Müjnir: Unable to find consumable jade_serpent_potion for potion,name=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=60
Müjnir: Unable to initialize consumable jade_serpent_potion for potion,name=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=60
Player Yåmm has duplicate buffs named 'nemesis' with source 'Yåmm' - the end is near.
Player Kehål has duplicate buffs named 'nemesis' with source 'Kehål' - the end is near.
Player Fluffy_Pillow has duplicate buffs named 'frailty' with source 'Fluffy_Pillow' - the end is near.
Player Yåmm has duplicate buffs named 'nemesis' with source 'Yåmm' - the end is near.
Player Kehål has duplicate buffs named 'nemesis' with source 'Kehål' - the end is near.
Player Fluffy_Pillow has duplicate buffs named 'frailty' with source 'Fluffy_Pillow' - the end is near.
Player Yåmm has duplicate buffs named 'nemesis' with source 'Yåmm' - the end is near.
Player Kehål has duplicate buffs named 'nemesis' with source 'Kehål' - the end is near.
Player Fluffy_Pillow has duplicate buffs named 'frailty' with source 'Fluffy_Pillow' - the end is near.
Player Yåmm has duplicate buffs named 'nemesis' with source 'Yåmm' - the end is near.
Player Kehål has duplicate buffs named 'nemesis' with source 'Kehål' - the end is near.
Player Fluffy_Pillow has duplicate buffs named 'frailty' with source 'Fluffy_Pillow' - the end is near.
Player Yåmm has duplicate buffs named 'nemesis' with source 'Yåmm' - the end is near.
Player Kehål has duplicate buffs named 'nemesis' with source 'Kehål' - the end is near.
Player Fluffy_Pillow has duplicate buffs named 'frailty' with source 'Fluffy_Pillow' - the end is near.
Player Yåmm has duplicate buffs named 'nemesis' with source 'Yåmm' - the end is near.
Player Kehål has duplicate buffs named 'nemesis' with source 'Kehål' - the end is near.
Player Fluffy_Pillow has duplicate buffs named 'frailty' with source 'Fluffy_Pillow' - the end is near.
Player Yåmm has duplicate buffs named 'nemesis' with source 'Yåmm' - the end is near.
Player Kehål has duplicate buffs named 'nemesis' with source 'Kehål' - the end is near.
Player Fluffy_Pillow has duplicate buffs named 'frailty' with source 'Fluffy_Pillow' - the end is near.
close

SimulationCraft 703-02

for World of Warcraft 7.0.3 Live (wow build level 22522, git build fac9690)

Current simulator hotfixes

Table of Contents

Raid Summary

 

Actions per Minute / DPS Variance Summary

Wadzak

Wadzak : 15529 dps, 88233 dtps, 0 hps (0 aps), 84.7k TMI, 84.8k ETMI

  • Race: Human
  • Class: Deathknight
  • Spec: Blood
  • Level: 110
  • Role: Tank
  • Position: front

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
15528.8 15528.8 14.3 / 0.092% 2790.8 / 18.0% -1.0
DTPS DTPS Error DTPS Range   TMI TMI Error TMI Min TMI Max TMI Range   MSD Mean MSD Min MSD Max MSD Freq.   Window Bin Size
88233.3 37.71 / 0.04% 7619 / 8.6%       84.7k 9 / 0.01% 82.6k 86.3k 1.8k / 2.1%       39.7% 34.1% 43.2% 8.4       6.00s 0.50s
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Runic Power 99.65% 1.3 100.0% 100%
Origin https://eu.api.battle.net/wow/character/hyjal/Wadzak/advanced
Talents
  • 15: Heartbreaker (Blood Death Knight)
  • 30: Spectral Deflection (Blood Death Knight)
  • 45: Ossuary (Blood Death Knight)
  • 60: Red Thirst (Blood Death Knight)
  • 75: Tremble Before Me (Blood Death Knight)
  • 90: Will of the Necropolis (Blood Death Knight)
  • 100: Purgatory (Blood Death Knight)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% B% Up%
Wadzak 15529
auto_attack_mh 9645 62.3% 143.9 3.15sec 30167 9631 Direct 143.9 25162 50319 30167 19.9% 7.5%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 143.93 143.93 0.00 0.00 3.1321 0.0000 4341985.39 6529997.48 33.51 9631.48 9631.48
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 106.65 74.10% 25741.03 24946 27377 25741.12 25234 26500 2745333 4035899 31.98
hit (blocked) 8.64 6.01% 18019.21 17462 19164 18019.19 17462 19164 155759 327116 52.38
crit 26.49 18.40% 51475.09 49891 54753 51473.79 49891 53619 1363544 2004539 31.98
crit (blocked) 2.15 1.49% 36050.96 34924 38327 31749.17 0 38327 77349 162443 46.13
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Deadly Grace 3250 20.7% 17.0 5.27sec 84973 0 Direct 17.0 70826 141653 84972 20.0% 0.0%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.96 16.96 0.00 0.00 0.0000 0.0000 1440921.19 1440921.19 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.57 80.03% 70826.31 70826 70826 70826.31 70826 70826 961138 961138 0.00
crit 3.39 19.97% 141652.62 141653 141653 138125.11 0 141653 479783 479783 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:5.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=47572 to 71358} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:47572.00
  • base_dd_max:71358.00
 
Gaseous Explosion (gaseous_bubble) 2634 17.0% 8.0 59.80sec 148777 0 Direct 8.0 124019 248038 148774 20.0% 0.0%  

Stats details: gaseous_bubble

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.97 7.97 0.00 0.00 0.0000 0.0000 1185020.76 1185020.76 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.38 80.04% 124018.99 124019 124019 124018.99 124019 124019 790626 790626 0.00
crit 1.59 19.96% 248037.98 248038 248038 205619.25 0 248038 394395 394395 0.00
 
 

Action details: gaseous_bubble

Static Values
  • id:214972
  • school:frost
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:214972
  • name:Gaseous Explosion
  • school:frost
  • tooltip:
  • description:{$@spelldesc214971=Become enveloped by a Gaseous Bubble that absorbs up to {$s1=212375} damage for {$d=8 seconds}. When the bubble is consumed or expires, it explodes and deals {$s2=94857} Frost damage to all nearby enemies within $214972A1 yards.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:104125.39
  • base_dd_max:104125.39
 
Simple Action Stats Execute Interval
Wadzak
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Wadzak
  • harmful:false
  • if_expr:
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Wadzak
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Wadzak
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 10.73% 0.0(0.0) 1.0

Buff details

  • buff initial source:Wadzak
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Demonbane 9.0 3.7 48.8sec 33.7sec 35.94% 35.94% 3.7(3.7) 8.7

Buff details

  • buff initial source:Wadzak
  • cooldown name:buff_demonbane
  • max_stacks:1
  • duration:15.00
  • cooldown:1.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:strength
  • amount:2310.00

Stack Uptimes

  • demonbane_1:35.94%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201405
  • name:Demonbane
  • tooltip:Strength increased by {$s1=2205}. Damage to Demons increased by {$s2=10}%.
  • description:Increases Strength by {$s1=2205}. Increases damage to Demons by {$s2=10}%.
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Gaseous Bubble 8.0 0.0 60.0sec 60.0sec 5.90% 71.00% 0.0(0.0) 0.1

Buff details

  • buff initial source:Wadzak
  • cooldown name:buff_gaseous_bubble
  • max_stacks:1
  • duration:8.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:233125.00

Stack Uptimes

  • gaseous_bubble_1:5.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:214971
  • name:Gaseous Bubble
  • tooltip:Absorbs $w1 damage. Causes a Gaseous Explosion when removed.
  • description:Become enveloped by a Gaseous Bubble that absorbs up to {$s1=212375} damage for {$d=8 seconds}. When the bubble is consumed or expires, it explodes and deals {$s2=94857} Frost damage to all nearby enemies within $214972A1 yards.
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
Potion of Deadly Grace 2.0 0.0 58.0sec 0.0sec 10.83% 10.86% 0.0(0.0) 2.0

Buff details

  • buff initial source:Wadzak
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:10.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Wadzak
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Countless Armies

Buff details

  • buff initial source:Wadzak
  • cooldown name:buff_flask_of_the_countless_armies
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:strength
  • amount:1300.00

Stack Uptimes

  • flask_of_the_countless_armies_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188034
  • name:Flask of the Countless Armies
  • tooltip:Strength increased by $w1.
  • description:Increases Strength by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Stoneskin Gargoyle

Buff details

  • buff initial source:Wadzak
  • cooldown name:buff_stoneskin_gargoyle
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stoneskin_gargoyle_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:62157
  • name:Stoneskin Gargoyle
  • tooltip:
  • description:
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (the_hungry_magister)

Buff details

  • buff initial source:Wadzak
  • cooldown name:buff_the_hungry_magister
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:375.00

Stack Uptimes

  • the_hungry_magister_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225602
  • name:Well Fed
  • tooltip:Critical Strike increased by $w1.
  • description:Increases critical strike by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Wadzak
Resource RPS-Gain RPS-Loss
Health 2525.31 88238.87
Combat End Resource Mean Min Max
Runic Power 0.00 0.00 0.00
Rune 6.00 6.00 6.00

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval
parry_haste 26.1 16.5sec

Statistics & Data Analysis

Fight Length
Sample Data Wadzak Fight Length
Count 9999
Mean 450.42
Minimum 350.15
Maximum 555.44
Spread ( max - min ) 205.29
Range [ ( max - min ) / 2 * 100% ] 22.79%
DPS
Sample Data Wadzak Damage Per Second
Count 9999
Mean 15528.82
Minimum 13477.24
Maximum 18715.66
Spread ( max - min ) 5238.42
Range [ ( max - min ) / 2 * 100% ] 16.87%
Standard Deviation 730.0840
5th Percentile 14417.98
95th Percentile 16793.10
( 95th Percentile - 5th Percentile ) 2375.12
Mean Distribution
Standard Deviation 7.3012
95.00% Confidence Intervall ( 15514.51 - 15543.13 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 84
0.1% Error 8491
0.1 Scale Factor Error with Delta=300 4550
0.05 Scale Factor Error with Delta=300 18200
0.01 Scale Factor Error with Delta=300 455018
Priority Target DPS
Sample Data Wadzak Priority Target Damage Per Second
Count 9999
Mean 15528.82
Minimum 13477.24
Maximum 18715.66
Spread ( max - min ) 5238.42
Range [ ( max - min ) / 2 * 100% ] 16.87%
Standard Deviation 730.0840
5th Percentile 14417.98
95th Percentile 16793.10
( 95th Percentile - 5th Percentile ) 2375.12
Mean Distribution
Standard Deviation 7.3012
95.00% Confidence Intervall ( 15514.51 - 15543.13 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 84
0.1% Error 8491
0.1 Scale Factor Error with Delta=300 4550
0.05 Scale Factor Error with Delta=300 18200
0.01 Scale Factor Error with Delta=300 455018
DPS(e)
Sample Data Wadzak Damage Per Second (Effective)
Count 9999
Mean 15528.82
Minimum 13477.24
Maximum 18715.66
Spread ( max - min ) 5238.42
Range [ ( max - min ) / 2 * 100% ] 16.87%
Damage
Sample Data Wadzak Damage
Count 9999
Mean 6967927.34
Minimum 5342603.02
Maximum 8902135.46
Spread ( max - min ) 3559532.44
Range [ ( max - min ) / 2 * 100% ] 25.54%
DTPS
Sample Data Wadzak Damage Taken Per Second
Count 9999
Mean 88233.27
Minimum 80691.83
Maximum 95256.66
Spread ( max - min ) 14564.83
Range [ ( max - min ) / 2 * 100% ] 8.25%
Standard Deviation 1923.6732
5th Percentile 84982.59
95th Percentile 91336.39
( 95th Percentile - 5th Percentile ) 6353.80
Mean Distribution
Standard Deviation 19.2377
95.00% Confidence Intervall ( 88195.56 - 88270.97 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 18
0.1% Error 1825
0.1 Scale Factor Error with Delta=300 31589
0.05 Scale Factor Error with Delta=300 126359
0.01 Scale Factor Error with Delta=300 3158975
HPS
Sample Data Wadzak Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Wadzak Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Wadzak Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Wadzak Healing Taken Per Second
Count 9999
Mean 2524.40
Minimum 1951.31
Maximum 3535.14
Spread ( max - min ) 1583.83
Range [ ( max - min ) / 2 * 100% ] 31.37%
TMI
Sample Data Wadzak Theck-Meloree Index
Count 9999
Mean 84705.46
Minimum 82610.35
Maximum 86260.68
Spread ( max - min ) 3650.33
Range [ ( max - min ) / 2 * 100% ] 2.15%
Standard Deviation 447.6208
5th Percentile 83942.09
95th Percentile 85416.77
( 95th Percentile - 5th Percentile ) 1474.68
Mean Distribution
Standard Deviation 4.4764
95.00% Confidence Intervall ( 84696.68 - 84714.23 )
Normalized 95.00% Confidence Intervall ( 99.99% - 100.01% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 1
0.1% Error 107
0.1 Scale Factor Error with Delta=300 1710
0.05 Scale Factor Error with Delta=300 6841
0.01 Scale Factor Error with Delta=300 171042
ETMI
Sample Data WadzakTheck-Meloree Index (Effective)
Count 9999
Mean 84804.31
Minimum 82648.38
Maximum 86267.27
Spread ( max - min ) 3618.89
Range [ ( max - min ) / 2 * 100% ] 2.13%
Standard Deviation 439.4832
5th Percentile 84045.19
95th Percentile 85493.80
( 95th Percentile - 5th Percentile ) 1448.61
Mean Distribution
Standard Deviation 4.3951
95.00% Confidence Intervall ( 84795.69 - 84812.92 )
Normalized 95.00% Confidence Intervall ( 99.99% - 100.01% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 1
0.1% Error 103
0.1 Scale Factor Error with Delta=300 1648
0.05 Scale Factor Error with Delta=300 6595
0.01 Scale Factor Error with Delta=300 164880
MSD
Sample Data Wadzak Max Spike Value
Count 1247
Mean 39.74
Minimum 34.13
Maximum 43.23
Spread ( max - min ) 9.10
Range [ ( max - min ) / 2 * 100% ] 11.45%
Standard Deviation 1.9145
5th Percentile 35.89
95th Percentile 42.04
( 95th Percentile - 5th Percentile ) 6.15
Mean Distribution
Standard Deviation 0.0542
95.00% Confidence Intervall ( 39.64 - 39.85 )
Normalized 95.00% Confidence Intervall ( 99.73% - 100.27% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 89
0.1% Error 8914
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 3

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,name=countless_armies
1 0.00 food,name=the_hungry_magister
2 0.00 augmentation,name=defiled
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=deadly_grace
Default action list Executed every time the actor is available.
# count action,conditions
5 1.00 auto_attack
0.00 arcane_torrent,if=runic_power.deficit>20
0.00 blood_fury,if=!talent.breath_of_sindragosa.enabled|dot.breath_of_sindragosa.ticking
0.00 berserking
6 8.05 use_item,slot=trinket1
7 1.00 potion,name=deadly_grace
0.00 sindragosas_fury
8 0.00 run_action_list,name=bos,if=dot.breath_of_sindragosa.ticking
9 0.00 call_action_list,name=generic

Sample Sequence

01245676666666

Sample Sequence Table

time name target resources buffs
Pre flask Wadzak 0.0/115: 0% runic_power | 6.0/6: 100% rune
Pre food Wadzak 0.0/115: 0% runic_power | 6.0/6: 100% rune
Pre augmentation Wadzak 0.0/115: 0% runic_power | 6.0/6: 100% rune
Pre potion Fluffy_Pillow 0.0/115: 0% runic_power | 6.0/6: 100% rune potion_of_deadly_grace
0:00.000 auto_attack Fluffy_Pillow 0.0/115: 0% runic_power | 6.0/6: 100% rune potion_of_deadly_grace
0:00.000 use_item_giant_ornamental_pearl Fluffy_Pillow 0.0/115: 0% runic_power | 6.0/6: 100% rune potion_of_deadly_grace
0:00.000 Waiting 57.800 sec 0.0/115: 0% runic_power | 6.0/6: 100% rune gaseous_bubble, potion_of_deadly_grace
0:57.800 potion Fluffy_Pillow 0.0/115: 0% runic_power | 6.0/6: 100% rune
0:58.000 Waiting 1.800 sec 0.0/115: 0% runic_power | 6.0/6: 100% rune potion_of_deadly_grace
0:59.800 use_item_giant_ornamental_pearl Fluffy_Pillow 0.0/115: 0% runic_power | 6.0/6: 100% rune potion_of_deadly_grace
1:00.000 Waiting 59.800 sec 0.0/115: 0% runic_power | 6.0/6: 100% rune gaseous_bubble, potion_of_deadly_grace
1:59.800 use_item_giant_ornamental_pearl Fluffy_Pillow 0.0/115: 0% runic_power | 6.0/6: 100% rune
2:00.000 Waiting 59.800 sec 0.0/115: 0% runic_power | 6.0/6: 100% rune gaseous_bubble
2:59.800 use_item_giant_ornamental_pearl Fluffy_Pillow 0.0/115: 0% runic_power | 6.0/6: 100% rune
3:00.000 Waiting 59.800 sec 0.0/115: 0% runic_power | 6.0/6: 100% rune gaseous_bubble
3:59.800 use_item_giant_ornamental_pearl Fluffy_Pillow 0.0/115: 0% runic_power | 6.0/6: 100% rune demonbane
4:00.000 Waiting 59.800 sec 0.0/115: 0% runic_power | 6.0/6: 100% rune gaseous_bubble, demonbane
4:59.800 use_item_giant_ornamental_pearl Fluffy_Pillow 0.0/115: 0% runic_power | 6.0/6: 100% rune
5:00.000 Waiting 59.800 sec 0.0/115: 0% runic_power | 6.0/6: 100% rune gaseous_bubble
5:59.800 use_item_giant_ornamental_pearl Fluffy_Pillow 0.0/115: 0% runic_power | 6.0/6: 100% rune
6:00.000 Waiting 59.800 sec 0.0/115: 0% runic_power | 6.0/6: 100% rune gaseous_bubble
6:59.800 use_item_giant_ornamental_pearl Fluffy_Pillow 0.0/115: 0% runic_power | 6.0/6: 100% rune
7:00.000 Waiting 27.600 sec 0.0/115: 0% runic_power | 6.0/6: 100% rune gaseous_bubble

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 20146 18521 8289 (6497)
Agility 7857 7532 0
Stamina 39829 37932 15102
Intellect 4327 4002 0
Spirit 0 0 0
Health 2389740 2275920 0
Runic Power 115 115 0
Rune 6 6 0
Crit 19.93% 18.84% 4844
Haste 4.82% 4.82% 1565
Damage / Heal Versatility 9.78% 9.78% 3910
Mitigation Versatility 4.89% 4.89% 3910
Attack Power 25440 23388 0
Mastery 39.42% 39.42% 6397
Armor 4660 4438 3859
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 18.45% 17.02% 4844
Tank-Block 0.00% 0.00% 0
Tank-Crit -6.00% -6.00% 0

Gear

Source Slot Average Item Level: 824.00
Local Head Crown of Fallen Kings
ilevel: 830, stats: { 531 Armor, +1614 Sta, +1077 StrInt, +866 Crit, +345 Mastery }
Local Neck Raven Filigree Pendant
ilevel: 830, stats: { +908 Sta, +1070 Vers, +632 Mastery }
Local Shoulders Pauldrons of the All-Father
ilevel: 840, stats: { 501 Armor, +1329 Sta, +886 StrInt, +552 Haste, +391 Mastery }
Local Chest Skoldiir Breastplate
ilevel: 825, stats: { 646 Armor, +1028 StrInt, +1542 Sta, +748 Crit, +441 Mastery }
Local Waist Greatbelt of Alpha Dominance
ilevel: 840, stats: { 376 Armor, +1329 Sta, +886 StrInt, +633 Crit, +310 Haste }
Local Legs Deathlord's Legguards
ilevel: 830, stats: { 571 Armor, +1614 Sta, +1077 Str, +866 Mastery, +345 Haste }
Local Feet Coralplate Sandstompers
ilevel: 815, stats: { 434 Armor, +702 StrInt, +1053 Sta, +503 Mastery, +355 Vers }
Local Wrists Wristbands of Magnificent Splendor
ilevel: 850, stats: { 299 Armor, +729 StrInt, +1094 Sta, +461 Vers, +273 Crit }
Local Hands Earthguard Gauntlets
ilevel: 800, stats: { 382 Armor, +611 StrInt, +916 Sta, +319 Crit, +493 Vers }
Local Finger1 Signet of the Highborne Magi
ilevel: 845, stats: { +1045 Sta, +1132 Mastery, +669 Crit }
Local Finger2 Ring of Minute Mirrors
ilevel: 805, stats: { +719 Sta, +931 Mastery, +620 Vers }
Local Trinket1 Giant Ornamental Pearl
ilevel: 820, stats: { +834 Vers }
Local Trinket2 Gronntooth War Horn
ilevel: 815, stats: { +327 Mastery, +327 Crit, +327 Haste }
Local Back Cloak of Unwavering Loyalty
ilevel: 825, stats: { 119 Armor, +578 StrAgiInt, +867 Sta, +430 Crit, +239 Mastery }
Local Main Hand Maw of the Damned
ilevel: 786, weapon: { 3697 - 5548, 3.6 }, stats: { +715 Str, +1072 Sta, +484 Crit, +465 Mastery }, enchant: rune_of_the_stoneskin_gargoyle, relics: { +36 ilevels }

Talents

Level
15 Bloodworms (Blood Death Knight) Heartbreaker (Blood Death Knight) Blooddrinker (Blood Death Knight)
30 Rapid Decomposition (Blood Death Knight) Soulgorge (Blood Death Knight) Spectral Deflection (Blood Death Knight)
45 Ossuary (Blood Death Knight) Blood Tap (Blood Death Knight) Anti-Magic Barrier (Blood Death Knight)
60 Mark of Blood (Blood Death Knight) Red Thirst (Blood Death Knight) Tombstone (Blood Death Knight)
75 Tightening Grasp (Blood Death Knight) Tremble Before Me (Blood Death Knight) March of the Damned (Blood Death Knight)
90 Will of the Necropolis (Blood Death Knight) Rune Tap (Blood Death Knight) Foul Bulwark (Blood Death Knight)
100 Bonestorm (Blood Death Knight) Blood Mirror (Blood Death Knight) Purgatory (Blood Death Knight)

Profile

deathknight="Wadzak"
origin="https://eu.api.battle.net/wow/character/hyjal/Wadzak/advanced"
thumbnail="http://eu.battle.net/static-render/eu/hyjal/146/135744402-avatar.jpg"
level=110
race=human
role=tank
position=front
talents=http://eu.battle.net/wow/en/tool/talent-calculator#da!1201102
artifact=15:0:0:0:0:274:3:277:3:279:2:281:1:284:1:289:1:1331:1
spec=blood

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,name=countless_armies
actions.precombat+=/food,name=the_hungry_magister
actions.precombat+=/augmentation,name=defiled
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=deadly_grace

# Executed every time the actor is available.
actions=auto_attack
actions+=/arcane_torrent,if=runic_power.deficit>20
actions+=/blood_fury,if=!talent.breath_of_sindragosa.enabled|dot.breath_of_sindragosa.ticking
actions+=/berserking
actions+=/use_item,slot=trinket1
actions+=/potion,name=deadly_grace
actions+=/sindragosas_fury
actions+=/run_action_list,name=bos,if=dot.breath_of_sindragosa.ticking
actions+=/call_action_list,name=generic

actions.bos=call_action_list,name=core
actions.bos+=/empower_rune_weapon,if=runic_power<=70

actions.generic=call_action_list,name=core
actions.generic+=/empower_rune_weapon,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains>15
actions.generic+=/empower_rune_weapon,if=!talent.breath_of_sindragosa.enabled

head=crown_of_fallen_kings,id=133629,bonus_id=1726/1808/1482/3339
neck=raven_filigree_pendant,id=134499,bonus_id=1726/1482/3339
shoulders=pauldrons_of_the_allfather,id=133631,bonus_id=1727/1492/1813
back=cloak_of_unwavering_loyalty,id=134412,bonus_id=1726/1808/1477
chest=skoldiir_breastplate,id=134179,bonus_id=1726/1487/1675
wrists=wristbands_of_magnificent_splendor,id=139283,bonus_id=1727/1502/3336
hands=earthguard_gauntlets,id=141010
waist=greatbelt_of_alpha_dominance,id=136773,bonus_id=1727/1492/1813
legs=deathlords_legguards,id=139677,bonus_id=3385/3383
feet=coralplate_sandstompers,id=134229,bonus_id=1824/1477/3339
finger1=signet_of_the_highborne_magi,id=134537,bonus_id=1726/1497/3337
finger2=ring_of_minute_mirrors,id=137533,bonus_id=1826/1457
trinket1=giant_ornamental_pearl,id=137369,bonus_id=1826/1808/1472/3338
trinket2=gronntooth_war_horn,id=133595
main_hand=maw_of_the_damned,id=128402,gem_id=137544/0/0/0,relic_id=1726:1477/0/0/0,enchant=rune_of_the_stoneskin_gargoyle

# Gear Summary
# gear_ilvl=823.73
# gear_strength=8289
# gear_stamina=15102
# gear_crit_rating=4749
# gear_haste_rating=1534
# gear_mastery_rating=6272
# gear_versatility_rating=3833
# gear_armor=3859

Decalang

Decalang : 121156 dps

  • Race: Draenei
  • Class: Deathknight
  • Spec: Frost
  • Level: 110
  • Role: Attack
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
121155.6 121155.6 63.0 / 0.052% 12695.2 / 10.5% 22092.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
5.5 5.5 Runic Power 14.95% 40.9 100.0% 100%
Origin https://eu.api.battle.net/wow/character/hyjal/Decalang/advanced
Talents
  • 15: Shattering Strikes (Frost Death Knight)
  • 30: Horn of Winter (Frost Death Knight)
  • 45: Avalanche (Frost Death Knight)
  • 60: Blinding Sleet (Frost Death Knight)
  • 75: White Walker (Frost Death Knight)
  • 90: Frostscythe (Frost Death Knight)
  • 100: Glacial Advance (Frost Death Knight)
  • Talent Calculator
Artifact
Professions
  • mining: 759
  • jewelcrafting: 746

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Decalang 121156
auto_attack_mh 7308 6.0% 223.7 2.02sec 14711 7311 Direct 223.7 14752 29503 14711 18.7% 19.0%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 223.65 223.65 0.00 0.00 2.0120 0.0000 3290073.80 4836720.13 31.98 7311.31 7311.31
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 139.38 62.32% 14752.34 12854 16989 14753.13 14209 15231 2056161 3022751 31.98
crit 41.82 18.70% 29503.43 25708 33979 29505.30 27640 31616 1233913 1813969 31.98
miss 42.45 18.98% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 3660 3.0% 223.7 2.02sec 7368 3662 Direct 223.7 7395 14792 7368 18.7% 19.1%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 223.65 223.65 0.00 0.00 2.0120 0.0000 1647890.11 2422554.56 31.98 3661.99 3661.99
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 139.16 62.22% 7395.15 6427 8495 7395.56 7152 7616 1029141 1512935 31.98
crit 41.83 18.70% 14792.14 12854 16989 14792.72 13720 15838 618749 909620 31.98
miss 42.66 19.07% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Avalanche 3530 2.9% 61.1 7.19sec 25984 0 Direct 61.1 21921 43835 25984 18.5% 0.0%  

Stats details: avalanche

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.06 61.06 0.00 0.00 0.0000 0.0000 1586574.44 1586574.44 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.74 81.46% 21920.66 18776 23751 21921.35 20361 23133 1090275 1090275 0.00
crit 11.32 18.54% 43834.80 37552 47503 43840.50 38303 47287 496300 496300 0.00
 
 

Action details: avalanche

Static Values
  • id:207150
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:207150
  • name:Avalanche
  • school:frost
  • tooltip:
  • description:{$@spelldesc207142=While Pillar of Frost is active, your melee critical strikes cause jagged icicles to fall on your nearby enemies, dealing {$207150s1=0} Frost damage.}
 
Caber Impact (caber_toss) 2 0.0% 3.0 180.33sec 259 0 Direct 3.0 218 436 259 18.8% 0.0%  

Stats details: caber_toss

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.02 3.02 0.00 0.00 0.0000 0.0000 781.99 1149.60 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.45 81.18% 217.88 218 218 216.53 0 218 534 785 31.78
crit 0.57 18.82% 435.76 436 436 204.22 0 436 248 364 14.99
 
 

Action details: caber_toss

Static Values
  • id:193347
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193347
  • name:Caber Impact
  • school:physical
  • tooltip:
  • description:Deals physical damage to the enemisies in the vicinity of where the caber lands.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:306.18
  • base_dd_max:306.18
 
Crystalline Swords 8626 7.1% 73.7 12.11sec 52703 0 Direct 73.7 44420 88860 52704 18.6% 0.0%  

Stats details: crystalline_swords

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.69 73.69 0.00 0.00 0.0000 0.0000 3883672.65 3883672.65 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 59.95 81.36% 44420.25 34137 57003 44427.15 41637 47416 2663209 2663209 0.00
crit 13.73 18.64% 88859.90 68274 114006 88862.31 75150 103983 1220464 1220464 0.00
 
 

Action details: crystalline_swords

Static Values
  • id:205165
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:0.3000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205165
  • name:Crystalline Swords
  • school:frost
  • tooltip:
  • description:{$@spelldesc189186=Your melee attacks have a chance to create icy copies of |cFFFFCC99Icebringer|r and |cFFFFCC99Frostreaper|r, which will then stab and pierce your foes.}
 
Deadly Grace 3802 3.1% 22.8 3.83sec 73795 0 Direct 22.8 62245 124490 73795 18.6% 0.0%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.84 22.84 0.00 0.00 0.0000 0.0000 1685264.86 1685264.86 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.60 81.44% 62244.99 62245 62245 62244.99 62245 62245 1157736 1157736 0.00
crit 4.24 18.56% 124489.98 124490 124490 123170.25 0 124490 527529 527529 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:5.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=47572 to 71358} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:47572.00
  • base_dd_max:71358.00
 
Frost Fever 7900 6.5% 38.0 12.06sec 93519 0 Periodic 149.8 20019 40057 23750 18.6% 0.0% 99.1%

Stats details: frost_fever

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.05 0.00 149.82 149.82 0.0000 2.9794 3558195.75 3558195.75 0.00 7971.40 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 121.9 81.38% 20019.39 5 26126 20021.38 18887 20921 2440822 2440822 0.00
crit 27.9 18.62% 40057.00 69 52253 40061.48 35090 46413 1117374 1117374 0.00
 
 

Action details: frost_fever

Static Values
  • id:55095
  • school:frost
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:55095
  • name:Frost Fever
  • school:frost
  • tooltip:Suffering $w1 Frost damage every $t1 sec.
  • description:A disease that deals ${8*{$s1=0}} Frost damage over {$d=24 seconds} and has a chance to grant the Death Knight ${$195617m1/10} Runic Power each time it deals damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.550000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:24.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Frost Strike 0 (33601) 0.0% (27.7%) 98.7 4.50sec 153265 117040

Stats details: frost_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.70 0.00 0.00 0.00 1.3095 0.0000 0.00 0.00 0.00 117040.14 117040.14
 
 

Action details: frost_strike

Static Values
  • id:49143
  • school:frost
  • resource:runic_power
  • range:13.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:runic_power>=80
Spelldata
  • id:49143
  • name:Frost Strike
  • school:frost
  • tooltip:
  • description:Chill your weapons with icy power, and quickly strike the enemy with both weapons, dealing a total of ${$222026sw1+$66196sw1} Frost damage.
 
    Frost Strike (_mh) 22400 18.5% 98.7 4.50sec 102174 0 Direct 98.7 86123 172342 102175 18.6% 0.0%  

Stats details: frost_strike_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.70 98.70 0.00 0.00 0.0000 0.0000 10084087.13 10084087.13 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 80.32 81.38% 86122.87 58339 130220 86142.19 79010 92814 6917661 6917661 0.00
crit 18.37 18.62% 172342.20 116677 260440 172378.40 136793 214473 3166426 3166426 0.00
 
 

Action details: frost_strike_mh

Static Values
  • id:222026
  • school:frost
  • resource:none
  • range:108.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222026
  • name:Frost Strike
  • school:frost
  • tooltip:
  • description:Instantly strike the enemy with your off-hand weapon, causing $sw2 Frost damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.50
 
    Frost Strike Off-Hand 11201 9.3% 98.7 4.50sec 51092 0 Direct 98.7 43073 86098 51091 18.6% 0.0%  

Stats details: frost_strike_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.70 98.70 0.00 0.00 0.0000 0.0000 5042531.95 5042531.95 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 80.30 81.36% 43072.56 29171 65113 43085.93 39826 46317 3458779 3458779 0.00
crit 18.39 18.64% 86097.69 58342 130226 86130.07 69519 106619 1583753 1583753 0.00
 
 

Action details: frost_strike_offhand

Static Values
  • id:66196
  • school:frost
  • resource:none
  • range:108.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:66196
  • name:Frost Strike Off-Hand
  • school:frost
  • tooltip:
  • description:Instantly strike the enemy with your off-hand weapon, causing $sw2 Frost damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.50
 
Frostscythe 12732 10.5% 29.8 15.03sec 192587 146948 Direct 29.8 0 192586 192586 100.0% 0.0%  

Stats details: frostscythe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.76 29.76 0.00 0.00 1.3106 0.0000 5732151.99 5732151.99 0.00 146948.11 146948.11
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 29.76 100.00% 192585.51 152325 242868 192603.53 177680 210563 5732152 5732152 0.00
 
 

Action details: frostscythe

Static Values
  • id:207230
  • school:frost
  • resource:rune
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.breath_of_sindragosa.enabled&(buff.killing_machine.react|spell_targets.frostscythe>=4)
Spelldata
  • id:207230
  • name:Frostscythe
  • school:frost
  • tooltip:
  • description:A sweeping attack that strikes all enemies in front of you for $sw1 Frost damage. This attack benefits from Killing Machine. Critical strikes with Frostscythe deal {$s3=4} times normal damage.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.20
 
Glacial Advance 0 (11628) 0.0% (9.6%) 31.9 14.29sec 163946 125371

Stats details: glacial_advance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.92 0.00 0.00 0.00 1.3077 0.0000 0.00 0.00 0.00 125370.68 125370.68
 
 

Action details: glacial_advance

Static Values
  • id:194913
  • school:frost
  • resource:rune
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:194913
  • name:Glacial Advance
  • school:shadow
  • tooltip:
  • description:Summon glacial spikes from the ground that advance forward, each dealing {$195975s1=0} Frost damage to enemies near their eruption point.
 
    Glacial Advance (_damage) 11628 9.6% 31.9 14.29sec 163946 0 Direct 31.9 138099 276264 163945 18.7% 0.0%  

Stats details: glacial_advance_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.92 31.92 0.00 0.00 0.0000 0.0000 5233348.37 5233348.37 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 25.95 81.29% 138098.78 106678 178135 138115.47 127503 151180 3583601 3583601 0.00
crit 5.97 18.71% 276264.08 213357 356270 275711.48 0 356270 1649747 1649747 0.00
 
 

Action details: glacial_advance_damage

Static Values
  • id:195975
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:195975
  • name:Glacial Advance
  • school:frost
  • tooltip:
  • description:Summon glacial spikes from the ground that advance forward, damaging enemies near their eruption point for {$s1=0} frost damage.
 
Howling Blast 9958 8.2% 38.0 12.06sec 117786 90130 Direct 38.0 99180 198422 117788 18.8% 0.0%  

Stats details: howling_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.05 38.05 0.00 0.00 1.3069 0.0000 4481509.85 4481509.85 0.00 90129.51 90129.51
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.91 81.25% 99179.61 19913 133007 98984.49 68658 113456 3065953 3065953 0.00
crit 7.13 18.75% 198422.47 39827 266015 197831.40 0 266015 1415557 1415557 0.00
 
 

Action details: howling_blast

Static Values
  • id:49184
  • school:frost
  • resource:rune
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49184
  • name:Howling Blast
  • school:frost
  • tooltip:
  • description:Blast the target with a frigid wind, dealing {$s2=0} {$?s204088=false}[Frost damage and applying Frost Fever to the target.][Frost damage to that foe, and ${($m1/100)*$m2} Frost damage to all other enemies within 10 yards, infecting all targets with Frost Fever.] |Tinterface\icons\spell_deathknight_frostfever.blp:24|t |cFFFFFFFFFrost Fever|r {$@spelldesc55095=A disease that deals ${8*{$s1=0}} Frost damage over {$d=24 seconds} and has a chance to grant the Death Knight ${$195617m1/10} Runic Power each time it deals damage.}
 
Obliterate 0 (15590) 0.0% (12.9%) 78.3 5.75sec 89658 68870

Stats details: obliterate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 78.25 0.00 0.00 0.00 1.3018 0.0000 0.00 0.00 0.00 68870.27 68870.27
 
 

Action details: obliterate

Static Values
  • id:49020
  • school:physical
  • resource:rune
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.killing_machine.react
Spelldata
  • id:49020
  • name:Obliterate
  • school:physical
  • tooltip:
  • description:A brutal attack with both weapons that deals a total of ${$222024sw1+$66198sw1} Physical damage.
 
    Obliterate (_mh) 10396 8.6% 78.3 5.75sec 59785 0 Direct 78.3 44350 110023 59785 23.5% 0.0%  

Stats details: obliterate_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 78.25 78.25 0.00 0.00 0.0000 0.0000 4678384.44 6877668.27 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 59.86 76.50% 44350.30 38455 50672 44359.56 42630 46178 2654947 3903024 31.98
crit 18.39 23.50% 110023.03 95369 125666 110041.65 100353 120165 2023437 2974644 31.98
 
 

Action details: obliterate_mh

Static Values
  • id:222024
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222024
  • name:Obliterate
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack with both weapons that deals a total of ${$222024sw1+$66198sw1} Physical damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.20
 
    Obliterate Off-Hand 5194 4.3% 78.3 5.75sec 29873 0 Direct 78.3 22176 55016 29873 23.4% 0.0%  

Stats details: obliterate_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 78.25 78.25 0.00 0.00 0.0000 0.0000 2337705.24 3436648.13 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 59.91 76.56% 22176.06 19229 25337 22180.05 21299 23236 1328628 1953209 31.98
crit 18.34 23.44% 55016.20 47688 62836 55028.16 50080 59780 1009078 1483440 31.98
 
 

Action details: obliterate_offhand

Static Values
  • id:66198
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:66198
  • name:Obliterate Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack with both weapons that deals a total of ${$222024sw1+$66198sw1} Physical damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.20
 
Razorice (_oh) 2818 2.3% 357.9 1.26sec 3544 0 Direct 357.9 2985 5969 3544 18.7% 0.0%  

Stats details: razorice_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 357.92 357.92 0.00 0.00 0.0000 0.0000 1268523.75 1268523.75 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 290.84 81.26% 2984.66 2496 3629 2985.14 2888 3080 868049 868049 0.00
crit 67.09 18.74% 5969.45 4992 7258 5970.56 5588 6411 400475 400475 0.00
 
 

Action details: razorice_oh

Static Values
  • id:50401
  • school:frost
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:50401
  • name:Razorice
  • school:frost
  • tooltip:
  • description:{$@spelldesc53343=Affixes your weapon with a rune that causes {$50401s1=0}% extra weapon damage as Frost damage and increases enemies' vulnerability to your Frost attacks by {$51714s1=2}%, stacking up to {$51714u=5} times. Modifying your rune weapon requires a Rune Forge in Ebon Hold.}
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.10
 
Simple Action Stats Execute Interval
Decalang
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Decalang
  • harmful:false
  • if_expr:
 
Empower Rune Weapon 2.8 185.75sec

Stats details: empower_rune_weapon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.78 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: empower_rune_weapon

Static Values
  • id:47568
  • school:physical
  • resource:runic_power
  • range:0.0
  • travel_speed:4.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:runic_power<=70
Spelldata
  • id:47568
  • name:Empower Rune Weapon
  • school:physical
  • tooltip:
  • description:Empower your rune weapon, immediately activating all your runes and generating {$s3=25} Runic Power.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Decalang
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Decalang
  • harmful:false
  • if_expr:
 
Horn of Winter 14.9 30.88sec

Stats details: horn_of_winter

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.91 0.00 0.00 0.00 1.3049 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: horn_of_winter

Static Values
  • id:57330
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:57330
  • name:Horn of Winter
  • school:physical
  • tooltip:
  • description:Blow the Horn of Winter, gaining {$s1=2} $Lrune:runes; and generating ${{$s2=100}/10} Runic Power.
 
Pillar of Frost 8.0 60.31sec

Stats details: pillar_of_frost

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.99 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: pillar_of_frost

Static Values
  • id:51271
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:51271
  • name:Pillar of Frost
  • school:physical
  • tooltip:Strength increased by {$s1=20}%.
  • description:The power of Frost increases your Strength by {$s1=20}%, and grants immunity to external movement effects such as knockbacks. Lasts {$d=20 seconds}.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Unholy Strength 29.4 15.32sec

Stats details: unholy_strength

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 29.42 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: unholy_strength

Static Values
  • id:53365
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Decalang
  • harmful:true
  • if_expr:
Spelldata
  • id:53365
  • name:Unholy Strength
  • school:physical
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 11.74% 0.0(0.0) 1.0

Buff details

  • buff initial source:Decalang
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Killing Machine 34.5 1.3 13.1sec 12.6sec 15.36% 24.08% 1.3(1.3) 0.0

Buff details

  • buff initial source:Decalang
  • cooldown name:buff_killing_machine
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1000.00

Stack Uptimes

  • killing_machine_1:15.36%

Trigger Attempt Success

  • trigger_pct:43.15%

Spelldata details

  • id:51124
  • name:Killing Machine
  • tooltip:Guaranteed critical strike on your next Obliterate{$?s207230=false}[ or Frostscythe][].
  • description:Your auto attack has a chance to cause your next Obliterate {$?s207230=false}[or Frostscythe ][]to be a guaranteed critical strike.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Pillar of Frost 8.0 0.0 60.3sec 60.3sec 34.63% 34.00% 0.0(0.0) 7.6

Buff details

  • buff initial source:Decalang
  • cooldown name:buff_pillar_of_frost
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • pillar_of_frost_1:34.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:51271
  • name:Pillar of Frost
  • tooltip:Strength increased by {$s1=20}%.
  • description:The power of Frost increases your Strength by {$s1=20}%, and grants immunity to external movement effects such as knockbacks. Lasts {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:60.00
  • default_chance:0.00%
Potion of Deadly Grace 2.0 0.0 58.3sec 0.0sec 10.83% 10.89% 0.0(0.0) 2.0

Buff details

  • buff initial source:Decalang
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:10.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Rime 35.1 0.1 12.7sec 12.7sec 10.45% 47.76% 0.1(0.1) 0.0

Buff details

  • buff initial source:Decalang
  • cooldown name:buff_rime
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:45.00%
  • default_value:-0.00

Stack Uptimes

  • rime_1:10.45%

Trigger Attempt Success

  • trigger_pct:45.00%

Spelldata details

  • id:59052
  • name:Rime
  • tooltip:Your next Howling Blast will consume no Runes, generate no Runic Power, and deals {$s2=300}% additional damage.
  • description:Your next Howling Blast will consume no Runes, generate no Runic Power, and deal {$s2=300}% additional damage.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Unholy Strength 12.6 16.8 36.4sec 15.3sec 66.14% 65.87% 16.8(16.8) 12.0

Buff details

  • buff initial source:Decalang
  • cooldown name:buff_unholy_strength
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • unholy_strength_1:66.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:53365
  • name:Unholy Strength
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Decalang
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Countless Armies

Buff details

  • buff initial source:Decalang
  • cooldown name:buff_flask_of_the_countless_armies
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:strength
  • amount:1300.00

Stack Uptimes

  • flask_of_the_countless_armies_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188034
  • name:Flask of the Countless Armies
  • tooltip:Strength increased by $w1.
  • description:Increases Strength by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (the_hungry_magister)

Buff details

  • buff initial source:Decalang
  • cooldown name:buff_the_hungry_magister
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:375.00

Stack Uptimes

  • the_hungry_magister_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225602
  • name:Well Fed
  • tooltip:Critical Strike increased by $w1.
  • description:Increases critical strike by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Windwalking (_movement_aura)

Buff details

  • buff initial source:Decalang
  • cooldown name:buff_windwalking_movement_aura
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • windwalking_movement_aura_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:166646
  • name:Windwalking
  • tooltip:Movement speed increased by {$s1=10}%.
  • description:
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%

Rune waste details (experimental)

In the table below, "Seconds per Rune" denotes the time in seconds an individual rune is wasting regeneration. The "Total Seconds per Iteration" denotes the cumulative time in seconds all runes wasted during a single iteration.

Seconds per Rune (n=120300)
Minimum 5th percentile Mean / Median 95th percentile Maximum
0.0010.0651.176 / 1.2212.6924.540
Total Seconds per Iteration (n=10007)
Minimum 5th percentile Mean / Median 95th percentile Maximum
5.9539.49714.136 / 13.98719.36728.674

Resources

Resource Usage Type Count Total Average RPE APR
Decalang
frost_strike Runic Power 98.7 2467.4 25.0 25.0 6130.6
frostscythe Rune 29.8 29.8 1.0 1.0 192592.1
glacial_advance Rune 31.9 31.9 1.0 1.0 163945.6
howling_blast Rune 38.0 3.0 0.1 0.1 1484933.3
obliterate Rune 78.3 156.5 2.0 2.0 44828.0
Resource Gains Type Count Total Average Overflow
howling_blast Runic Power 3.02 30.18 (1.21%) 10.00 0.00 0.00%
glacial_advance Runic Power 31.92 319.21 (12.77%) 10.00 0.00 0.00%
frostscythe Runic Power 29.76 297.63 (11.91%) 10.00 0.00 0.00%
obliterate Runic Power 78.26 1565.11 (62.62%) 20.00 0.00 0.00%
Horn of Winter Runic Power 14.91 149.13 (5.97%) 10.00 0.00 0.00%
Horn of Winter Rune 29.83 29.83 (13.81%) 1.00 0.00 0.00%
Frost Fever Runic Power 27.62 138.11 (5.53%) 5.00 0.00 0.00%
Rune Regeneration Rune 146.50 146.50 (67.81%) 1.00 0.00 0.00%
Runic Empowerment Rune 24.62 24.62 (11.39%) 1.00 0.00 0.00%
Empower Rune Weapon Rune 15.11 15.11 (6.99%) 1.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Runic Power 5.55 5.48
Rune 0.48 0.49
Combat End Resource Mean Min Max
Runic Power 32.15 0.00 100.00
Rune 0.84 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Runic Power Cap 0.0%

Procs

Count Interval
Killing Machine: Obliterate 4.6 78.3sec
Killing Machine: Frostscythe 29.8 15.1sec
Rune ready 216.1 2.7sec

Statistics & Data Analysis

Fight Length
Sample Data Decalang Fight Length
Count 9999
Mean 450.42
Minimum 350.15
Maximum 555.44
Spread ( max - min ) 205.29
Range [ ( max - min ) / 2 * 100% ] 22.79%
DPS
Sample Data Decalang Damage Per Second
Count 9999
Mean 121155.61
Minimum 109967.15
Maximum 134596.48
Spread ( max - min ) 24629.33
Range [ ( max - min ) / 2 * 100% ] 10.16%
Standard Deviation 3215.1344
5th Percentile 115880.62
95th Percentile 126551.38
( 95th Percentile - 5th Percentile ) 10670.76
Mean Distribution
Standard Deviation 32.1530
95.00% Confidence Intervall ( 121092.59 - 121218.63 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 27
0.1% Error 2705
0.1 Scale Factor Error with Delta=300 88243
0.05 Scale Factor Error with Delta=300 352973
0.01 Scale Factor Error with Delta=300 8824333
Priority Target DPS
Sample Data Decalang Priority Target Damage Per Second
Count 9999
Mean 121155.61
Minimum 109967.15
Maximum 134596.48
Spread ( max - min ) 24629.33
Range [ ( max - min ) / 2 * 100% ] 10.16%
Standard Deviation 3215.1344
5th Percentile 115880.62
95th Percentile 126551.38
( 95th Percentile - 5th Percentile ) 10670.76
Mean Distribution
Standard Deviation 32.1530
95.00% Confidence Intervall ( 121092.59 - 121218.63 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 27
0.1% Error 2705
0.1 Scale Factor Error with Delta=300 88243
0.05 Scale Factor Error with Delta=300 352973
0.01 Scale Factor Error with Delta=300 8824333
DPS(e)
Sample Data Decalang Damage Per Second (Effective)
Count 9999
Mean 121155.61
Minimum 109967.15
Maximum 134596.48
Spread ( max - min ) 24629.33
Range [ ( max - min ) / 2 * 100% ] 10.16%
Damage
Sample Data Decalang Damage
Count 9999
Mean 54510696.33
Minimum 40919334.12
Maximum 68899902.37
Spread ( max - min ) 27980568.25
Range [ ( max - min ) / 2 * 100% ] 25.67%
DTPS
Sample Data Decalang Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Decalang Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Decalang Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Decalang Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Decalang Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Decalang Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data DecalangTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Decalang Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,name=countless_armies
1 0.00 food,name=the_hungry_magister
2 0.00 augmentation,name=defiled
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=deadly_grace
Default action list Executed every time the actor is available.
# count action,conditions
5 1.00 auto_attack
0.00 arcane_torrent,if=runic_power.deficit>20
0.00 blood_fury,if=!talent.breath_of_sindragosa.enabled|dot.breath_of_sindragosa.ticking
0.00 berserking
6 3.02 use_item,slot=trinket1
7 1.00 potion,name=deadly_grace
8 7.99 pillar_of_frost
0.00 sindragosas_fury
0.00 obliteration
0.00 breath_of_sindragosa,if=runic_power>=50
9 0.00 run_action_list,name=bos,if=dot.breath_of_sindragosa.ticking
A 0.00 call_action_list,name=generic
actions.generic
# count action,conditions
C 3.24 howling_blast,target_if=!dot.frost_fever.ticking
D 34.81 howling_blast,if=buff.rime.react
E 10.38 frost_strike,if=runic_power>=80
F 0.00 call_action_list,name=core
0.00 horn_of_winter,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains>15
G 14.92 horn_of_winter,if=!talent.breath_of_sindragosa.enabled
0.00 frost_strike,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains>15
H 88.31 frost_strike,if=!talent.breath_of_sindragosa.enabled
0.00 empower_rune_weapon,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains>15
0.00 hungering_rune_weapon,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains>15
I 2.78 empower_rune_weapon,if=!talent.breath_of_sindragosa.enabled
0.00 hungering_rune_weapon,if=!talent.breath_of_sindragosa.enabled
actions.core
# count action,conditions
J 31.92 glacial_advance
0.00 frost_strike,if=buff.obliteration.up&!buff.killing_machine.react
0.00 remorseless_winter,if=spell_targets.remorseless_winter>=2
K 29.76 frostscythe,if=!talent.breath_of_sindragosa.enabled&(buff.killing_machine.react|spell_targets.frostscythe>=4)
0.00 obliterate,if=buff.killing_machine.react
L 78.26 obliterate
0.00 frostscythe,if=talent.frozen_pulse.enabled
0.00 howling_blast,if=talent.frozen_pulse.enabled

Sample Sequence

0124568CJKLGLDELLDEJEKHLHDLHKJHHILLDLHHLJGLDEHLLDEJHHLLHHK7J8HGLDLLDEJKEKHHLHLDJHLDGLHHJKKLDHHHLDJH8KLHGLHJHLDHLDKHJHLDHGJLLDHHKHLHJLDH68LDHJGLHKLHHJLKHILDLKHHJLHLGLDELDJEHHLDKHH8JLHGLDLJHLDLDEEKHJLHHHKLHLDGJHLHLHKHLDJH8LDHJGLLHHHLDJHLHLDJKGKLDELELHHHJL6H8KHLDLHDJGLDLEKHHLDJHHLILDLLDEJLDEKGELKEJHHHL8HLDJKHHLDLGJHH

Sample Sequence Table

time name target resources buffs
Pre flask Decalang 0.0/100: 0% runic_power | 6.0/6: 100% rune
Pre food Decalang 0.0/100: 0% runic_power | 6.0/6: 100% rune
Pre augmentation Decalang 0.0/100: 0% runic_power | 6.0/6: 100% rune
Pre potion Fluffy_Pillow 0.0/100: 0% runic_power | 6.0/6: 100% rune potion_of_deadly_grace
0:00.000 auto_attack Fluffy_Pillow 0.0/100: 0% runic_power | 6.0/6: 100% rune potion_of_deadly_grace
0:00.000 use_item_lost_etins_strength Fluffy_Pillow 0.0/100: 0% runic_power | 6.0/6: 100% rune killing_machine, potion_of_deadly_grace
0:00.000 pillar_of_frost Fluffy_Pillow 0.0/100: 0% runic_power | 6.0/6: 100% rune killing_machine, potion_of_deadly_grace
0:00.000 howling_blast Fluffy_Pillow 0.0/100: 0% runic_power | 6.0/6: 100% rune killing_machine, pillar_of_frost, potion_of_deadly_grace
0:01.266 glacial_advance Fluffy_Pillow 10.0/100: 10% runic_power | 5.0/6: 83% rune bloodlust, killing_machine, pillar_of_frost, potion_of_deadly_grace
0:02.302 frostscythe Fluffy_Pillow 20.0/100: 20% runic_power | 4.0/6: 67% rune bloodlust, killing_machine, pillar_of_frost, potion_of_deadly_grace
0:03.340 obliterate Fluffy_Pillow 30.0/100: 30% runic_power | 3.0/6: 50% rune bloodlust, pillar_of_frost, potion_of_deadly_grace
0:04.378 horn_of_winter Fluffy_Pillow 50.0/100: 50% runic_power | 1.0/6: 17% rune bloodlust, pillar_of_frost, potion_of_deadly_grace
0:05.414 obliterate Fluffy_Pillow 60.0/100: 60% runic_power | 3.0/6: 50% rune bloodlust, pillar_of_frost, potion_of_deadly_grace
0:06.452 howling_blast Fluffy_Pillow 80.0/100: 80% runic_power | 1.0/6: 17% rune bloodlust, pillar_of_frost, rime, potion_of_deadly_grace
0:07.488 frost_strike Fluffy_Pillow 80.0/100: 80% runic_power | 2.0/6: 33% rune bloodlust, pillar_of_frost, potion_of_deadly_grace
0:08.524 obliterate Fluffy_Pillow 55.0/100: 55% runic_power | 3.0/6: 50% rune bloodlust, pillar_of_frost, potion_of_deadly_grace
0:09.560 obliterate Fluffy_Pillow 75.0/100: 75% runic_power | 2.0/6: 33% rune bloodlust, pillar_of_frost, rime, unholy_strength, potion_of_deadly_grace
0:10.597 howling_blast Fluffy_Pillow 95.0/100: 95% runic_power | 0.0/6: 0% rune bloodlust, pillar_of_frost, rime, unholy_strength, potion_of_deadly_grace
0:11.634 frost_strike Fluffy_Pillow 95.0/100: 95% runic_power | 0.0/6: 0% rune bloodlust, pillar_of_frost, unholy_strength, potion_of_deadly_grace
0:12.671 glacial_advance Fluffy_Pillow 75.0/100: 75% runic_power | 1.0/6: 17% rune bloodlust, killing_machine, pillar_of_frost, unholy_strength, potion_of_deadly_grace
0:13.706 frost_strike Fluffy_Pillow 85.0/100: 85% runic_power | 0.0/6: 0% rune bloodlust, killing_machine, pillar_of_frost, unholy_strength, potion_of_deadly_grace
0:14.742 frostscythe Fluffy_Pillow 60.0/100: 60% runic_power | 1.0/6: 17% rune bloodlust, killing_machine, pillar_of_frost, unholy_strength, potion_of_deadly_grace
0:15.780 frost_strike Fluffy_Pillow 75.0/100: 75% runic_power | 1.0/6: 17% rune bloodlust, pillar_of_frost, unholy_strength, potion_of_deadly_grace
0:16.815 obliterate Fluffy_Pillow 50.0/100: 50% runic_power | 3.0/6: 50% rune bloodlust, pillar_of_frost, unholy_strength, potion_of_deadly_grace
0:17.851 frost_strike Fluffy_Pillow 70.0/100: 70% runic_power | 1.0/6: 17% rune bloodlust, pillar_of_frost, rime, unholy_strength, potion_of_deadly_grace
0:18.888 howling_blast Fluffy_Pillow 45.0/100: 45% runic_power | 2.0/6: 33% rune bloodlust, pillar_of_frost, rime, unholy_strength, potion_of_deadly_grace
0:19.925 obliterate Fluffy_Pillow 45.0/100: 45% runic_power | 2.0/6: 33% rune bloodlust, pillar_of_frost, unholy_strength, potion_of_deadly_grace
0:20.962 frost_strike Fluffy_Pillow 65.0/100: 65% runic_power | 1.0/6: 17% rune bloodlust, killing_machine, unholy_strength, potion_of_deadly_grace
0:21.997 frostscythe Fluffy_Pillow 40.0/100: 40% runic_power | 2.0/6: 33% rune bloodlust, killing_machine, unholy_strength, potion_of_deadly_grace
0:23.034 glacial_advance Fluffy_Pillow 50.0/100: 50% runic_power | 2.0/6: 33% rune bloodlust, unholy_strength
0:24.070 frost_strike Fluffy_Pillow 60.0/100: 60% runic_power | 1.0/6: 17% rune bloodlust, unholy_strength
0:25.106 frost_strike Fluffy_Pillow 35.0/100: 35% runic_power | 1.0/6: 17% rune bloodlust, unholy_strength
0:26.143 empower_rune_weapon Fluffy_Pillow 10.0/100: 10% runic_power | 1.0/6: 17% rune bloodlust, unholy_strength
0:26.143 obliterate Fluffy_Pillow 10.0/100: 10% runic_power | 6.0/6: 100% rune bloodlust, unholy_strength
0:27.179 obliterate Fluffy_Pillow 30.0/100: 30% runic_power | 4.0/6: 67% rune bloodlust, unholy_strength
0:28.218 howling_blast Fluffy_Pillow 50.0/100: 50% runic_power | 2.0/6: 33% rune bloodlust, rime, unholy_strength
0:29.256 obliterate Fluffy_Pillow 50.0/100: 50% runic_power | 2.0/6: 33% rune bloodlust
0:30.292 frost_strike Fluffy_Pillow 70.0/100: 70% runic_power | 0.0/6: 0% rune bloodlust
0:31.330 frost_strike Fluffy_Pillow 45.0/100: 45% runic_power | 1.0/6: 17% rune bloodlust
0:32.367 Waiting 0.700 sec 20.0/100: 20% runic_power | 1.0/6: 17% rune bloodlust
0:33.067 obliterate Fluffy_Pillow 20.0/100: 20% runic_power | 3.0/6: 50% rune bloodlust, killing_machine
0:34.103 glacial_advance Fluffy_Pillow 40.0/100: 40% runic_power | 2.0/6: 33% rune bloodlust
0:35.138 horn_of_winter Fluffy_Pillow 50.0/100: 50% runic_power | 1.0/6: 17% rune bloodlust
0:36.174 obliterate Fluffy_Pillow 65.0/100: 65% runic_power | 3.0/6: 50% rune bloodlust
0:37.210 howling_blast Fluffy_Pillow 85.0/100: 85% runic_power | 1.0/6: 17% rune bloodlust, rime
0:38.246 frost_strike Fluffy_Pillow 85.0/100: 85% runic_power | 1.0/6: 17% rune bloodlust, unholy_strength
0:39.282 frost_strike Fluffy_Pillow 60.0/100: 60% runic_power | 1.0/6: 17% rune bloodlust, unholy_strength
0:40.318 obliterate Fluffy_Pillow 35.0/100: 35% runic_power | 3.0/6: 50% rune bloodlust, unholy_strength
0:41.461 obliterate Fluffy_Pillow 55.0/100: 55% runic_power | 2.0/6: 33% rune unholy_strength
0:42.808 howling_blast Fluffy_Pillow 80.0/100: 80% runic_power | 0.0/6: 0% rune rime, unholy_strength
0:44.155 frost_strike Fluffy_Pillow 80.0/100: 80% runic_power | 0.0/6: 0% rune unholy_strength
0:45.500 glacial_advance Fluffy_Pillow 60.0/100: 60% runic_power | 1.0/6: 17% rune unholy_strength
0:46.846 frost_strike Fluffy_Pillow 70.0/100: 70% runic_power | 0.0/6: 0% rune unholy_strength
0:48.194 frost_strike Fluffy_Pillow 45.0/100: 45% runic_power | 0.0/6: 0% rune unholy_strength
0:49.540 obliterate Fluffy_Pillow 20.0/100: 20% runic_power | 3.0/6: 50% rune unholy_strength
0:50.887 obliterate Fluffy_Pillow 40.0/100: 40% runic_power | 2.0/6: 33% rune unholy_strength
0:52.234 frost_strike Fluffy_Pillow 60.0/100: 60% runic_power | 0.0/6: 0% rune killing_machine, unholy_strength
0:53.581 frost_strike Fluffy_Pillow 35.0/100: 35% runic_power | 0.0/6: 0% rune killing_machine
0:54.927 Waiting 2.600 sec 10.0/100: 10% runic_power | 0.0/6: 0% rune killing_machine
0:57.527 frostscythe Fluffy_Pillow 10.0/100: 10% runic_power | 2.0/6: 33% rune killing_machine
0:58.874 potion Fluffy_Pillow 20.0/100: 20% runic_power | 2.0/6: 33% rune
0:58.874 glacial_advance Fluffy_Pillow 20.0/100: 20% runic_power | 2.0/6: 33% rune potion_of_deadly_grace
1:00.273 pillar_of_frost Fluffy_Pillow 35.0/100: 35% runic_power | 1.0/6: 17% rune potion_of_deadly_grace
1:00.273 frost_strike Fluffy_Pillow 35.0/100: 35% runic_power | 1.0/6: 17% rune pillar_of_frost, potion_of_deadly_grace
1:01.619 Waiting 3.300 sec 10.0/100: 10% runic_power | 1.0/6: 17% rune pillar_of_frost, potion_of_deadly_grace
1:04.919 horn_of_winter Fluffy_Pillow 15.0/100: 15% runic_power | 1.0/6: 17% rune pillar_of_frost, potion_of_deadly_grace
1:06.486 obliterate Fluffy_Pillow 25.0/100: 25% runic_power | 5.0/6: 83% rune pillar_of_frost, potion_of_deadly_grace
1:07.833 howling_blast Fluffy_Pillow 45.0/100: 45% runic_power | 4.0/6: 67% rune pillar_of_frost, rime, potion_of_deadly_grace
1:09.180 obliterate Fluffy_Pillow 45.0/100: 45% runic_power | 4.0/6: 67% rune pillar_of_frost, potion_of_deadly_grace
1:10.526 obliterate Fluffy_Pillow 65.0/100: 65% runic_power | 2.0/6: 33% rune pillar_of_frost, potion_of_deadly_grace
1:11.872 howling_blast Fluffy_Pillow 85.0/100: 85% runic_power | 0.0/6: 0% rune pillar_of_frost, rime, potion_of_deadly_grace
1:13.219 frost_strike Fluffy_Pillow 85.0/100: 85% runic_power | 0.0/6: 0% rune killing_machine, pillar_of_frost, potion_of_deadly_grace
1:14.567 glacial_advance Fluffy_Pillow 60.0/100: 60% runic_power | 1.0/6: 17% rune killing_machine, pillar_of_frost, potion_of_deadly_grace
1:15.914 frostscythe Fluffy_Pillow 70.0/100: 70% runic_power | 2.0/6: 33% rune killing_machine, pillar_of_frost, potion_of_deadly_grace
1:17.261 frost_strike Fluffy_Pillow 80.0/100: 80% runic_power | 1.0/6: 17% rune killing_machine, pillar_of_frost, unholy_strength, potion_of_deadly_grace
1:18.610 frostscythe Fluffy_Pillow 55.0/100: 55% runic_power | 2.0/6: 33% rune killing_machine, pillar_of_frost, unholy_strength, potion_of_deadly_grace
1:19.956 frost_strike Fluffy_Pillow 65.0/100: 65% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength, potion_of_deadly_grace
1:21.302 frost_strike Fluffy_Pillow 40.0/100: 40% runic_power | 1.0/6: 17% rune unholy_strength, potion_of_deadly_grace
1:22.648 obliterate Fluffy_Pillow 15.0/100: 15% runic_power | 2.0/6: 33% rune unholy_strength, potion_of_deadly_grace
1:23.995 frost_strike Fluffy_Pillow 35.0/100: 35% runic_power | 0.0/6: 0% rune unholy_strength
1:25.342 obliterate Fluffy_Pillow 10.0/100: 10% runic_power | 2.0/6: 33% rune unholy_strength
1:26.689 howling_blast Fluffy_Pillow 30.0/100: 30% runic_power | 0.0/6: 0% rune rime, unholy_strength
1:28.036 glacial_advance Fluffy_Pillow 30.0/100: 30% runic_power | 1.0/6: 17% rune unholy_strength
1:29.382 frost_strike Fluffy_Pillow 40.0/100: 40% runic_power | 0.0/6: 0% rune unholy_strength
1:30.729 Waiting 2.700 sec 15.0/100: 15% runic_power | 0.0/6: 0% rune unholy_strength
1:33.429 obliterate Fluffy_Pillow 15.0/100: 15% runic_power | 2.0/6: 33% rune
1:34.774 howling_blast Fluffy_Pillow 35.0/100: 35% runic_power | 0.0/6: 0% rune rime
1:36.121 horn_of_winter Fluffy_Pillow 40.0/100: 40% runic_power | 1.0/6: 17% rune
1:37.468 obliterate Fluffy_Pillow 50.0/100: 50% runic_power | 3.0/6: 50% rune
1:38.812 frost_strike Fluffy_Pillow 70.0/100: 70% runic_power | 1.0/6: 17% rune
1:40.158 frost_strike Fluffy_Pillow 45.0/100: 45% runic_power | 1.0/6: 17% rune killing_machine
1:41.505 glacial_advance Fluffy_Pillow 20.0/100: 20% runic_power | 2.0/6: 33% rune killing_machine
1:42.852 frostscythe Fluffy_Pillow 30.0/100: 30% runic_power | 3.0/6: 50% rune killing_machine
1:44.199 frostscythe Fluffy_Pillow 40.0/100: 40% runic_power | 2.0/6: 33% rune killing_machine
1:45.545 obliterate Fluffy_Pillow 50.0/100: 50% runic_power | 2.0/6: 33% rune
1:46.891 howling_blast Fluffy_Pillow 70.0/100: 70% runic_power | 0.0/6: 0% rune rime
1:48.238 frost_strike Fluffy_Pillow 75.0/100: 75% runic_power | 0.0/6: 0% rune unholy_strength
1:49.586 frost_strike Fluffy_Pillow 50.0/100: 50% runic_power | 0.0/6: 0% rune unholy_strength
1:50.933 frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 0.0/6: 0% rune unholy_strength
1:52.279 obliterate Fluffy_Pillow 0.0/100: 0% runic_power | 2.0/6: 33% rune unholy_strength
1:53.624 howling_blast Fluffy_Pillow 20.0/100: 20% runic_power | 0.0/6: 0% rune rime, unholy_strength
1:54.970 glacial_advance Fluffy_Pillow 20.0/100: 20% runic_power | 1.0/6: 17% rune unholy_strength
1:56.317 frost_strike Fluffy_Pillow 30.0/100: 30% runic_power | 0.0/6: 0% rune unholy_strength
1:57.662 Waiting 2.400 sec 5.0/100: 5% runic_power | 0.0/6: 0% rune unholy_strength
2:00.062 pillar_of_frost Fluffy_Pillow 10.0/100: 10% runic_power | 0.0/6: 0% rune killing_machine, unholy_strength
2:00.273 frostscythe Fluffy_Pillow 10.0/100: 10% runic_power | 2.0/6: 33% rune killing_machine, pillar_of_frost, unholy_strength
2:01.621 Waiting 1.300 sec 20.0/100: 20% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength
2:02.921 obliterate Fluffy_Pillow 20.0/100: 20% runic_power | 2.0/6: 33% rune pillar_of_frost
2:04.268 frost_strike Fluffy_Pillow 45.0/100: 45% runic_power | 0.0/6: 0% rune pillar_of_frost
2:05.616 Waiting 0.300 sec 20.0/100: 20% runic_power | 0.0/6: 0% rune pillar_of_frost
2:05.916 horn_of_winter Fluffy_Pillow 20.0/100: 20% runic_power | 0.0/6: 0% rune pillar_of_frost
2:07.466 obliterate Fluffy_Pillow 35.0/100: 35% runic_power | 2.0/6: 33% rune pillar_of_frost
2:08.812 frost_strike Fluffy_Pillow 55.0/100: 55% runic_power | 0.0/6: 0% rune pillar_of_frost
2:10.158 glacial_advance Fluffy_Pillow 35.0/100: 35% runic_power | 2.0/6: 33% rune pillar_of_frost
2:11.506 frost_strike Fluffy_Pillow 45.0/100: 45% runic_power | 1.0/6: 17% rune pillar_of_frost
2:12.852 obliterate Fluffy_Pillow 20.0/100: 20% runic_power | 2.0/6: 33% rune pillar_of_frost
2:14.198 howling_blast Fluffy_Pillow 40.0/100: 40% runic_power | 0.0/6: 0% rune pillar_of_frost, rime
2:15.543 frost_strike Fluffy_Pillow 40.0/100: 40% runic_power | 0.0/6: 0% rune pillar_of_frost
2:16.889 Waiting 1.200 sec 15.0/100: 15% runic_power | 0.0/6: 0% rune pillar_of_frost
2:18.089 obliterate Fluffy_Pillow 15.0/100: 15% runic_power | 2.0/6: 33% rune pillar_of_frost
2:19.436 howling_blast Fluffy_Pillow 35.0/100: 35% runic_power | 0.0/6: 0% rune killing_machine, pillar_of_frost, rime
2:20.782 frostscythe Fluffy_Pillow 35.0/100: 35% runic_power | 1.0/6: 17% rune killing_machine
2:22.128 frost_strike Fluffy_Pillow 45.0/100: 45% runic_power | 0.0/6: 0% rune
2:23.473 glacial_advance Fluffy_Pillow 20.0/100: 20% runic_power | 1.0/6: 17% rune
2:24.930 frost_strike Fluffy_Pillow 30.0/100: 30% runic_power | 0.0/6: 0% rune unholy_strength
2:26.275 Waiting 0.800 sec 5.0/100: 5% runic_power | 0.0/6: 0% rune unholy_strength
2:27.075 obliterate Fluffy_Pillow 5.0/100: 5% runic_power | 2.0/6: 33% rune unholy_strength
2:28.421 howling_blast Fluffy_Pillow 25.0/100: 25% runic_power | 0.0/6: 0% rune rime, unholy_strength
2:29.767 frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 1.0/6: 17% rune unholy_strength
2:31.113 Waiting 4.800 sec 0.0/100: 0% runic_power | 1.0/6: 17% rune unholy_strength
2:35.913 horn_of_winter Fluffy_Pillow 5.0/100: 5% runic_power | 1.0/6: 17% rune unholy_strength
2:37.469 glacial_advance Fluffy_Pillow 15.0/100: 15% runic_power | 5.0/6: 83% rune unholy_strength
2:38.815 obliterate Fluffy_Pillow 25.0/100: 25% runic_power | 4.0/6: 67% rune unholy_strength
2:40.161 obliterate Fluffy_Pillow 45.0/100: 45% runic_power | 2.0/6: 33% rune unholy_strength
2:41.506 howling_blast Fluffy_Pillow 65.0/100: 65% runic_power | 0.0/6: 0% rune rime, unholy_strength
2:42.852 frost_strike Fluffy_Pillow 65.0/100: 65% runic_power | 0.0/6: 0% rune unholy_strength
2:44.198 frost_strike Fluffy_Pillow 40.0/100: 40% runic_power | 0.0/6: 0% rune killing_machine, unholy_strength
2:45.545 frostscythe Fluffy_Pillow 15.0/100: 15% runic_power | 1.0/6: 17% rune killing_machine, unholy_strength
2:46.894 frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 1.0/6: 17% rune
2:48.241 obliterate Fluffy_Pillow 0.0/100: 0% runic_power | 2.0/6: 33% rune unholy_strength
2:49.589 Waiting 1.500 sec 20.0/100: 20% runic_power | 0.0/6: 0% rune unholy_strength
2:51.089 frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 0.0/6: 0% rune unholy_strength
2:52.434 glacial_advance Fluffy_Pillow 0.0/100: 0% runic_power | 1.0/6: 17% rune unholy_strength
2:53.779 Waiting 1.600 sec 10.0/100: 10% runic_power | 0.0/6: 0% rune unholy_strength
2:55.379 obliterate Fluffy_Pillow 10.0/100: 10% runic_power | 2.0/6: 33% rune unholy_strength
2:56.725 howling_blast Fluffy_Pillow 30.0/100: 30% runic_power | 1.0/6: 17% rune rime, unholy_strength
2:58.071 frost_strike Fluffy_Pillow 30.0/100: 30% runic_power | 1.0/6: 17% rune unholy_strength
2:59.417 Waiting 0.400 sec 5.0/100: 5% runic_power | 1.0/6: 17% rune unholy_strength
2:59.817 use_item_lost_etins_strength Fluffy_Pillow 5.0/100: 5% runic_power | 1.0/6: 17% rune unholy_strength
3:00.000 Waiting 0.100 sec 10.0/100: 10% runic_power | 1.0/6: 17% rune unholy_strength
3:00.100 pillar_of_frost Fluffy_Pillow 10.0/100: 10% runic_power | 1.0/6: 17% rune unholy_strength
3:00.273 Waiting 2.600 sec 10.0/100: 10% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength
3:02.873 obliterate Fluffy_Pillow 10.0/100: 10% runic_power | 2.0/6: 33% rune pillar_of_frost
3:04.220 howling_blast Fluffy_Pillow 30.0/100: 30% runic_power | 0.0/6: 0% rune pillar_of_frost, rime
3:05.566 frost_strike Fluffy_Pillow 30.0/100: 30% runic_power | 1.0/6: 17% rune pillar_of_frost
3:06.913 glacial_advance Fluffy_Pillow 5.0/100: 5% runic_power | 2.0/6: 33% rune pillar_of_frost
3:08.261 horn_of_winter Fluffy_Pillow 15.0/100: 15% runic_power | 1.0/6: 17% rune pillar_of_frost
3:09.608 obliterate Fluffy_Pillow 30.0/100: 30% runic_power | 3.0/6: 50% rune pillar_of_frost
3:10.956 frost_strike Fluffy_Pillow 50.0/100: 50% runic_power | 1.0/6: 17% rune killing_machine, pillar_of_frost
3:12.301 frostscythe Fluffy_Pillow 25.0/100: 25% runic_power | 2.0/6: 33% rune killing_machine, pillar_of_frost
3:13.649 obliterate Fluffy_Pillow 35.0/100: 35% runic_power | 2.0/6: 33% rune pillar_of_frost
3:14.996 frost_strike Fluffy_Pillow 55.0/100: 55% runic_power | 1.0/6: 17% rune pillar_of_frost
3:16.342 frost_strike Fluffy_Pillow 30.0/100: 30% runic_power | 1.0/6: 17% rune pillar_of_frost
3:17.688 Waiting 2.500 sec 5.0/100: 5% runic_power | 1.0/6: 17% rune pillar_of_frost
3:20.188 glacial_advance Fluffy_Pillow 5.0/100: 5% runic_power | 1.0/6: 17% rune pillar_of_frost
3:21.686 Waiting 0.600 sec 15.0/100: 15% runic_power | 1.0/6: 17% rune
3:22.286 obliterate Fluffy_Pillow 15.0/100: 15% runic_power | 2.0/6: 33% rune
3:23.633 frostscythe Fluffy_Pillow 35.0/100: 35% runic_power | 1.0/6: 17% rune killing_machine
3:24.979 frost_strike Fluffy_Pillow 45.0/100: 45% runic_power | 0.0/6: 0% rune
3:26.324 empower_rune_weapon Fluffy_Pillow 20.0/100: 20% runic_power | 0.0/6: 0% rune
3:26.324 obliterate Fluffy_Pillow 20.0/100: 20% runic_power | 6.0/6: 100% rune
3:27.670 howling_blast Fluffy_Pillow 40.0/100: 40% runic_power | 4.0/6: 67% rune rime
3:29.018 obliterate Fluffy_Pillow 40.0/100: 40% runic_power | 4.0/6: 67% rune
3:30.365 frostscythe Fluffy_Pillow 60.0/100: 60% runic_power | 2.0/6: 33% rune killing_machine, unholy_strength
3:31.713 frost_strike Fluffy_Pillow 70.0/100: 70% runic_power | 1.0/6: 17% rune unholy_strength
3:33.059 frost_strike Fluffy_Pillow 45.0/100: 45% runic_power | 1.0/6: 17% rune unholy_strength
3:34.405 glacial_advance Fluffy_Pillow 20.0/100: 20% runic_power | 1.0/6: 17% rune unholy_strength
3:35.751 obliterate Fluffy_Pillow 30.0/100: 30% runic_power | 2.0/6: 33% rune unholy_strength
3:37.097 frost_strike Fluffy_Pillow 55.0/100: 55% runic_power | 0.0/6: 0% rune unholy_strength
3:38.443 obliterate Fluffy_Pillow 30.0/100: 30% runic_power | 2.0/6: 33% rune unholy_strength
3:39.788 horn_of_winter Fluffy_Pillow 50.0/100: 50% runic_power | 0.0/6: 0% rune unholy_strength
3:41.133 obliterate Fluffy_Pillow 60.0/100: 60% runic_power | 2.0/6: 33% rune unholy_strength
3:42.478 howling_blast Fluffy_Pillow 80.0/100: 80% runic_power | 0.0/6: 0% rune rime, unholy_strength
3:43.825 frost_strike Fluffy_Pillow 80.0/100: 80% runic_power | 0.0/6: 0% rune unholy_strength
3:45.172 obliterate Fluffy_Pillow 55.0/100: 55% runic_power | 2.0/6: 33% rune
3:46.519 howling_blast Fluffy_Pillow 75.0/100: 75% runic_power | 0.0/6: 0% rune rime
3:47.864 glacial_advance Fluffy_Pillow 75.0/100: 75% runic_power | 1.0/6: 17% rune
3:49.211 frost_strike Fluffy_Pillow 85.0/100: 85% runic_power | 0.0/6: 0% rune
3:50.557 frost_strike Fluffy_Pillow 60.0/100: 60% runic_power | 0.0/6: 0% rune
3:51.903 frost_strike Fluffy_Pillow 40.0/100: 40% runic_power | 0.0/6: 0% rune
3:53.251 obliterate Fluffy_Pillow 15.0/100: 15% runic_power | 3.0/6: 50% rune unholy_strength
3:54.597 howling_blast Fluffy_Pillow 40.0/100: 40% runic_power | 1.0/6: 17% rune killing_machine, rime, unholy_strength
3:55.942 frostscythe Fluffy_Pillow 40.0/100: 40% runic_power | 2.0/6: 33% rune killing_machine, unholy_strength
3:57.291 frost_strike Fluffy_Pillow 50.0/100: 50% runic_power | 1.0/6: 17% rune unholy_strength
3:58.637 frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 1.0/6: 17% rune unholy_strength
3:59.984 Waiting 0.100 sec 0.0/100: 0% runic_power | 1.0/6: 17% rune unholy_strength
4:00.084 pillar_of_frost Fluffy_Pillow 0.0/100: 0% runic_power | 1.0/6: 17% rune unholy_strength
4:00.273 Waiting 0.800 sec 0.0/100: 0% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength
4:01.073 glacial_advance Fluffy_Pillow 0.0/100: 0% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength
4:02.638 obliterate Fluffy_Pillow 10.0/100: 10% runic_power | 2.0/6: 33% rune pillar_of_frost, unholy_strength
4:03.984 frost_strike Fluffy_Pillow 35.0/100: 35% runic_power | 0.0/6: 0% rune pillar_of_frost, unholy_strength
4:05.331 Waiting 4.300 sec 10.0/100: 10% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength
4:09.631 horn_of_winter Fluffy_Pillow 10.0/100: 10% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength
4:11.135 obliterate Fluffy_Pillow 20.0/100: 20% runic_power | 5.0/6: 83% rune pillar_of_frost, unholy_strength
4:12.482 howling_blast Fluffy_Pillow 40.0/100: 40% runic_power | 3.0/6: 50% rune pillar_of_frost, rime
4:13.829 obliterate Fluffy_Pillow 40.0/100: 40% runic_power | 4.0/6: 67% rune pillar_of_frost
4:15.172 glacial_advance Fluffy_Pillow 65.0/100: 65% runic_power | 2.0/6: 33% rune pillar_of_frost
4:16.516 frost_strike Fluffy_Pillow 75.0/100: 75% runic_power | 1.0/6: 17% rune pillar_of_frost
4:17.863 obliterate Fluffy_Pillow 50.0/100: 50% runic_power | 2.0/6: 33% rune pillar_of_frost
4:19.210 howling_blast Fluffy_Pillow 75.0/100: 75% runic_power | 0.0/6: 0% rune pillar_of_frost, rime
4:20.557 obliterate Fluffy_Pillow 75.0/100: 75% runic_power | 2.0/6: 33% rune
4:21.902 howling_blast Fluffy_Pillow 100.0/100: 100% runic_power | 0.0/6: 0% rune rime
4:23.248 frost_strike Fluffy_Pillow 100.0/100: 100% runic_power | 1.0/6: 17% rune killing_machine
4:24.594 frost_strike Fluffy_Pillow 80.0/100: 80% runic_power | 2.0/6: 33% rune killing_machine
4:25.940 frostscythe Fluffy_Pillow 55.0/100: 55% runic_power | 2.0/6: 33% rune killing_machine
4:27.286 frost_strike Fluffy_Pillow 70.0/100: 70% runic_power | 1.0/6: 17% rune
4:28.633 glacial_advance Fluffy_Pillow 45.0/100: 45% runic_power | 1.0/6: 17% rune
4:29.980 obliterate Fluffy_Pillow 55.0/100: 55% runic_power | 2.0/6: 33% rune
4:31.326 frost_strike Fluffy_Pillow 75.0/100: 75% runic_power | 0.0/6: 0% rune
4:32.674 frost_strike Fluffy_Pillow 50.0/100: 50% runic_power | 1.0/6: 17% rune
4:34.021 frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 1.0/6: 17% rune
4:35.366 Waiting 0.800 sec 0.0/100: 0% runic_power | 1.0/6: 17% rune
4:36.166 frostscythe Fluffy_Pillow 0.0/100: 0% runic_power | 1.0/6: 17% rune killing_machine
4:37.512 Waiting 0.500 sec 10.0/100: 10% runic_power | 0.0/6: 0% rune
4:38.012 obliterate Fluffy_Pillow 10.0/100: 10% runic_power | 2.0/6: 33% rune
4:39.360 frost_strike Fluffy_Pillow 30.0/100: 30% runic_power | 0.0/6: 0% rune
4:40.707 obliterate Fluffy_Pillow 5.0/100: 5% runic_power | 2.0/6: 33% rune
4:42.053 howling_blast Fluffy_Pillow 25.0/100: 25% runic_power | 0.0/6: 0% rune rime
4:43.401 horn_of_winter Fluffy_Pillow 25.0/100: 25% runic_power | 0.0/6: 0% rune unholy_strength
4:44.745 glacial_advance Fluffy_Pillow 35.0/100: 35% runic_power | 2.0/6: 33% rune unholy_strength
4:46.090 frost_strike Fluffy_Pillow 45.0/100: 45% runic_power | 1.0/6: 17% rune unholy_strength
4:47.437 obliterate Fluffy_Pillow 20.0/100: 20% runic_power | 3.0/6: 50% rune unholy_strength
4:48.784 frost_strike Fluffy_Pillow 40.0/100: 40% runic_power | 1.0/6: 17% rune unholy_strength
4:50.130 obliterate Fluffy_Pillow 15.0/100: 15% runic_power | 2.0/6: 33% rune unholy_strength
4:51.476 frost_strike Fluffy_Pillow 40.0/100: 40% runic_power | 0.0/6: 0% rune killing_machine, unholy_strength
4:52.824 frostscythe Fluffy_Pillow 15.0/100: 15% runic_power | 1.0/6: 17% rune killing_machine, unholy_strength
4:54.171 frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 0.0/6: 0% rune unholy_strength
4:55.518 Waiting 0.400 sec 0.0/100: 0% runic_power | 0.0/6: 0% rune unholy_strength
4:55.918 obliterate Fluffy_Pillow 0.0/100: 0% runic_power | 2.0/6: 33% rune unholy_strength
4:57.265 howling_blast Fluffy_Pillow 20.0/100: 20% runic_power | 0.0/6: 0% rune rime
4:58.611 glacial_advance Fluffy_Pillow 20.0/100: 20% runic_power | 1.0/6: 17% rune
4:59.958 frost_strike Fluffy_Pillow 30.0/100: 30% runic_power | 0.0/6: 0% rune
5:01.305 pillar_of_frost Fluffy_Pillow 5.0/100: 5% runic_power | 0.0/6: 0% rune
5:01.305 Waiting 3.600 sec 5.0/100: 5% runic_power | 0.0/6: 0% rune pillar_of_frost
5:04.905 obliterate Fluffy_Pillow 10.0/100: 10% runic_power | 2.0/6: 33% rune pillar_of_frost
5:06.250 howling_blast Fluffy_Pillow 30.0/100: 30% runic_power | 0.0/6: 0% rune pillar_of_frost, rime
5:07.596 frost_strike Fluffy_Pillow 30.0/100: 30% runic_power | 1.0/6: 17% rune pillar_of_frost
5:08.941 Waiting 2.900 sec 5.0/100: 5% runic_power | 1.0/6: 17% rune pillar_of_frost
5:11.841 glacial_advance Fluffy_Pillow 5.0/100: 5% runic_power | 1.0/6: 17% rune pillar_of_frost
5:13.383 horn_of_winter Fluffy_Pillow 20.0/100: 20% runic_power | 0.0/6: 0% rune pillar_of_frost
5:14.748 obliterate Fluffy_Pillow 30.0/100: 30% runic_power | 4.0/6: 67% rune pillar_of_frost
5:16.096 obliterate Fluffy_Pillow 50.0/100: 50% runic_power | 2.0/6: 33% rune pillar_of_frost
5:17.442 frost_strike Fluffy_Pillow 70.0/100: 70% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength
5:18.788 frost_strike Fluffy_Pillow 45.0/100: 45% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength
5:20.134 Waiting 0.900 sec 20.0/100: 20% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength
5:21.034 frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength
5:22.380 Waiting 0.400 sec 0.0/100: 0% runic_power | 1.0/6: 17% rune unholy_strength
5:22.780 obliterate Fluffy_Pillow 0.0/100: 0% runic_power | 2.0/6: 33% rune unholy_strength
5:24.127 howling_blast Fluffy_Pillow 20.0/100: 20% runic_power | 1.0/6: 17% rune rime, unholy_strength
5:25.473 glacial_advance Fluffy_Pillow 20.0/100: 20% runic_power | 2.0/6: 33% rune unholy_strength
5:26.820 frost_strike Fluffy_Pillow 30.0/100: 30% runic_power | 1.0/6: 17% rune unholy_strength
5:28.168 Waiting 3.600 sec 5.0/100: 5% runic_power | 1.0/6: 17% rune unholy_strength
5:31.768 obliterate Fluffy_Pillow 5.0/100: 5% runic_power | 2.0/6: 33% rune unholy_strength
5:33.115 frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 1.0/6: 17% rune unholy_strength
5:34.460 obliterate Fluffy_Pillow 0.0/100: 0% runic_power | 2.0/6: 33% rune killing_machine, unholy_strength
5:35.808 howling_blast Fluffy_Pillow 20.0/100: 20% runic_power | 0.0/6: 0% rune rime, unholy_strength
5:37.156 Waiting 3.500 sec 20.0/100: 20% runic_power | 0.0/6: 0% rune unholy_strength
5:40.656 glacial_advance Fluffy_Pillow 20.0/100: 20% runic_power | 1.0/6: 17% rune killing_machine, unholy_strength
5:42.002 frostscythe Fluffy_Pillow 30.0/100: 30% runic_power | 1.0/6: 17% rune killing_machine, unholy_strength
5:43.346 horn_of_winter Fluffy_Pillow 40.0/100: 40% runic_power | 1.0/6: 17% rune
5:44.746 frostscythe Fluffy_Pillow 50.0/100: 50% runic_power | 3.0/6: 50% rune killing_machine
5:46.093 obliterate Fluffy_Pillow 60.0/100: 60% runic_power | 2.0/6: 33% rune
5:47.441 howling_blast Fluffy_Pillow 80.0/100: 80% runic_power | 0.0/6: 0% rune rime
5:48.787 frost_strike Fluffy_Pillow 80.0/100: 80% runic_power | 0.0/6: 0% rune
5:50.134 obliterate Fluffy_Pillow 55.0/100: 55% runic_power | 2.0/6: 33% rune
5:51.482 frost_strike Fluffy_Pillow 80.0/100: 80% runic_power | 1.0/6: 17% rune
5:52.828 obliterate Fluffy_Pillow 55.0/100: 55% runic_power | 2.0/6: 33% rune
5:54.172 frost_strike Fluffy_Pillow 75.0/100: 75% runic_power | 0.0/6: 0% rune
5:55.519 frost_strike Fluffy_Pillow 50.0/100: 50% runic_power | 0.0/6: 0% rune
5:56.864 frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 0.0/6: 0% rune
5:58.211 glacial_advance Fluffy_Pillow 5.0/100: 5% runic_power | 1.0/6: 17% rune
5:59.560 obliterate Fluffy_Pillow 15.0/100: 15% runic_power | 2.0/6: 33% rune
6:00.908 use_item_lost_etins_strength Fluffy_Pillow 40.0/100: 40% runic_power | 0.0/6: 0% rune killing_machine
6:00.908 frost_strike Fluffy_Pillow 40.0/100: 40% runic_power | 0.0/6: 0% rune killing_machine
6:02.253 pillar_of_frost Fluffy_Pillow 15.0/100: 15% runic_power | 2.0/6: 33% rune killing_machine
6:02.253 frostscythe Fluffy_Pillow 15.0/100: 15% runic_power | 2.0/6: 33% rune killing_machine, pillar_of_frost
6:03.599 frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 1.0/6: 17% rune pillar_of_frost
6:04.944 Waiting 2.600 sec 0.0/100: 0% runic_power | 1.0/6: 17% rune pillar_of_frost
6:07.544 obliterate Fluffy_Pillow 5.0/100: 5% runic_power | 2.0/6: 33% rune pillar_of_frost, unholy_strength
6:08.892 howling_blast Fluffy_Pillow 25.0/100: 25% runic_power | 1.0/6: 17% rune pillar_of_frost, rime, unholy_strength
6:10.239 obliterate Fluffy_Pillow 25.0/100: 25% runic_power | 2.0/6: 33% rune pillar_of_frost, unholy_strength
6:11.586 frost_strike Fluffy_Pillow 45.0/100: 45% runic_power | 0.0/6: 0% rune pillar_of_frost, rime, unholy_strength
6:12.930 howling_blast Fluffy_Pillow 25.0/100: 25% runic_power | 1.0/6: 17% rune pillar_of_frost, rime, unholy_strength
6:14.276 glacial_advance Fluffy_Pillow 25.0/100: 25% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength
6:15.621 horn_of_winter Fluffy_Pillow 35.0/100: 35% runic_power | 0.0/6: 0% rune pillar_of_frost, unholy_strength
6:16.966 obliterate Fluffy_Pillow 45.0/100: 45% runic_power | 3.0/6: 50% rune pillar_of_frost, unholy_strength
6:18.313 howling_blast Fluffy_Pillow 65.0/100: 65% runic_power | 2.0/6: 33% rune pillar_of_frost, rime, unholy_strength
6:19.659 obliterate Fluffy_Pillow 65.0/100: 65% runic_power | 3.0/6: 50% rune pillar_of_frost, unholy_strength
6:21.004 frost_strike Fluffy_Pillow 85.0/100: 85% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength
6:22.352 frostscythe Fluffy_Pillow 60.0/100: 60% runic_power | 1.0/6: 17% rune killing_machine
6:23.699 frost_strike Fluffy_Pillow 70.0/100: 70% runic_power | 0.0/6: 0% rune
6:25.044 frost_strike Fluffy_Pillow 45.0/100: 45% runic_power | 0.0/6: 0% rune
6:26.392 obliterate Fluffy_Pillow 20.0/100: 20% runic_power | 2.0/6: 33% rune
6:27.739 howling_blast Fluffy_Pillow 40.0/100: 40% runic_power | 0.0/6: 0% rune rime
6:29.085 glacial_advance Fluffy_Pillow 40.0/100: 40% runic_power | 1.0/6: 17% rune
6:30.433 frost_strike Fluffy_Pillow 50.0/100: 50% runic_power | 0.0/6: 0% rune
6:31.781 frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 1.0/6: 17% rune
6:33.127 obliterate Fluffy_Pillow 0.0/100: 0% runic_power | 2.0/6: 33% rune
6:34.474 empower_rune_weapon Fluffy_Pillow 20.0/100: 20% runic_power | 1.0/6: 17% rune killing_machine
6:34.474 obliterate Fluffy_Pillow 20.0/100: 20% runic_power | 6.0/6: 100% rune killing_machine
6:35.818 howling_blast Fluffy_Pillow 40.0/100: 40% runic_power | 4.0/6: 67% rune rime, unholy_strength
6:37.162 obliterate Fluffy_Pillow 40.0/100: 40% runic_power | 4.0/6: 67% rune unholy_strength
6:38.507 obliterate Fluffy_Pillow 60.0/100: 60% runic_power | 2.0/6: 33% rune killing_machine, unholy_strength
6:39.853 howling_blast Fluffy_Pillow 80.0/100: 80% runic_power | 0.0/6: 0% rune rime, unholy_strength
6:41.200 frost_strike Fluffy_Pillow 80.0/100: 80% runic_power | 0.0/6: 0% rune unholy_strength
6:42.545 glacial_advance Fluffy_Pillow 55.0/100: 55% runic_power | 1.0/6: 17% rune unholy_strength
6:43.891 obliterate Fluffy_Pillow 65.0/100: 65% runic_power | 2.0/6: 33% rune unholy_strength
6:45.237 howling_blast Fluffy_Pillow 85.0/100: 85% runic_power | 0.0/6: 0% rune rime, unholy_strength
6:46.584 frost_strike Fluffy_Pillow 85.0/100: 85% runic_power | 1.0/6: 17% rune killing_machine, unholy_strength
6:47.931 frostscythe Fluffy_Pillow 60.0/100: 60% runic_power | 1.0/6: 17% rune killing_machine, unholy_strength
6:49.277 horn_of_winter Fluffy_Pillow 70.0/100: 70% runic_power | 0.0/6: 0% rune unholy_strength
6:50.623 frost_strike Fluffy_Pillow 80.0/100: 80% runic_power | 2.0/6: 33% rune unholy_strength
6:51.970 obliterate Fluffy_Pillow 55.0/100: 55% runic_power | 2.0/6: 33% rune unholy_strength
6:53.317 frostscythe Fluffy_Pillow 75.0/100: 75% runic_power | 2.0/6: 33% rune killing_machine, unholy_strength
6:54.665 frost_strike Fluffy_Pillow 90.0/100: 90% runic_power | 1.0/6: 17% rune unholy_strength
6:56.011 glacial_advance Fluffy_Pillow 65.0/100: 65% runic_power | 2.0/6: 33% rune unholy_strength
6:57.360 frost_strike Fluffy_Pillow 75.0/100: 75% runic_power | 1.0/6: 17% rune unholy_strength
6:58.705 frost_strike Fluffy_Pillow 50.0/100: 50% runic_power | 1.0/6: 17% rune unholy_strength
7:00.054 frost_strike Fluffy_Pillow 30.0/100: 30% runic_power | 1.0/6: 17% rune unholy_strength
7:01.400 obliterate Fluffy_Pillow 5.0/100: 5% runic_power | 3.0/6: 50% rune unholy_strength
7:02.746 pillar_of_frost Fluffy_Pillow 25.0/100: 25% runic_power | 1.0/6: 17% rune unholy_strength
7:02.746 frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength
7:04.093 obliterate Fluffy_Pillow 0.0/100: 0% runic_power | 2.0/6: 33% rune pillar_of_frost, unholy_strength
7:05.440 howling_blast Fluffy_Pillow 20.0/100: 20% runic_power | 0.0/6: 0% rune pillar_of_frost, rime, unholy_strength
7:06.786 Waiting 3.500 sec 20.0/100: 20% runic_power | 0.0/6: 0% rune pillar_of_frost, unholy_strength
7:10.286 glacial_advance Fluffy_Pillow 20.0/100: 20% runic_power | 2.0/6: 33% rune killing_machine, pillar_of_frost
7:11.632 frostscythe Fluffy_Pillow 30.0/100: 30% runic_power | 1.0/6: 17% rune killing_machine, pillar_of_frost
7:12.978 frost_strike Fluffy_Pillow 40.0/100: 40% runic_power | 1.0/6: 17% rune pillar_of_frost
7:14.323 Waiting 3.700 sec 15.0/100: 15% runic_power | 1.0/6: 17% rune pillar_of_frost
7:18.023 frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 1.0/6: 17% rune pillar_of_frost
7:19.370 obliterate Fluffy_Pillow 0.0/100: 0% runic_power | 3.0/6: 50% rune pillar_of_frost
7:20.716 howling_blast Fluffy_Pillow 20.0/100: 20% runic_power | 1.0/6: 17% rune pillar_of_frost, rime
7:22.063 obliterate Fluffy_Pillow 20.0/100: 20% runic_power | 2.0/6: 33% rune pillar_of_frost, unholy_strength
7:23.410 horn_of_winter Fluffy_Pillow 40.0/100: 40% runic_power | 0.0/6: 0% rune unholy_strength
7:24.756 glacial_advance Fluffy_Pillow 55.0/100: 55% runic_power | 2.0/6: 33% rune unholy_strength
7:26.103 frost_strike Fluffy_Pillow 65.0/100: 65% runic_power | 1.0/6: 17% rune unholy_strength
7:27.449 frost_strike Fluffy_Pillow 45.0/100: 45% runic_power | 1.0/6: 17% rune unholy_strength

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 20575 18869 7315 (5557)
Agility 8278 7953 0
Stamina 22275 22275 13238
Intellect 4751 4426 0
Spirit 2 2 0
Health 1336500 1336500 0
Runic Power 100 100 0
Rune 6 6 0
Crit 18.68% 17.61% 4414
Haste 11.72% 11.72% 3810
Swing Speed 25.13% 25.13% 3810
Damage / Heal Versatility 4.67% 4.67% 1870
Attack Power 20575 18869 0
Mastery 30.78% 30.78% 4381
Armor 3578 3578 3578
Run Speed 7 0 0
Leech 1.25% 1.25% 287

Gear

Source Slot Average Item Level: 797.00
Local Head Deathlord's Helm
ilevel: 810, stats: { 508 Armor, +1340 Sta, +894 Str, +707 Haste, +418 Crit }
Local Neck Tightweb Choker
ilevel: 840, stats: { +997 Sta, +1011 Haste, +758 Crit }
Local Shoulders Thorignir Heavy Pauldrons
ilevel: 680, stats: { 272 Armor, +200 StrInt, +300 Sta, +156 Crit, +110 Haste }
Local Chest Skoldiir Breastplate
ilevel: 825, stats: { 646 Armor, +1028 StrInt, +1542 Sta, +748 Crit, +441 Mastery }
Local Waist Hardshell Greatbelt
ilevel: 800, stats: { 344 Armor, +611 StrInt, +916 Sta, +563 Crit, +250 Haste }
Local Legs Rock Solid Legplates
ilevel: 825, stats: { 565 Armor, +1028 StrInt, +1542 Sta, +824 Haste, +365 Mastery }
Local Feet Valkyra Protector Greatboots
ilevel: 815, stats: { 434 Armor, +1053 Sta, +702 StrInt, +558 Haste, +300 Mastery }
Local Wrists Skoldiir Bracers
ilevel: 820, stats: { 279 Armor, +552 StrInt, +828 Sta, +398 Crit, +257 Mastery }
Local Hands Rumblestone Gauntlets
ilevel: 825, stats: { 404 Armor, +771 StrInt, +1157 Sta, +541 Vers, +350 Haste }
Local Finger1 Val'kyr Ascension Signet
ilevel: 805, stats: { +719 Sta, +931 Crit, +620 Mastery }
Local Finger2 Band of Crystalline Bone
ilevel: 825, stats: { +867 Sta, +1051 Vers, +621 Mastery, +287 Leech }, gems: { +150 Mastery }
Local Trinket1 Lost Etin's Strength
ilevel: 660, stats: { +210 Str }
Local Trinket2 Mountain Rage Shaker
ilevel: 800, stats: { +774 Mastery }
Local Back Stole of Malefic Repose
ilevel: 840, stats: { 126 Armor, +665 StrAgiInt, +997 Sta, +429 Mastery, +278 Vers }
Local Main Hand Blades of the Fallen Prince
ilevel: 793, weapon: { 1937 - 3599, 2.6 }, stats: { +327 Str, +490 Sta, +221 Crit, +212 Mastery }, enchant: rune_of_the_fallen_crusader, relics: { +28 ilevels, +15 ilevels }
Local Off Hand Blades of the Fallen Prince
ilevel: 793, weapon: { 1937 - 3599, 2.6 }, stats: { +327 Str, +490 Sta, +221 Crit, +212 Mastery }, enchant: rune_of_razorice
Local Tabard Stormwind Tabard
ilevel: 600

Talents

Level
15 Shattering Strikes (Frost Death Knight) Icy Talons (Frost Death Knight) Murderous Efficiency (Frost Death Knight)
30 Freezing Fog (Frost Death Knight) Frozen Pulse (Frost Death Knight) Horn of Winter (Frost Death Knight)
45 Icecap (Frost Death Knight) Hungering Rune Weapon (Frost Death Knight) Avalanche (Frost Death Knight)
60 Abomination's Might (Frost Death Knight) Blinding Sleet (Frost Death Knight) Winter is Coming (Frost Death Knight)
75 Volatile Shielding (Frost Death Knight) Permafrost (Frost Death Knight) White Walker (Frost Death Knight)
90 Frostscythe (Frost Death Knight) Runic Attenuation (Frost Death Knight) Gathering Storm (Frost Death Knight)
100 Obliteration (Frost Death Knight) Breath of Sindragosa (Frost Death Knight) Glacial Advance (Frost Death Knight)

Profile

deathknight="Decalang"
origin="https://eu.api.battle.net/wow/character/hyjal/Decalang/advanced"
thumbnail="http://eu.battle.net/static-render/eu/hyjal/92/114541916-avatar.jpg"
level=110
race=draenei
role=attack
position=back
professions=jewelcrafting=746/mining=759
talents=http://eu.battle.net/wow/en/tool/talent-calculator#dZ!0221202
artifact=12:0:0:0:0:108:1:109:3:113:3:115:3:119:1:122:1:1091:1:1332:1
spec=frost

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,name=countless_armies
actions.precombat+=/food,name=the_hungry_magister
actions.precombat+=/augmentation,name=defiled
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=deadly_grace

# Executed every time the actor is available.
actions=auto_attack
actions+=/arcane_torrent,if=runic_power.deficit>20
actions+=/blood_fury,if=!talent.breath_of_sindragosa.enabled|dot.breath_of_sindragosa.ticking
actions+=/berserking
actions+=/use_item,slot=trinket1
actions+=/potion,name=deadly_grace
actions+=/pillar_of_frost
actions+=/sindragosas_fury
actions+=/obliteration
actions+=/breath_of_sindragosa,if=runic_power>=50
actions+=/run_action_list,name=bos,if=dot.breath_of_sindragosa.ticking
actions+=/call_action_list,name=generic

actions.bos=howling_blast,target_if=!dot.frost_fever.ticking
actions.bos+=/call_action_list,name=core
actions.bos+=/horn_of_winter
actions.bos+=/empower_rune_weapon,if=runic_power<=70
actions.bos+=/hungering_rune_weapon
actions.bos+=/howling_blast,if=buff.rime.react

actions.generic=howling_blast,target_if=!dot.frost_fever.ticking
actions.generic+=/howling_blast,if=buff.rime.react
actions.generic+=/frost_strike,if=runic_power>=80
actions.generic+=/call_action_list,name=core
actions.generic+=/horn_of_winter,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains>15
actions.generic+=/horn_of_winter,if=!talent.breath_of_sindragosa.enabled
actions.generic+=/frost_strike,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains>15
actions.generic+=/frost_strike,if=!talent.breath_of_sindragosa.enabled
actions.generic+=/empower_rune_weapon,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains>15
actions.generic+=/hungering_rune_weapon,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains>15
actions.generic+=/empower_rune_weapon,if=!talent.breath_of_sindragosa.enabled
actions.generic+=/hungering_rune_weapon,if=!talent.breath_of_sindragosa.enabled

actions.core=glacial_advance
actions.core+=/frost_strike,if=buff.obliteration.up&!buff.killing_machine.react
actions.core+=/remorseless_winter,if=spell_targets.remorseless_winter>=2
actions.core+=/frostscythe,if=!talent.breath_of_sindragosa.enabled&(buff.killing_machine.react|spell_targets.frostscythe>=4)
actions.core+=/obliterate,if=buff.killing_machine.react
actions.core+=/obliterate
actions.core+=/frostscythe,if=talent.frozen_pulse.enabled
actions.core+=/howling_blast,if=talent.frozen_pulse.enabled

head=deathlords_helm,id=139676,bonus_id=3386/3381
neck=tightweb_choker,id=134541,bonus_id=1727/1492/1813
shoulders=thorignir_heavy_pauldrons,id=121516,bonus_id=1792
back=stole_of_malefic_repose,id=134404,bonus_id=1727/1492/1813
chest=skoldiir_breastplate,id=134179,bonus_id=1726/1487/1675
tabard=stormwind_tabard,id=118365
wrists=skoldiir_bracers,id=134186,bonus_id=3395/1482/1675
hands=rumblestone_gauntlets,id=137355,bonus_id=1726/1477
waist=hardshell_greatbelt,id=140622
legs=rock_solid_legplates,id=137342,bonus_id=1726/1477
feet=valkyra_protector_greatboots,id=136772,bonus_id=1826/1467/3339
finger1=valkyr_ascension_signet,id=133679,bonus_id=1826/1808/1457
finger2=band_of_crystalline_bone,id=134493,bonus_id=1726/1808/41/1477,gems=150mastery
trinket1=lost_etins_strength,id=129163,bonus_id=1794
trinket2=mountain_rage_shaker,id=121806
main_hand=blades_of_the_fallen_prince,id=128292,gem_id=132791/133059/0/0,relic_id=767:1734:1617:1809/1793:1565:1809/0/0,enchant=rune_of_the_fallen_crusader
off_hand=blades_of_the_fallen_prince,id=128293,enchant=rune_of_razorice

# Gear Summary
# gear_ilvl=797.25
# gear_strength=7315
# gear_stamina=13238
# gear_crit_rating=4414
# gear_haste_rating=3810
# gear_mastery_rating=4381
# gear_versatility_rating=1870
# gear_leech_rating=287
# gear_armor=3578

Ethila

Ethila : 159389 dps

  • Race: Human
  • Class: Deathknight
  • Spec: Frost
  • Level: 110
  • Role: Attack
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
159388.9 159388.9 90.9 / 0.057% 18209.9 / 11.4% 24766.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
6.4 6.4 Runic Power 18.11% 41.0 100.0% 100%
Origin https://eu.api.battle.net/wow/character/hyjal/Ethila/advanced
Talents
  • 15: Murderous Efficiency (Frost Death Knight)
  • 30: Freezing Fog (Frost Death Knight)
  • 45: Icecap (Frost Death Knight)
  • 60: Winter is Coming (Frost Death Knight)
  • 75: Permafrost (Frost Death Knight)
  • 90: Runic Attenuation (Frost Death Knight)
  • 100: Obliteration (Frost Death Knight)
  • Talent Calculator
Artifact
Professions
  • mining: 768
  • jewelcrafting: 728

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Ethila 159389
auto_attack_mh 8976 5.6% 224.9 2.01sec 17968 8975 Direct 224.9 17301 34601 17969 22.8% 19.0%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 224.90 224.90 0.00 0.00 2.0020 0.0000 4041034.75 5940703.85 31.98 8975.01 8975.01
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 130.93 58.22% 17300.56 15061 19471 17301.06 16687 17911 2265086 3329890 31.98
crit 51.33 22.82% 34600.52 30122 38941 34601.36 32774 36430 1775949 2610814 31.98
miss 42.65 18.96% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 4498 2.8% 224.9 2.01sec 9004 4497 Direct 224.9 8671 17340 9004 22.8% 19.0%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 224.88 224.88 0.00 0.00 2.0020 0.0000 2024768.60 2976601.64 31.98 4497.42 4497.42
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 130.81 58.17% 8670.59 7531 9735 8671.04 8376 8939 1134210 1667396 31.98
crit 51.36 22.84% 17340.14 15061 19471 17339.88 16471 18245 890559 1309206 31.98
miss 42.71 18.99% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Brittle 9366 5.9% 53.8 7.98sec 78292 0 Direct 53.8 63740 127481 78291 22.8% 0.0%  

Stats details: brittle

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.79 53.79 0.00 0.00 0.0000 0.0000 4211287.69 4211287.69 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.51 77.17% 63740.17 60948 67043 63735.96 62281 65296 2645855 2645855 0.00
crit 12.28 22.83% 127480.92 121896 134086 127471.20 121896 134086 1565433 1565433 0.00
 
 

Action details: brittle

Static Values
  • id:214964
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:214964
  • name:Brittle
  • school:frost
  • tooltip:Movement speed reduced by {$s2=30}%.
  • description:{$@spelldesc214962=Sheathe your weapons in ice for {$d=30 seconds}, giving your attacks a chance to cause {$214964s1=31338 to 34637} additional Frost damage and slow the target's movement speed by {$214964s2=30}% for {$214964d=8 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:36041.28
  • base_dd_max:39835.10
 
Crystalline Swords 12127 7.6% 81.7 10.96sec 66838 0 Direct 81.7 54457 108906 66837 22.7% 0.0%  

Stats details: crystalline_swords

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.69 81.69 0.00 0.00 0.0000 0.0000 5460307.50 5460307.50 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 63.12 77.26% 54456.98 43361 65821 54459.11 50846 59220 3437230 3437230 0.00
crit 18.58 22.74% 108905.80 86721 131643 108910.21 91925 123665 2023078 2023078 0.00
 
 

Action details: crystalline_swords

Static Values
  • id:205165
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:0.3000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205165
  • name:Crystalline Swords
  • school:frost
  • tooltip:
  • description:{$@spelldesc189186=Your melee attacks have a chance to create icy copies of |cFFFFCC99Icebringer|r and |cFFFFCC99Frostreaper|r, which will then stab and pierce your foes.}
 
Deadly Grace 3870 2.4% 23.0 3.79sec 74522 0 Direct 23.0 60712 121425 74521 22.7% 0.0%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.02 23.02 0.00 0.00 0.0000 0.0000 1715773.07 1715773.07 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.79 77.25% 60712.28 60712 60712 60712.28 60712 60712 1079870 1079870 0.00
crit 5.24 22.75% 121424.56 121425 121425 121096.68 0 121425 635903 635903 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:5.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=47572 to 71358} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:47572.00
  • base_dd_max:71358.00
 
Frost Fever 12651 7.9% 52.9 8.63sec 107624 0 Periodic 149.8 30963 61924 38030 22.8% 0.0% 99.5%

Stats details: frost_fever

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.95 0.00 149.84 149.84 0.0000 2.9917 5698607.53 5698607.53 0.00 12712.16 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 115.6 77.17% 30963.48 17 37710 30965.03 29290 32322 3580564 3580564 0.00
crit 34.2 22.83% 61924.22 19 75420 61933.06 55545 67833 2118043 2118043 0.00
 
 

Action details: frost_fever

Static Values
  • id:55095
  • school:frost
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:55095
  • name:Frost Fever
  • school:frost
  • tooltip:Suffering $w1 Frost damage every $t1 sec.
  • description:A disease that deals ${8*{$s1=0}} Frost damage over {$d=24 seconds} and has a chance to grant the Death Knight ${$195617m1/10} Runic Power each time it deals damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.550000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:24.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Frost Strike 0 (48433) 0.0% (30.4%) 115.8 3.87sec 188249 144716

Stats details: frost_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 115.83 0.00 0.00 0.00 1.3008 0.0000 0.00 0.00 0.00 144716.08 144716.08
 
 

Action details: frost_strike

Static Values
  • id:49143
  • school:frost
  • resource:runic_power
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:runic_power>=80
Spelldata
  • id:49143
  • name:Frost Strike
  • school:frost
  • tooltip:
  • description:Chill your weapons with icy power, and quickly strike the enemy with both weapons, dealing a total of ${$222026sw1+$66196sw1} Frost damage.
 
    Frost Strike (_mh) 31246 19.6% 115.8 3.87sec 121449 0 Direct 115.8 98851 197779 121448 22.8% 0.0%  

Stats details: frost_strike_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 115.83 115.83 0.00 0.00 0.0000 0.0000 14067726.48 14067726.48 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 89.37 77.16% 98851.49 81941 116028 98860.57 94605 103883 8834770 8834770 0.00
crit 26.46 22.84% 197779.18 163882 232055 197764.18 177426 220431 5232956 5232956 0.00
 
 

Action details: frost_strike_mh

Static Values
  • id:222026
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222026
  • name:Frost Strike
  • school:frost
  • tooltip:
  • description:Instantly strike the enemy with your off-hand weapon, causing $sw2 Frost damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.50
 
    Frost Strike Off-Hand 17187 10.8% 115.8 3.87sec 66800 0 Direct 115.8 54382 108784 66800 22.8% 0.0%  

Stats details: frost_strike_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 115.83 115.83 0.00 0.00 0.0000 0.0000 7737658.55 7737658.55 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 89.39 77.17% 54382.41 45070 63818 54386.97 52284 56892 4861375 4861375 0.00
crit 26.44 22.83% 108783.92 90139 127635 108776.54 99131 120600 2876283 2876283 0.00
 
 

Action details: frost_strike_offhand

Static Values
  • id:66196
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:66196
  • name:Frost Strike Off-Hand
  • school:frost
  • tooltip:
  • description:Instantly strike the enemy with your off-hand weapon, causing $sw2 Frost damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.50
 
Howling Blast 17622 11.1% 52.9 8.63sec 149762 115196 Direct 52.9 121978 243647 149760 22.8% 0.0%  

Stats details: howling_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.95 52.95 0.00 0.00 1.3001 0.0000 7929764.43 7929764.43 0.00 115196.25 115196.25
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.86 77.17% 121977.82 24842 150841 121908.76 106168 133708 4983777 4983777 0.00
crit 12.09 22.83% 243646.91 49684 301682 243554.37 150225 301682 2945988 2945988 0.00
 
 

Action details: howling_blast

Static Values
  • id:49184
  • school:frost
  • resource:rune
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49184
  • name:Howling Blast
  • school:frost
  • tooltip:
  • description:Blast the target with a frigid wind, dealing {$s2=0} {$?s204088=false}[Frost damage and applying Frost Fever to the target.][Frost damage to that foe, and ${($m1/100)*$m2} Frost damage to all other enemies within 10 yards, infecting all targets with Frost Fever.] |Tinterface\icons\spell_deathknight_frostfever.blp:24|t |cFFFFFFFFFrost Fever|r {$@spelldesc55095=A disease that deals ${8*{$s1=0}} Frost damage over {$d=24 seconds} and has a chance to grant the Death Knight ${$195617m1/10} Runic Power each time it deals damage.}
 
Obliterate 0 (35597) 0.0% (22.3%) 114.8 3.92sec 139520 107549

Stats details: obliterate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 114.82 0.00 0.00 0.00 1.2973 0.0000 0.00 0.00 0.00 107549.35 107549.35
 
 

Action details: obliterate

Static Values
  • id:49020
  • school:physical
  • resource:rune
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.killing_machine.react
Spelldata
  • id:49020
  • name:Obliterate
  • school:physical
  • tooltip:
  • description:A brutal attack with both weapons that deals a total of ${$222024sw1+$66198sw1} Physical damage.
 
    Obliterate (_mh) 22967 14.4% 114.8 3.92sec 90018 0 Direct 114.8 52291 123077 90018 53.3% 0.0%  

Stats details: obliterate_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 114.82 114.82 0.00 0.00 0.0000 0.0000 10335833.92 15194654.90 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 53.62 46.70% 52290.71 45341 58366 52294.05 50232 54659 2804032 4122193 31.98
crit 61.20 53.30% 123077.36 107006 137744 123081.97 116632 127972 7531802 11072462 31.98
 
 

Action details: obliterate_mh

Static Values
  • id:222024
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222024
  • name:Obliterate
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack with both weapons that deals a total of ${$222024sw1+$66198sw1} Physical damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.20
 
    Obliterate Off-Hand 12629 7.9% 114.8 3.92sec 49502 0 Direct 114.8 28758 67702 49502 53.3% 0.0%  

Stats details: obliterate_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 114.82 114.82 0.00 0.00 0.0000 0.0000 5683749.17 8355649.66 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 53.66 46.73% 28757.81 24939 32103 28760.50 27583 29933 1543167 2268601 31.98
crit 61.16 53.27% 67702.18 58856 75762 67703.93 64862 70908 4140582 6087048 31.98
 
 

Action details: obliterate_offhand

Static Values
  • id:66198
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:66198
  • name:Obliterate Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack with both weapons that deals a total of ${$222024sw1+$66198sw1} Physical damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.20
 
Razorice 6250 3.9% 412.9 1.09sec 6814 0 Direct 412.9 5549 11096 6814 22.8% 0.0%  

Stats details: razorice

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 412.88 412.88 0.00 0.00 0.0000 0.0000 2813518.88 2813518.88 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 318.68 77.18% 5548.75 4592 6531 5549.10 5375 5712 1768275 1768275 0.00
crit 94.20 22.82% 11095.61 9185 13061 11096.33 10472 11624 1045244 1045244 0.00
 
 

Action details: razorice

Static Values
  • id:50401
  • school:frost
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:50401
  • name:Razorice
  • school:frost
  • tooltip:
  • description:{$@spelldesc53343=Affixes your weapon with a rune that causes {$50401s1=0}% extra weapon damage as Frost damage and increases enemies' vulnerability to your Frost attacks by {$51714s1=2}%, stacking up to {$51714u=5} times. Modifying your rune weapon requires a Rune Forge in Ebon Hold.}
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.10
 
Simple Action Stats Execute Interval
Ethila
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Ethila
  • harmful:false
  • if_expr:
 
Empower Rune Weapon 2.8 186.33sec

Stats details: empower_rune_weapon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.76 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: empower_rune_weapon

Static Values
  • id:47568
  • school:physical
  • resource:runic_power
  • range:0.0
  • travel_speed:4.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:runic_power<=70
Spelldata
  • id:47568
  • name:Empower Rune Weapon
  • school:physical
  • tooltip:
  • description:Empower your rune weapon, immediately activating all your runes and generating {$s3=25} Runic Power.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Ethila
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Ethila
  • harmful:false
  • if_expr:
 
Obliteration 5.5 90.34sec

Stats details: obliteration

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.51 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: obliteration

Static Values
  • id:207256
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:4.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:207256
  • name:Obliteration
  • school:physical
  • tooltip:Obliterate cost reduced. Triggering Killing Machine from Frost Strike hits.
  • description:For the next {$d=8 seconds}, every Frost Strike hit triggers Killing Machine, and Obliterate costs {$s1=1} less Rune.
 
Pillar of Frost 9.9 48.29sec

Stats details: pillar_of_frost

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.91 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: pillar_of_frost

Static Values
  • id:51271
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:51271
  • name:Pillar of Frost
  • school:physical
  • tooltip:Strength increased by {$s1=20}%.
  • description:The power of Frost increases your Strength by {$s1=20}%, and grants immunity to external movement effects such as knockbacks. Lasts {$d=20 seconds}.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Unholy Strength 29.5 15.16sec

Stats details: unholy_strength

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 29.54 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: unholy_strength

Static Values
  • id:53365
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Ethila
  • harmful:true
  • if_expr:
Spelldata
  • id:53365
  • name:Unholy Strength
  • school:physical
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 10.93% 0.0(0.0) 1.0

Buff details

  • buff initial source:Ethila
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Down Draft 5.2 0.0 76.1sec 75.9sec 22.59% 22.64% 5.0(5.0) 5.0

Buff details

  • buff initial source:Ethila
  • cooldown name:buff_down_draft
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:295.64

Stack Uptimes

  • down_draft_1:1.15%
  • down_draft_2:1.15%
  • down_draft_3:1.15%
  • down_draft_4:1.15%
  • down_draft_5:1.14%
  • down_draft_6:1.14%
  • down_draft_7:1.14%
  • down_draft_8:1.14%
  • down_draft_9:1.13%
  • down_draft_10:1.13%
  • down_draft_11:1.13%
  • down_draft_12:1.13%
  • down_draft_13:1.12%
  • down_draft_14:1.12%
  • down_draft_15:1.12%
  • down_draft_16:1.11%
  • down_draft_17:1.11%
  • down_draft_18:1.11%
  • down_draft_19:1.11%
  • down_draft_20:1.10%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:214342
  • name:Down Draft
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc214340=Your melee attacks have a chance to grant you {$214342s1=319} Haste every $215024t2 sec for {$215024d=20 seconds}.}
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Killing Machine 45.5 5.5 9.9sec 8.9sec 23.64% 28.23% 5.5(5.5) 0.0

Buff details

  • buff initial source:Ethila
  • cooldown name:buff_killing_machine
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1000.00

Stack Uptimes

  • killing_machine_1:23.64%

Trigger Attempt Success

  • trigger_pct:50.04%

Spelldata details

  • id:51124
  • name:Killing Machine
  • tooltip:Guaranteed critical strike on your next Obliterate{$?s207230=false}[ or Frostscythe][].
  • description:Your auto attack has a chance to cause your next Obliterate {$?s207230=false}[or Frostscythe ][]to be a guaranteed critical strike.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Obliteration 5.5 0.0 90.3sec 90.3sec 9.70% 9.32% 0.0(0.0) 5.4

Buff details

  • buff initial source:Ethila
  • cooldown name:buff_obliteration
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • obliteration_1:9.70%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:207256
  • name:Obliteration
  • tooltip:Obliterate cost reduced. Triggering Killing Machine from Frost Strike hits.
  • description:For the next {$d=8 seconds}, every Frost Strike hit triggers Killing Machine, and Obliterate costs {$s1=1} less Rune.
  • max_stacks:0
  • duration:8.00
  • cooldown:90.00
  • default_chance:100.00%
Pillar of Frost 9.9 0.0 47.8sec 48.3sec 43.11% 42.53% 0.0(0.0) 9.5

Buff details

  • buff initial source:Ethila
  • cooldown name:buff_pillar_of_frost
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • pillar_of_frost_1:43.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:51271
  • name:Pillar of Frost
  • tooltip:Strength increased by {$s1=20}%.
  • description:The power of Frost increases your Strength by {$s1=20}%, and grants immunity to external movement effects such as knockbacks. Lasts {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:60.00
  • default_chance:0.00%
Potion of Deadly Grace 2.0 0.0 58.3sec 0.0sec 10.83% 10.89% 0.0(0.0) 2.0

Buff details

  • buff initial source:Ethila
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:10.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Rime 51.4 0.2 8.7sec 8.7sec 15.26% 49.10% 0.2(0.2) 0.0

Buff details

  • buff initial source:Ethila
  • cooldown name:buff_rime
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:45.00%
  • default_value:-0.00

Stack Uptimes

  • rime_1:15.26%

Trigger Attempt Success

  • trigger_pct:44.99%

Spelldata details

  • id:59052
  • name:Rime
  • tooltip:Your next Howling Blast will consume no Runes, generate no Runic Power, and deals {$s2=300}% additional damage.
  • description:Your next Howling Blast will consume no Runes, generate no Runic Power, and deal {$s2=300}% additional damage.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Sheathed in Frost 4.3 0.0 120.3sec 120.3sec 27.63% 27.69% 0.0(0.0) 4.0

Buff details

  • buff initial source:Ethila
  • cooldown name:buff_sheathed_in_frost
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • sheathed_in_frost_1:27.63%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:214962
  • name:Sheathed in Frost
  • tooltip:Your attacks have a chance to cause {$214964s1=31338 to 34637} additional Frost damage and slow the target's movement speed by {$214964s2=30}% for {$214964d=8 seconds} .
  • description:Sheathe your weapons in ice for {$d=30 seconds}, giving your attacks a chance to cause {$214964s1=31338 to 34637} additional Frost damage and slow the target's movement speed by {$214964s2=30}% for {$214964d=8 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:120.00
  • default_chance:101.00%
Unholy Strength 12.7 16.8 36.2sec 15.2sec 66.25% 65.85% 16.8(16.8) 12.0

Buff details

  • buff initial source:Ethila
  • cooldown name:buff_unholy_strength
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • unholy_strength_1:66.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:53365
  • name:Unholy Strength
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Ethila
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Countless Armies

Buff details

  • buff initial source:Ethila
  • cooldown name:buff_flask_of_the_countless_armies
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:strength
  • amount:1300.00

Stack Uptimes

  • flask_of_the_countless_armies_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188034
  • name:Flask of the Countless Armies
  • tooltip:Strength increased by $w1.
  • description:Increases Strength by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (the_hungry_magister)

Buff details

  • buff initial source:Ethila
  • cooldown name:buff_the_hungry_magister
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:375.00

Stack Uptimes

  • the_hungry_magister_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225602
  • name:Well Fed
  • tooltip:Critical Strike increased by $w1.
  • description:Increases critical strike by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Rune waste details (experimental)

In the table below, "Seconds per Rune" denotes the time in seconds an individual rune is wasting regeneration. The "Total Seconds per Iteration" denotes the cumulative time in seconds all runes wasted during a single iteration.

Seconds per Rune (n=133814)
Minimum 5th percentile Mean / Median 95th percentile Maximum
0.0010.3611.862 / 1.3654.43612.852
Total Seconds per Iteration (n=10007)
Minimum 5th percentile Mean / Median 95th percentile Maximum
7.17013.38224.901 / 23.70140.30176.486

Resources

Resource Usage Type Count Total Average RPE APR
Ethila
frost_strike Runic Power 115.8 2895.8 25.0 25.0 7530.0
howling_blast Rune 52.9 1.7 0.0 0.0 4755102.6
obliterate Rune 114.8 214.9 1.9 1.9 74561.7
Resource Gains Type Count Total Average Overflow
howling_blast Runic Power 1.67 16.68 (0.57%) 10.00 0.00 0.00%
obliterate Runic Power 114.82 2296.40 (78.41%) 20.00 0.00 0.00%
Frost Fever Runic Power 26.46 132.03 (4.51%) 4.99 0.27 0.20%
Murderous Efficiency Rune 22.64 22.64 (10.70%) 1.00 0.00 0.00%
Rune Regeneration Rune 145.43 145.43 (68.75%) 1.00 0.00 0.00%
Runic Empowerment Rune 28.97 28.95 (13.69%) 1.00 0.02 0.06%
Empower Rune Weapon Rune 14.51 14.51 (6.86%) 1.00 0.00 0.00%
Runic Attenuation Runic Power 449.77 449.29 (15.34%) 1.00 0.48 0.11%
Over-Powered Runic Power 11.46 34.32 (1.17%) 3.00 0.05 0.15%
Resource RPS-Gain RPS-Loss
Runic Power 6.50 6.43
Rune 0.47 0.48
Combat End Resource Mean Min Max
Runic Power 32.66 0.00 100.00
Rune 1.02 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Runic Power Cap 0.1%

Procs

Count Interval
Killing Machine: Obliterate 45.3 10.0sec
Rune ready 211.5 2.7sec

Statistics & Data Analysis

Fight Length
Sample Data Ethila Fight Length
Count 9999
Mean 450.42
Minimum 350.15
Maximum 555.44
Spread ( max - min ) 205.29
Range [ ( max - min ) / 2 * 100% ] 22.79%
DPS
Sample Data Ethila Damage Per Second
Count 9999
Mean 159388.91
Minimum 141151.90
Maximum 179286.62
Spread ( max - min ) 38134.73
Range [ ( max - min ) / 2 * 100% ] 11.96%
Standard Deviation 4638.7663
5th Percentile 151996.08
95th Percentile 167257.86
( 95th Percentile - 5th Percentile ) 15261.78
Mean Distribution
Standard Deviation 46.3900
95.00% Confidence Intervall ( 159297.99 - 159479.83 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 32
0.1% Error 3253
0.1 Scale Factor Error with Delta=300 183691
0.05 Scale Factor Error with Delta=300 734765
0.01 Scale Factor Error with Delta=300 18369133
Priority Target DPS
Sample Data Ethila Priority Target Damage Per Second
Count 9999
Mean 159388.91
Minimum 141151.90
Maximum 179286.62
Spread ( max - min ) 38134.73
Range [ ( max - min ) / 2 * 100% ] 11.96%
Standard Deviation 4638.7663
5th Percentile 151996.08
95th Percentile 167257.86
( 95th Percentile - 5th Percentile ) 15261.78
Mean Distribution
Standard Deviation 46.3900
95.00% Confidence Intervall ( 159297.99 - 159479.83 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 32
0.1% Error 3253
0.1 Scale Factor Error with Delta=300 183691
0.05 Scale Factor Error with Delta=300 734765
0.01 Scale Factor Error with Delta=300 18369133
DPS(e)
Sample Data Ethila Damage Per Second (Effective)
Count 9999
Mean 159388.91
Minimum 141151.90
Maximum 179286.62
Spread ( max - min ) 38134.73
Range [ ( max - min ) / 2 * 100% ] 11.96%
Damage
Sample Data Ethila Damage
Count 9999
Mean 71720030.58
Minimum 50956681.54
Maximum 92307253.96
Spread ( max - min ) 41350572.42
Range [ ( max - min ) / 2 * 100% ] 28.83%
DTPS
Sample Data Ethila Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Ethila Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Ethila Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Ethila Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Ethila Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Ethila Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data EthilaTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Ethila Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,name=countless_armies
1 0.00 food,name=the_hungry_magister
2 0.00 augmentation,name=defiled
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=deadly_grace
Default action list Executed every time the actor is available.
# count action,conditions
5 1.00 auto_attack
0.00 arcane_torrent,if=runic_power.deficit>20
0.00 blood_fury,if=!talent.breath_of_sindragosa.enabled|dot.breath_of_sindragosa.ticking
0.00 berserking
6 4.32 use_item,slot=trinket2
7 1.00 potion,name=deadly_grace
8 9.92 pillar_of_frost
0.00 sindragosas_fury
9 5.51 obliteration
0.00 breath_of_sindragosa,if=runic_power>=50
A 0.00 run_action_list,name=bos,if=dot.breath_of_sindragosa.ticking
B 0.00 call_action_list,name=generic
actions.generic
# count action,conditions
D 1.78 howling_blast,target_if=!dot.frost_fever.ticking
E 51.17 howling_blast,if=buff.rime.react
F 9.41 frost_strike,if=runic_power>=80
G 0.00 call_action_list,name=core
0.00 horn_of_winter,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains>15
0.00 horn_of_winter,if=!talent.breath_of_sindragosa.enabled
0.00 frost_strike,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains>15
H 94.56 frost_strike,if=!talent.breath_of_sindragosa.enabled
0.00 empower_rune_weapon,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains>15
0.00 hungering_rune_weapon,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains>15
I 2.77 empower_rune_weapon,if=!talent.breath_of_sindragosa.enabled
0.00 hungering_rune_weapon,if=!talent.breath_of_sindragosa.enabled
actions.core
# count action,conditions
0.00 glacial_advance
J 11.86 frost_strike,if=buff.obliteration.up&!buff.killing_machine.react
0.00 remorseless_winter,if=spell_targets.remorseless_winter>=2
0.00 frostscythe,if=!talent.breath_of_sindragosa.enabled&(buff.killing_machine.react|spell_targets.frostscythe>=4)
K 40.05 obliterate,if=buff.killing_machine.react
L 74.77 obliterate
0.00 frostscythe,if=talent.frozen_pulse.enabled
0.00 howling_blast,if=talent.frozen_pulse.enabled

Sample Sequence

01245689DKJKJKJLLHLHLHILLLEFHLLFLFHLELFHHKELEHHL8ELHHKEH7KELHHKLELFHHKHL9JKJK8JKLLEHHKELLFFHLHLH6LEHHKEHKELHHLLHH8KEHHLLHHKHLHLE9KJKEJKELEFLEFL8FLEFKFHLEHHLHHIKELKHHLHLH6LHHK8ELHLEHLHLHHKELHH9LJKJKLELHLHHHKHL8HLHKELEHHLHLEHLHKHLEHLELELFLFHHKH8LEHLEH6L9JKEJKJKHLHLEHLHLHLEHIL8LLFHHKELHHLHLHKLHHHLEHKK

Sample Sequence Table

time name target resources buffs
Pre flask Ethila 0.0/100: 0% runic_power | 6.0/6: 100% rune
Pre food Ethila 0.0/100: 0% runic_power | 6.0/6: 100% rune
Pre augmentation Ethila 0.0/100: 0% runic_power | 6.0/6: 100% rune
Pre potion Fluffy_Pillow 0.0/100: 0% runic_power | 6.0/6: 100% rune potion_of_deadly_grace
0:00.000 auto_attack Fluffy_Pillow 0.0/100: 0% runic_power | 6.0/6: 100% rune potion_of_deadly_grace
0:00.000 use_item_faulty_countermeasure Fluffy_Pillow 2.0/100: 2% runic_power | 6.0/6: 100% rune killing_machine, potion_of_deadly_grace
0:00.000 pillar_of_frost Fluffy_Pillow 2.0/100: 2% runic_power | 6.0/6: 100% rune killing_machine, potion_of_deadly_grace
0:00.000 obliteration Fluffy_Pillow 2.0/100: 2% runic_power | 6.0/6: 100% rune killing_machine, pillar_of_frost, potion_of_deadly_grace
0:00.000 howling_blast Fluffy_Pillow 2.0/100: 2% runic_power | 6.0/6: 100% rune killing_machine, obliteration, pillar_of_frost, potion_of_deadly_grace
0:01.280 obliterate Fluffy_Pillow 14.0/100: 14% runic_power | 5.0/6: 83% rune bloodlust, killing_machine, obliteration, pillar_of_frost, sheathed_in_frost, potion_of_deadly_grace
0:02.332 frost_strike Fluffy_Pillow 34.0/100: 34% runic_power | 4.0/6: 67% rune bloodlust, obliteration, pillar_of_frost, sheathed_in_frost, potion_of_deadly_grace
0:03.385 obliterate Fluffy_Pillow 11.0/100: 11% runic_power | 5.0/6: 83% rune bloodlust, killing_machine, obliteration, pillar_of_frost, sheathed_in_frost, potion_of_deadly_grace
0:04.436 frost_strike Fluffy_Pillow 33.0/100: 33% runic_power | 4.0/6: 67% rune bloodlust, obliteration, pillar_of_frost, sheathed_in_frost, potion_of_deadly_grace
0:05.488 obliterate Fluffy_Pillow 8.0/100: 8% runic_power | 4.0/6: 67% rune bloodlust, killing_machine, obliteration, pillar_of_frost, sheathed_in_frost, potion_of_deadly_grace
0:06.539 frost_strike Fluffy_Pillow 30.0/100: 30% runic_power | 3.0/6: 50% rune bloodlust, obliteration, pillar_of_frost, sheathed_in_frost, potion_of_deadly_grace
0:07.591 obliterate Fluffy_Pillow 7.0/100: 7% runic_power | 3.0/6: 50% rune bloodlust, killing_machine, obliteration, pillar_of_frost, sheathed_in_frost, potion_of_deadly_grace
0:08.641 obliterate Fluffy_Pillow 27.0/100: 27% runic_power | 3.0/6: 50% rune bloodlust, pillar_of_frost, sheathed_in_frost, potion_of_deadly_grace
0:09.694 frost_strike Fluffy_Pillow 49.0/100: 49% runic_power | 1.0/6: 17% rune bloodlust, pillar_of_frost, sheathed_in_frost, potion_of_deadly_grace
0:10.745 obliterate Fluffy_Pillow 26.0/100: 26% runic_power | 3.0/6: 50% rune bloodlust, pillar_of_frost, sheathed_in_frost, potion_of_deadly_grace
0:11.796 frost_strike Fluffy_Pillow 46.0/100: 46% runic_power | 1.0/6: 17% rune bloodlust, pillar_of_frost, sheathed_in_frost, potion_of_deadly_grace
0:12.847 obliterate Fluffy_Pillow 23.0/100: 23% runic_power | 3.0/6: 50% rune bloodlust, pillar_of_frost, unholy_strength, sheathed_in_frost, potion_of_deadly_grace
0:13.899 frost_strike Fluffy_Pillow 43.0/100: 43% runic_power | 1.0/6: 17% rune bloodlust, pillar_of_frost, unholy_strength, sheathed_in_frost, potion_of_deadly_grace
0:14.950 empower_rune_weapon Fluffy_Pillow 20.0/100: 20% runic_power | 1.0/6: 17% rune bloodlust, pillar_of_frost, unholy_strength, sheathed_in_frost, potion_of_deadly_grace
0:14.950 obliterate Fluffy_Pillow 20.0/100: 20% runic_power | 6.0/6: 100% rune bloodlust, pillar_of_frost, unholy_strength, sheathed_in_frost, potion_of_deadly_grace
0:16.001 obliterate Fluffy_Pillow 42.0/100: 42% runic_power | 4.0/6: 67% rune bloodlust, killing_machine, pillar_of_frost, unholy_strength, sheathed_in_frost, potion_of_deadly_grace
0:17.053 obliterate Fluffy_Pillow 62.0/100: 62% runic_power | 3.0/6: 50% rune bloodlust, pillar_of_frost, rime, unholy_strength, sheathed_in_frost, potion_of_deadly_grace
0:18.103 howling_blast Fluffy_Pillow 89.0/100: 89% runic_power | 1.0/6: 17% rune bloodlust, pillar_of_frost, rime, unholy_strength, sheathed_in_frost, potion_of_deadly_grace
0:19.156 frost_strike Fluffy_Pillow 91.0/100: 91% runic_power | 1.0/6: 17% rune bloodlust, pillar_of_frost, unholy_strength, sheathed_in_frost, potion_of_deadly_grace
0:20.207 frost_strike Fluffy_Pillow 66.0/100: 66% runic_power | 1.0/6: 17% rune bloodlust, unholy_strength, sheathed_in_frost, potion_of_deadly_grace
0:21.256 obliterate Fluffy_Pillow 43.0/100: 43% runic_power | 2.0/6: 33% rune bloodlust, unholy_strength, sheathed_in_frost, potion_of_deadly_grace
0:22.307 obliterate Fluffy_Pillow 65.0/100: 65% runic_power | 2.0/6: 33% rune bloodlust, unholy_strength, sheathed_in_frost, potion_of_deadly_grace
0:23.358 frost_strike Fluffy_Pillow 85.0/100: 85% runic_power | 1.0/6: 17% rune bloodlust, unholy_strength, sheathed_in_frost
0:24.411 obliterate Fluffy_Pillow 62.0/100: 62% runic_power | 2.0/6: 33% rune bloodlust, unholy_strength, sheathed_in_frost
0:25.463 frost_strike Fluffy_Pillow 84.0/100: 84% runic_power | 0.0/6: 0% rune bloodlust, unholy_strength, sheathed_in_frost
0:26.514 frost_strike Fluffy_Pillow 59.0/100: 59% runic_power | 1.0/6: 17% rune bloodlust, unholy_strength, sheathed_in_frost
0:27.566 obliterate Fluffy_Pillow 41.0/100: 41% runic_power | 2.0/6: 33% rune bloodlust, unholy_strength, sheathed_in_frost
0:28.618 howling_blast Fluffy_Pillow 63.0/100: 63% runic_power | 0.0/6: 0% rune bloodlust, rime, unholy_strength, sheathed_in_frost
0:29.670 obliterate Fluffy_Pillow 63.0/100: 63% runic_power | 2.0/6: 33% rune bloodlust, unholy_strength, sheathed_in_frost
0:30.724 frost_strike Fluffy_Pillow 85.0/100: 85% runic_power | 1.0/6: 17% rune bloodlust, unholy_strength
0:31.775 frost_strike Fluffy_Pillow 60.0/100: 60% runic_power | 1.0/6: 17% rune bloodlust, unholy_strength
0:32.827 frost_strike Fluffy_Pillow 37.0/100: 37% runic_power | 1.0/6: 17% rune bloodlust, killing_machine, unholy_strength
0:33.879 obliterate Fluffy_Pillow 14.0/100: 14% runic_power | 2.0/6: 33% rune bloodlust, killing_machine, unholy_strength
0:34.933 howling_blast Fluffy_Pillow 34.0/100: 34% runic_power | 0.0/6: 0% rune bloodlust, rime, unholy_strength
0:35.986 obliterate Fluffy_Pillow 36.0/100: 36% runic_power | 2.0/6: 33% rune bloodlust, unholy_strength
0:37.036 howling_blast Fluffy_Pillow 58.0/100: 58% runic_power | 1.0/6: 17% rune bloodlust, rime, unholy_strength
0:38.087 frost_strike Fluffy_Pillow 58.0/100: 58% runic_power | 1.0/6: 17% rune bloodlust, unholy_strength
0:39.139 frost_strike Fluffy_Pillow 35.0/100: 35% runic_power | 1.0/6: 17% rune bloodlust, unholy_strength
0:40.190 Waiting 3.300 sec 12.0/100: 12% runic_power | 1.0/6: 17% rune bloodlust, unholy_strength
0:43.490 obliterate Fluffy_Pillow 14.0/100: 14% runic_power | 3.0/6: 50% rune
0:44.856 pillar_of_frost Fluffy_Pillow 36.0/100: 36% runic_power | 2.0/6: 33% rune rime
0:45.000 howling_blast Fluffy_Pillow 36.0/100: 36% runic_power | 2.0/6: 33% rune pillar_of_frost, rime
0:46.367 obliterate Fluffy_Pillow 38.0/100: 38% runic_power | 2.0/6: 33% rune pillar_of_frost
0:47.731 frost_strike Fluffy_Pillow 58.0/100: 58% runic_power | 0.0/6: 0% rune pillar_of_frost
0:49.097 frost_strike Fluffy_Pillow 35.0/100: 35% runic_power | 0.0/6: 0% rune killing_machine, pillar_of_frost
0:50.462 Waiting 2.100 sec 12.0/100: 12% runic_power | 0.0/6: 0% rune killing_machine, pillar_of_frost
0:52.562 obliterate Fluffy_Pillow 14.0/100: 14% runic_power | 2.0/6: 33% rune killing_machine, pillar_of_frost
0:53.927 howling_blast Fluffy_Pillow 34.0/100: 34% runic_power | 1.0/6: 17% rune pillar_of_frost, rime
0:55.292 frost_strike Fluffy_Pillow 36.0/100: 36% runic_power | 1.0/6: 17% rune killing_machine, pillar_of_frost
0:56.657 Waiting 1.100 sec 13.0/100: 13% runic_power | 1.0/6: 17% rune killing_machine, pillar_of_frost, unholy_strength
0:57.757 potion Fluffy_Pillow 13.0/100: 13% runic_power | 1.0/6: 17% rune killing_machine, pillar_of_frost, unholy_strength
0:58.000 Waiting 3.600 sec 13.0/100: 13% runic_power | 1.0/6: 17% rune killing_machine, pillar_of_frost, unholy_strength, potion_of_deadly_grace
1:01.600 obliterate Fluffy_Pillow 22.0/100: 22% runic_power | 3.0/6: 50% rune killing_machine, pillar_of_frost, unholy_strength, potion_of_deadly_grace
1:02.966 howling_blast Fluffy_Pillow 44.0/100: 44% runic_power | 3.0/6: 50% rune pillar_of_frost, rime, unholy_strength, potion_of_deadly_grace
1:04.331 obliterate Fluffy_Pillow 44.0/100: 44% runic_power | 3.0/6: 50% rune pillar_of_frost, unholy_strength, potion_of_deadly_grace
1:05.694 frost_strike Fluffy_Pillow 66.0/100: 66% runic_power | 1.0/6: 17% rune unholy_strength, potion_of_deadly_grace
1:07.058 frost_strike Fluffy_Pillow 43.0/100: 43% runic_power | 1.0/6: 17% rune killing_machine, unholy_strength, potion_of_deadly_grace
1:08.424 Waiting 2.300 sec 18.0/100: 18% runic_power | 1.0/6: 17% rune killing_machine, unholy_strength, potion_of_deadly_grace
1:10.724 obliterate Fluffy_Pillow 20.0/100: 20% runic_power | 3.0/6: 50% rune killing_machine, unholy_strength, potion_of_deadly_grace
1:12.088 obliterate Fluffy_Pillow 42.0/100: 42% runic_power | 3.0/6: 50% rune killing_machine, unholy_strength, potion_of_deadly_grace
1:13.454 howling_blast Fluffy_Pillow 64.0/100: 64% runic_power | 2.0/6: 33% rune rime, unholy_strength, potion_of_deadly_grace
1:14.820 obliterate Fluffy_Pillow 64.0/100: 64% runic_power | 2.0/6: 33% rune unholy_strength, potion_of_deadly_grace
1:16.185 frost_strike Fluffy_Pillow 86.0/100: 86% runic_power | 0.0/6: 0% rune unholy_strength, potion_of_deadly_grace
1:17.550 frost_strike Fluffy_Pillow 63.0/100: 63% runic_power | 0.0/6: 0% rune killing_machine, unholy_strength, potion_of_deadly_grace
1:18.915 frost_strike Fluffy_Pillow 38.0/100: 38% runic_power | 0.0/6: 0% rune killing_machine, unholy_strength, potion_of_deadly_grace
1:20.281 obliterate Fluffy_Pillow 15.0/100: 15% runic_power | 2.0/6: 33% rune killing_machine, unholy_strength, potion_of_deadly_grace
1:21.646 frost_strike Fluffy_Pillow 38.0/100: 38% runic_power | 1.0/6: 17% rune unholy_strength, potion_of_deadly_grace
1:23.013 Waiting 5.900 sec 15.0/100: 15% runic_power | 1.0/6: 17% rune unholy_strength
1:28.913 obliterate Fluffy_Pillow 21.0/100: 21% runic_power | 3.0/6: 50% rune unholy_strength
1:30.279 obliteration Fluffy_Pillow 43.0/100: 43% runic_power | 2.0/6: 33% rune unholy_strength
1:30.279 frost_strike Fluffy_Pillow 43.0/100: 43% runic_power | 2.0/6: 33% rune obliteration, unholy_strength
1:31.646 obliterate Fluffy_Pillow 18.0/100: 18% runic_power | 2.0/6: 33% rune killing_machine, obliteration, unholy_strength
1:33.011 frost_strike Fluffy_Pillow 40.0/100: 40% runic_power | 2.0/6: 33% rune obliteration, unholy_strength
1:34.376 obliterate Fluffy_Pillow 17.0/100: 17% runic_power | 2.0/6: 33% rune killing_machine, obliteration, unholy_strength
1:35.741 pillar_of_frost Fluffy_Pillow 37.0/100: 37% runic_power | 2.0/6: 33% rune obliteration, unholy_strength
1:35.741 frost_strike Fluffy_Pillow 37.0/100: 37% runic_power | 2.0/6: 33% rune obliteration, pillar_of_frost, unholy_strength
1:37.106 obliterate Fluffy_Pillow 14.0/100: 14% runic_power | 2.0/6: 33% rune killing_machine, obliteration, pillar_of_frost, unholy_strength
1:38.471 obliterate Fluffy_Pillow 34.0/100: 34% runic_power | 4.0/6: 67% rune pillar_of_frost, unholy_strength
1:39.836 obliterate Fluffy_Pillow 56.0/100: 56% runic_power | 3.0/6: 50% rune pillar_of_frost, unholy_strength
1:41.201 howling_blast Fluffy_Pillow 78.0/100: 78% runic_power | 1.0/6: 17% rune pillar_of_frost, rime, unholy_strength
1:42.567 frost_strike Fluffy_Pillow 78.0/100: 78% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength
1:43.933 frost_strike Fluffy_Pillow 55.0/100: 55% runic_power | 1.0/6: 17% rune killing_machine, pillar_of_frost, unholy_strength
1:45.300 obliterate Fluffy_Pillow 32.0/100: 32% runic_power | 2.0/6: 33% rune killing_machine, pillar_of_frost, unholy_strength
1:46.665 howling_blast Fluffy_Pillow 55.0/100: 55% runic_power | 1.0/6: 17% rune pillar_of_frost, rime, unholy_strength
1:48.030 obliterate Fluffy_Pillow 57.0/100: 57% runic_power | 3.0/6: 50% rune pillar_of_frost, unholy_strength
1:49.396 obliterate Fluffy_Pillow 79.0/100: 79% runic_power | 2.0/6: 33% rune pillar_of_frost, unholy_strength
1:50.761 frost_strike Fluffy_Pillow 99.0/100: 99% runic_power | 0.0/6: 0% rune pillar_of_frost, unholy_strength
1:52.126 frost_strike Fluffy_Pillow 81.0/100: 81% runic_power | 0.0/6: 0% rune pillar_of_frost, unholy_strength
1:53.492 frost_strike Fluffy_Pillow 58.0/100: 58% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength
1:54.857 obliterate Fluffy_Pillow 38.0/100: 38% runic_power | 2.0/6: 33% rune pillar_of_frost
1:56.222 frost_strike Fluffy_Pillow 60.0/100: 60% runic_power | 1.0/6: 17% rune
1:57.587 obliterate Fluffy_Pillow 37.0/100: 37% runic_power | 3.0/6: 50% rune
1:58.953 frost_strike Fluffy_Pillow 57.0/100: 57% runic_power | 1.0/6: 17% rune
2:00.318 use_item_faulty_countermeasure Fluffy_Pillow 34.0/100: 34% runic_power | 2.0/6: 33% rune
2:00.318 obliterate Fluffy_Pillow 34.0/100: 34% runic_power | 2.0/6: 33% rune
2:01.686 howling_blast Fluffy_Pillow 54.0/100: 54% runic_power | 0.0/6: 0% rune rime, sheathed_in_frost
2:03.052 frost_strike Fluffy_Pillow 56.0/100: 56% runic_power | 0.0/6: 0% rune killing_machine, sheathed_in_frost
2:04.417 frost_strike Fluffy_Pillow 33.0/100: 33% runic_power | 0.0/6: 0% rune killing_machine, sheathed_in_frost
2:05.780 obliterate Fluffy_Pillow 8.0/100: 8% runic_power | 2.0/6: 33% rune killing_machine, sheathed_in_frost
2:07.145 howling_blast Fluffy_Pillow 30.0/100: 30% runic_power | 1.0/6: 17% rune rime, sheathed_in_frost
2:08.511 frost_strike Fluffy_Pillow 32.0/100: 32% runic_power | 1.0/6: 17% rune sheathed_in_frost
2:09.875 Waiting 4.400 sec 7.0/100: 7% runic_power | 1.0/6: 17% rune sheathed_in_frost
2:14.275 obliterate Fluffy_Pillow 16.0/100: 16% runic_power | 2.0/6: 33% rune killing_machine, sheathed_in_frost
2:15.640 howling_blast Fluffy_Pillow 43.0/100: 43% runic_power | 2.0/6: 33% rune rime, unholy_strength, sheathed_in_frost
2:17.007 obliterate Fluffy_Pillow 45.0/100: 45% runic_power | 2.0/6: 33% rune unholy_strength, sheathed_in_frost
2:18.372 frost_strike Fluffy_Pillow 65.0/100: 65% runic_power | 0.0/6: 0% rune unholy_strength, sheathed_in_frost
2:19.737 frost_strike Fluffy_Pillow 42.0/100: 42% runic_power | 1.0/6: 17% rune unholy_strength, sheathed_in_frost
2:21.090 Waiting 2.200 sec 19.0/100: 19% runic_power | 1.0/6: 17% rune unholy_strength, sheathed_in_frost, down_draft(2)
2:23.290 obliterate Fluffy_Pillow 21.0/100: 21% runic_power | 2.0/6: 33% rune unholy_strength, sheathed_in_frost, down_draft(4)
2:24.603 obliterate Fluffy_Pillow 41.0/100: 41% runic_power | 2.0/6: 33% rune unholy_strength, sheathed_in_frost, down_draft(5)
2:25.903 frost_strike Fluffy_Pillow 63.0/100: 63% runic_power | 0.0/6: 0% rune killing_machine, unholy_strength, sheathed_in_frost, down_draft(7)
2:27.189 frost_strike Fluffy_Pillow 45.0/100: 45% runic_power | 0.0/6: 0% rune killing_machine, unholy_strength, sheathed_in_frost, down_draft(8)
2:28.463 pillar_of_frost Fluffy_Pillow 20.0/100: 20% runic_power | 0.0/6: 0% rune killing_machine, unholy_strength, sheathed_in_frost, down_draft(9)
2:28.463 Waiting 3.800 sec 20.0/100: 20% runic_power | 0.0/6: 0% rune killing_machine, pillar_of_frost, unholy_strength, sheathed_in_frost, down_draft(9)
2:32.263 obliterate Fluffy_Pillow 24.0/100: 24% runic_power | 2.0/6: 33% rune killing_machine, pillar_of_frost, unholy_strength, down_draft(13)
2:33.488 howling_blast Fluffy_Pillow 46.0/100: 46% runic_power | 1.0/6: 17% rune pillar_of_frost, rime, down_draft(14)
2:34.702 frost_strike Fluffy_Pillow 48.0/100: 48% runic_power | 1.0/6: 17% rune pillar_of_frost, down_draft(15)
2:35.903 Waiting 0.100 sec 23.0/100: 23% runic_power | 1.0/6: 17% rune pillar_of_frost, down_draft(17)
2:36.003 frost_strike Fluffy_Pillow 28.0/100: 28% runic_power | 1.0/6: 17% rune pillar_of_frost, down_draft(17)
2:37.195 Waiting 2.500 sec 5.0/100: 5% runic_power | 1.0/6: 17% rune pillar_of_frost, down_draft(18)
2:39.695 obliterate Fluffy_Pillow 7.0/100: 7% runic_power | 2.0/6: 33% rune pillar_of_frost, down_draft(20)
2:41.054 obliterate Fluffy_Pillow 29.0/100: 29% runic_power | 2.0/6: 33% rune pillar_of_frost
2:42.418 frost_strike Fluffy_Pillow 51.0/100: 51% runic_power | 0.0/6: 0% rune pillar_of_frost
2:43.785 frost_strike Fluffy_Pillow 26.0/100: 26% runic_power | 0.0/6: 0% rune pillar_of_frost
2:45.151 Waiting 4.200 sec 3.0/100: 3% runic_power | 0.0/6: 0% rune killing_machine, pillar_of_frost
2:49.351 obliterate Fluffy_Pillow 12.0/100: 12% runic_power | 2.0/6: 33% rune killing_machine, unholy_strength
2:50.717 frost_strike Fluffy_Pillow 34.0/100: 34% runic_power | 1.0/6: 17% rune unholy_strength
2:52.081 obliterate Fluffy_Pillow 14.0/100: 14% runic_power | 2.0/6: 33% rune unholy_strength
2:53.447 frost_strike Fluffy_Pillow 36.0/100: 36% runic_power | 0.0/6: 0% rune unholy_strength
2:54.810 Waiting 3.600 sec 13.0/100: 13% runic_power | 0.0/6: 0% rune unholy_strength
2:58.410 obliterate Fluffy_Pillow 15.0/100: 15% runic_power | 2.0/6: 33% rune unholy_strength
2:59.775 howling_blast Fluffy_Pillow 37.0/100: 37% runic_power | 1.0/6: 17% rune killing_machine, rime, unholy_strength
3:01.140 obliteration Fluffy_Pillow 39.0/100: 39% runic_power | 1.0/6: 17% rune killing_machine, unholy_strength
3:01.140 obliterate Fluffy_Pillow 39.0/100: 39% runic_power | 1.0/6: 17% rune killing_machine, obliteration, unholy_strength
3:02.505 frost_strike Fluffy_Pillow 59.0/100: 59% runic_power | 1.0/6: 17% rune obliteration, unholy_strength
3:03.872 obliterate Fluffy_Pillow 36.0/100: 36% runic_power | 1.0/6: 17% rune killing_machine, obliteration, unholy_strength
3:05.238 howling_blast Fluffy_Pillow 58.0/100: 58% runic_power | 0.0/6: 0% rune obliteration, rime, unholy_strength
3:06.602 frost_strike Fluffy_Pillow 58.0/100: 58% runic_power | 0.0/6: 0% rune obliteration, unholy_strength
3:07.968 obliterate Fluffy_Pillow 35.0/100: 35% runic_power | 3.0/6: 50% rune killing_machine, obliteration, unholy_strength
3:09.333 howling_blast Fluffy_Pillow 60.0/100: 60% runic_power | 4.0/6: 67% rune rime, unholy_strength
3:10.700 obliterate Fluffy_Pillow 62.0/100: 62% runic_power | 4.0/6: 67% rune unholy_strength
3:12.064 howling_blast Fluffy_Pillow 89.0/100: 89% runic_power | 2.0/6: 33% rune rime, unholy_strength
3:13.430 frost_strike Fluffy_Pillow 89.0/100: 89% runic_power | 2.0/6: 33% rune unholy_strength
3:14.795 obliterate Fluffy_Pillow 66.0/100: 66% runic_power | 2.0/6: 33% rune unholy_strength
3:16.161 howling_blast Fluffy_Pillow 93.0/100: 93% runic_power | 1.0/6: 17% rune rime, unholy_strength
3:17.526 frost_strike Fluffy_Pillow 93.0/100: 93% runic_power | 2.0/6: 33% rune unholy_strength
3:18.892 obliterate Fluffy_Pillow 70.0/100: 70% runic_power | 3.0/6: 50% rune unholy_strength
3:20.259 pillar_of_frost Fluffy_Pillow 92.0/100: 92% runic_power | 2.0/6: 33% rune unholy_strength
3:20.463 frost_strike Fluffy_Pillow 92.0/100: 92% runic_power | 2.0/6: 33% rune pillar_of_frost, unholy_strength
3:21.828 obliterate Fluffy_Pillow 67.0/100: 67% runic_power | 2.0/6: 33% rune pillar_of_frost, unholy_strength
3:23.195 howling_blast Fluffy_Pillow 92.0/100: 92% runic_power | 0.0/6: 0% rune killing_machine, pillar_of_frost, rime, unholy_strength
3:24.562 frost_strike Fluffy_Pillow 94.0/100: 94% runic_power | 0.0/6: 0% rune killing_machine, pillar_of_frost
3:25.929 obliterate Fluffy_Pillow 69.0/100: 69% runic_power | 3.0/6: 50% rune killing_machine, pillar_of_frost
3:27.295 frost_strike Fluffy_Pillow 96.0/100: 96% runic_power | 1.0/6: 17% rune pillar_of_frost
3:28.661 frost_strike Fluffy_Pillow 73.0/100: 73% runic_power | 1.0/6: 17% rune pillar_of_frost
3:30.028 obliterate Fluffy_Pillow 53.0/100: 53% runic_power | 2.0/6: 33% rune pillar_of_frost
3:31.392 howling_blast Fluffy_Pillow 75.0/100: 75% runic_power | 0.0/6: 0% rune pillar_of_frost, rime
3:32.756 frost_strike Fluffy_Pillow 77.0/100: 77% runic_power | 0.0/6: 0% rune pillar_of_frost
3:34.123 frost_strike Fluffy_Pillow 52.0/100: 52% runic_power | 1.0/6: 17% rune pillar_of_frost
3:35.490 obliterate Fluffy_Pillow 29.0/100: 29% runic_power | 2.0/6: 33% rune pillar_of_frost, unholy_strength
3:36.856 frost_strike Fluffy_Pillow 51.0/100: 51% runic_power | 0.0/6: 0% rune killing_machine, pillar_of_frost, unholy_strength
3:38.222 frost_strike Fluffy_Pillow 26.0/100: 26% runic_power | 1.0/6: 17% rune killing_machine, pillar_of_frost, unholy_strength
3:39.588 empower_rune_weapon Fluffy_Pillow 3.0/100: 3% runic_power | 1.0/6: 17% rune killing_machine, pillar_of_frost, unholy_strength
3:39.588 obliterate Fluffy_Pillow 3.0/100: 3% runic_power | 6.0/6: 100% rune killing_machine, pillar_of_frost, unholy_strength
3:40.953 howling_blast Fluffy_Pillow 23.0/100: 23% runic_power | 4.0/6: 67% rune rime, unholy_strength
3:42.320 obliterate Fluffy_Pillow 25.0/100: 25% runic_power | 4.0/6: 67% rune unholy_strength
3:43.685 obliterate Fluffy_Pillow 47.0/100: 47% runic_power | 2.0/6: 33% rune killing_machine, unholy_strength
3:45.052 frost_strike Fluffy_Pillow 67.0/100: 67% runic_power | 0.0/6: 0% rune unholy_strength
3:46.419 frost_strike Fluffy_Pillow 44.0/100: 44% runic_power | 0.0/6: 0% rune unholy_strength
3:47.786 Waiting 0.900 sec 21.0/100: 21% runic_power | 0.0/6: 0% rune unholy_strength
3:48.686 obliterate Fluffy_Pillow 21.0/100: 21% runic_power | 2.0/6: 33% rune unholy_strength
3:50.051 frost_strike Fluffy_Pillow 43.0/100: 43% runic_power | 0.0/6: 0% rune
3:51.417 Waiting 6.400 sec 18.0/100: 18% runic_power | 1.0/6: 17% rune
3:57.817 obliterate Fluffy_Pillow 24.0/100: 24% runic_power | 3.0/6: 50% rune
3:59.184 frost_strike Fluffy_Pillow 46.0/100: 46% runic_power | 1.0/6: 17% rune
4:00.550 use_item_faulty_countermeasure Fluffy_Pillow 28.0/100: 28% runic_power | 2.0/6: 33% rune
4:00.550 obliterate Fluffy_Pillow 28.0/100: 28% runic_power | 2.0/6: 33% rune
4:01.917 frost_strike Fluffy_Pillow 51.0/100: 51% runic_power | 0.0/6: 0% rune sheathed_in_frost
4:03.282 frost_strike Fluffy_Pillow 28.0/100: 28% runic_power | 1.0/6: 17% rune killing_machine, sheathed_in_frost
4:04.649 Waiting 2.200 sec 5.0/100: 5% runic_power | 1.0/6: 17% rune killing_machine, sheathed_in_frost
4:06.849 obliterate Fluffy_Pillow 7.0/100: 7% runic_power | 3.0/6: 50% rune killing_machine, sheathed_in_frost
4:08.214 pillar_of_frost Fluffy_Pillow 27.0/100: 27% runic_power | 2.0/6: 33% rune rime, sheathed_in_frost
4:08.214 howling_blast Fluffy_Pillow 27.0/100: 27% runic_power | 2.0/6: 33% rune pillar_of_frost, rime, sheathed_in_frost
4:09.578 obliterate Fluffy_Pillow 29.0/100: 29% runic_power | 3.0/6: 50% rune pillar_of_frost, unholy_strength, sheathed_in_frost
4:10.945 frost_strike Fluffy_Pillow 51.0/100: 51% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength, sheathed_in_frost
4:12.309 obliterate Fluffy_Pillow 26.0/100: 26% runic_power | 2.0/6: 33% rune pillar_of_frost, unholy_strength, sheathed_in_frost
4:13.674 howling_blast Fluffy_Pillow 48.0/100: 48% runic_power | 0.0/6: 0% rune pillar_of_frost, rime, unholy_strength, sheathed_in_frost
4:15.041 frost_strike Fluffy_Pillow 55.0/100: 55% runic_power | 0.0/6: 0% rune pillar_of_frost, unholy_strength, sheathed_in_frost
4:16.408 obliterate Fluffy_Pillow 30.0/100: 30% runic_power | 3.0/6: 50% rune pillar_of_frost, unholy_strength, sheathed_in_frost
4:17.773 frost_strike Fluffy_Pillow 55.0/100: 55% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength, sheathed_in_frost
4:19.140 obliterate Fluffy_Pillow 32.0/100: 32% runic_power | 2.0/6: 33% rune pillar_of_frost, unholy_strength, sheathed_in_frost
4:20.505 frost_strike Fluffy_Pillow 52.0/100: 52% runic_power | 0.0/6: 0% rune pillar_of_frost, unholy_strength, sheathed_in_frost
4:21.869 frost_strike Fluffy_Pillow 29.0/100: 29% runic_power | 0.0/6: 0% rune killing_machine, pillar_of_frost, unholy_strength, sheathed_in_frost
4:23.236 Waiting 1.800 sec 6.0/100: 6% runic_power | 0.0/6: 0% rune killing_machine, pillar_of_frost, sheathed_in_frost
4:25.036 obliterate Fluffy_Pillow 6.0/100: 6% runic_power | 2.0/6: 33% rune killing_machine, pillar_of_frost, sheathed_in_frost
4:26.401 howling_blast Fluffy_Pillow 28.0/100: 28% runic_power | 1.0/6: 17% rune pillar_of_frost, rime, sheathed_in_frost
4:27.767 obliterate Fluffy_Pillow 30.0/100: 30% runic_power | 2.0/6: 33% rune pillar_of_frost, sheathed_in_frost
4:29.133 frost_strike Fluffy_Pillow 50.0/100: 50% runic_power | 0.0/6: 0% rune sheathed_in_frost
4:30.497 frost_strike Fluffy_Pillow 27.0/100: 27% runic_power | 0.0/6: 0% rune unholy_strength, sheathed_in_frost
4:31.863 obliteration Fluffy_Pillow 4.0/100: 4% runic_power | 0.0/6: 0% rune unholy_strength
4:31.863 Waiting 2.200 sec 4.0/100: 4% runic_power | 0.0/6: 0% rune obliteration, unholy_strength
4:34.063 obliterate Fluffy_Pillow 6.0/100: 6% runic_power | 2.0/6: 33% rune obliteration, unholy_strength
4:35.429 frost_strike Fluffy_Pillow 26.0/100: 26% runic_power | 1.0/6: 17% rune obliteration, unholy_strength
4:36.795 obliterate Fluffy_Pillow 3.0/100: 3% runic_power | 3.0/6: 50% rune killing_machine, obliteration, unholy_strength
4:38.161 frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 3.0/6: 50% rune killing_machine, obliteration, unholy_strength
4:39.526 obliterate Fluffy_Pillow 0.0/100: 0% runic_power | 4.0/6: 67% rune killing_machine, obliteration, unholy_strength
4:40.892 obliterate Fluffy_Pillow 25.0/100: 25% runic_power | 3.0/6: 50% rune unholy_strength
4:42.257 howling_blast Fluffy_Pillow 47.0/100: 47% runic_power | 1.0/6: 17% rune rime, unholy_strength
4:43.621 obliterate Fluffy_Pillow 47.0/100: 47% runic_power | 2.0/6: 33% rune unholy_strength
4:44.985 frost_strike Fluffy_Pillow 69.0/100: 69% runic_power | 0.0/6: 0% rune unholy_strength
4:46.349 obliterate Fluffy_Pillow 49.0/100: 49% runic_power | 2.0/6: 33% rune unholy_strength
4:47.715 frost_strike Fluffy_Pillow 71.0/100: 71% runic_power | 0.0/6: 0% rune killing_machine, unholy_strength
4:49.080 frost_strike Fluffy_Pillow 48.0/100: 48% runic_power | 1.0/6: 17% rune killing_machine, unholy_strength
4:50.431 Waiting 0.200 sec 23.0/100: 23% runic_power | 1.0/6: 17% rune killing_machine, unholy_strength, down_draft(2)
4:50.631 frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 1.0/6: 17% rune killing_machine, unholy_strength, down_draft(2)
4:51.967 Waiting 0.200 sec 5.0/100: 5% runic_power | 1.0/6: 17% rune killing_machine, down_draft(3)
4:52.167 obliterate Fluffy_Pillow 5.0/100: 5% runic_power | 2.0/6: 33% rune killing_machine, down_draft(4)
4:53.485 frost_strike Fluffy_Pillow 27.0/100: 27% runic_power | 0.0/6: 0% rune down_draft(5)
4:54.789 Waiting 2.600 sec 4.0/100: 4% runic_power | 1.0/6: 17% rune unholy_strength, down_draft(6)
4:57.389 obliterate Fluffy_Pillow 6.0/100: 6% runic_power | 2.0/6: 33% rune unholy_strength, down_draft(9)
4:58.653 pillar_of_frost Fluffy_Pillow 31.0/100: 31% runic_power | 0.0/6: 0% rune unholy_strength, down_draft(10)
4:58.653 frost_strike Fluffy_Pillow 31.0/100: 31% runic_power | 0.0/6: 0% rune pillar_of_frost, unholy_strength, down_draft(10)
4:59.908 Waiting 3.300 sec 6.0/100: 6% runic_power | 0.0/6: 0% rune pillar_of_frost, unholy_strength, down_draft(11)
5:03.208 obliterate Fluffy_Pillow 15.0/100: 15% runic_power | 2.0/6: 33% rune pillar_of_frost, unholy_strength, down_draft(15)
5:04.419 frost_strike Fluffy_Pillow 40.0/100: 40% runic_power | 0.0/6: 0% rune pillar_of_frost, unholy_strength, down_draft(16)
5:05.617 Waiting 3.100 sec 15.0/100: 15% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength, down_draft(17)
5:08.717 obliterate Fluffy_Pillow 19.0/100: 19% runic_power | 2.0/6: 33% rune killing_machine, pillar_of_frost, unholy_strength, down_draft(20)
5:10.022 howling_blast Fluffy_Pillow 41.0/100: 41% runic_power | 1.0/6: 17% rune pillar_of_frost, rime
5:11.388 obliterate Fluffy_Pillow 41.0/100: 41% runic_power | 2.0/6: 33% rune pillar_of_frost
5:12.754 howling_blast Fluffy_Pillow 63.0/100: 63% runic_power | 0.0/6: 0% rune pillar_of_frost, rime
5:14.119 frost_strike Fluffy_Pillow 65.0/100: 65% runic_power | 1.0/6: 17% rune pillar_of_frost
5:15.485 frost_strike Fluffy_Pillow 40.0/100: 40% runic_power | 1.0/6: 17% rune pillar_of_frost
5:16.835 obliterate Fluffy_Pillow 17.0/100: 17% runic_power | 2.0/6: 33% rune pillar_of_frost, down_draft(2)
5:18.170 frost_strike Fluffy_Pillow 37.0/100: 37% runic_power | 1.0/6: 17% rune pillar_of_frost, down_draft(3)
5:19.492 obliterate Fluffy_Pillow 14.0/100: 14% runic_power | 2.0/6: 33% rune down_draft(5)
5:20.800 howling_blast Fluffy_Pillow 36.0/100: 36% runic_power | 1.0/6: 17% rune rime, down_draft(6)
5:22.095 frost_strike Fluffy_Pillow 36.0/100: 36% runic_power | 1.0/6: 17% rune down_draft(7)
5:23.376 obliterate Fluffy_Pillow 13.0/100: 13% runic_power | 2.0/6: 33% rune down_draft(8)
5:24.643 frost_strike Fluffy_Pillow 40.0/100: 40% runic_power | 0.0/6: 0% rune killing_machine, down_draft(10)
5:25.900 Waiting 0.300 sec 15.0/100: 15% runic_power | 1.0/6: 17% rune killing_machine, down_draft(11)
5:26.200 obliterate Fluffy_Pillow 17.0/100: 17% runic_power | 2.0/6: 33% rune killing_machine, unholy_strength, down_draft(11)
5:27.443 frost_strike Fluffy_Pillow 37.0/100: 37% runic_power | 1.0/6: 17% rune unholy_strength, down_draft(12)
5:28.672 obliterate Fluffy_Pillow 14.0/100: 14% runic_power | 3.0/6: 50% rune unholy_strength, down_draft(14)
5:29.889 howling_blast Fluffy_Pillow 34.0/100: 34% runic_power | 1.0/6: 17% rune rime, unholy_strength, down_draft(15)
5:31.095 frost_strike Fluffy_Pillow 36.0/100: 36% runic_power | 1.0/6: 17% rune unholy_strength, down_draft(16)
5:32.293 obliterate Fluffy_Pillow 13.0/100: 13% runic_power | 3.0/6: 50% rune unholy_strength, down_draft(17)
5:33.479 howling_blast Fluffy_Pillow 38.0/100: 38% runic_power | 1.0/6: 17% rune rime, unholy_strength, down_draft(18)
5:34.653 obliterate Fluffy_Pillow 40.0/100: 40% runic_power | 2.0/6: 33% rune killing_machine, unholy_strength, down_draft(20)
5:35.878 howling_blast Fluffy_Pillow 62.0/100: 62% runic_power | 1.0/6: 17% rune rime, unholy_strength
5:37.244 obliterate Fluffy_Pillow 62.0/100: 62% runic_power | 2.0/6: 33% rune unholy_strength
5:38.609 frost_strike Fluffy_Pillow 84.0/100: 84% runic_power | 0.0/6: 0% rune unholy_strength
5:39.974 obliterate Fluffy_Pillow 66.0/100: 66% runic_power | 2.0/6: 33% rune unholy_strength
5:41.339 frost_strike Fluffy_Pillow 86.0/100: 86% runic_power | 0.0/6: 0% rune
5:42.705 frost_strike Fluffy_Pillow 68.0/100: 68% runic_power | 0.0/6: 0% rune killing_machine
5:44.070 frost_strike Fluffy_Pillow 45.0/100: 45% runic_power | 1.0/6: 17% rune killing_machine
5:45.436 Waiting 0.400 sec 20.0/100: 20% runic_power | 1.0/6: 17% rune killing_machine
5:45.836 obliterate Fluffy_Pillow 20.0/100: 20% runic_power | 2.0/6: 33% rune killing_machine
5:47.201 frost_strike Fluffy_Pillow 42.0/100: 42% runic_power | 1.0/6: 17% rune
5:48.565 pillar_of_frost Fluffy_Pillow 19.0/100: 19% runic_power | 1.0/6: 17% rune
5:48.565 Waiting 0.100 sec 19.0/100: 19% runic_power | 1.0/6: 17% rune pillar_of_frost
5:48.665 obliterate Fluffy_Pillow 19.0/100: 19% runic_power | 2.0/6: 33% rune pillar_of_frost
5:50.031 howling_blast Fluffy_Pillow 39.0/100: 39% runic_power | 0.0/6: 0% rune pillar_of_frost, rime
5:51.396 frost_strike Fluffy_Pillow 41.0/100: 41% runic_power | 0.0/6: 0% rune pillar_of_frost
5:52.761 Waiting 2.200 sec 18.0/100: 18% runic_power | 1.0/6: 17% rune pillar_of_frost
5:54.961 obliterate Fluffy_Pillow 20.0/100: 20% runic_power | 2.0/6: 33% rune pillar_of_frost
5:56.324 howling_blast Fluffy_Pillow 40.0/100: 40% runic_power | 0.0/6: 0% rune pillar_of_frost, rime
5:57.690 frost_strike Fluffy_Pillow 42.0/100: 42% runic_power | 1.0/6: 17% rune pillar_of_frost
5:59.056 Waiting 1.300 sec 19.0/100: 19% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength
6:00.356 use_item_faulty_countermeasure Fluffy_Pillow 19.0/100: 19% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength
6:00.550 Waiting 0.700 sec 19.0/100: 19% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength
6:01.250 obliterate Fluffy_Pillow 21.0/100: 21% runic_power | 2.0/6: 33% rune pillar_of_frost, unholy_strength, sheathed_in_frost
6:02.616 obliteration Fluffy_Pillow 41.0/100: 41% runic_power | 0.0/6: 0% rune pillar_of_frost, unholy_strength, sheathed_in_frost
6:02.616 frost_strike Fluffy_Pillow 41.0/100: 41% runic_power | 0.0/6: 0% rune obliteration, pillar_of_frost, unholy_strength, sheathed_in_frost
6:03.982 obliterate Fluffy_Pillow 18.0/100: 18% runic_power | 1.0/6: 17% rune killing_machine, obliteration, pillar_of_frost, unholy_strength, sheathed_in_frost
6:05.348 howling_blast Fluffy_Pillow 40.0/100: 40% runic_power | 1.0/6: 17% rune obliteration, pillar_of_frost, rime, unholy_strength, sheathed_in_frost
6:06.713 frost_strike Fluffy_Pillow 40.0/100: 40% runic_power | 1.0/6: 17% rune obliteration, pillar_of_frost, unholy_strength, sheathed_in_frost
6:08.079 obliterate Fluffy_Pillow 17.0/100: 17% runic_power | 3.0/6: 50% rune killing_machine, obliteration, pillar_of_frost, unholy_strength, sheathed_in_frost
6:09.446 frost_strike Fluffy_Pillow 39.0/100: 39% runic_power | 2.0/6: 33% rune obliteration, unholy_strength, sheathed_in_frost
6:10.813 obliterate Fluffy_Pillow 14.0/100: 14% runic_power | 3.0/6: 50% rune killing_machine, unholy_strength, sheathed_in_frost
6:12.178 frost_strike Fluffy_Pillow 36.0/100: 36% runic_power | 1.0/6: 17% rune unholy_strength, sheathed_in_frost
6:13.544 obliterate Fluffy_Pillow 13.0/100: 13% runic_power | 2.0/6: 33% rune unholy_strength, sheathed_in_frost
6:14.910 frost_strike Fluffy_Pillow 33.0/100: 33% runic_power | 0.0/6: 0% rune unholy_strength, sheathed_in_frost
6:16.276 obliterate Fluffy_Pillow 10.0/100: 10% runic_power | 2.0/6: 33% rune unholy_strength, sheathed_in_frost
6:17.642 howling_blast Fluffy_Pillow 32.0/100: 32% runic_power | 0.0/6: 0% rune rime, unholy_strength, sheathed_in_frost
6:19.009 frost_strike Fluffy_Pillow 32.0/100: 32% runic_power | 0.0/6: 0% rune unholy_strength, sheathed_in_frost
6:20.375 Waiting 1.800 sec 9.0/100: 9% runic_power | 1.0/6: 17% rune unholy_strength, sheathed_in_frost
6:22.175 obliterate Fluffy_Pillow 11.0/100: 11% runic_power | 2.0/6: 33% rune sheathed_in_frost
6:23.541 frost_strike Fluffy_Pillow 31.0/100: 31% runic_power | 0.0/6: 0% rune sheathed_in_frost
6:24.908 Waiting 3.600 sec 8.0/100: 8% runic_power | 1.0/6: 17% rune sheathed_in_frost
6:28.508 obliterate Fluffy_Pillow 12.0/100: 12% runic_power | 2.0/6: 33% rune killing_machine, sheathed_in_frost
6:29.872 frost_strike Fluffy_Pillow 32.0/100: 32% runic_power | 0.0/6: 0% rune sheathed_in_frost
6:31.235 Waiting 2.800 sec 9.0/100: 9% runic_power | 1.0/6: 17% rune unholy_strength
6:34.035 obliterate Fluffy_Pillow 16.0/100: 16% runic_power | 2.0/6: 33% rune unholy_strength
6:35.400 howling_blast Fluffy_Pillow 41.0/100: 41% runic_power | 0.0/6: 0% rune rime, unholy_strength
6:36.765 frost_strike Fluffy_Pillow 43.0/100: 43% runic_power | 0.0/6: 0% rune unholy_strength
6:38.131 Waiting 1.300 sec 18.0/100: 18% runic_power | 1.0/6: 17% rune unholy_strength
6:39.431 empower_rune_weapon Fluffy_Pillow 20.0/100: 20% runic_power | 1.0/6: 17% rune unholy_strength
6:39.588 obliterate Fluffy_Pillow 20.0/100: 20% runic_power | 6.0/6: 100% rune unholy_strength
6:40.954 pillar_of_frost Fluffy_Pillow 42.0/100: 42% runic_power | 4.0/6: 67% rune unholy_strength
6:40.954 obliterate Fluffy_Pillow 42.0/100: 42% runic_power | 4.0/6: 67% rune pillar_of_frost, unholy_strength
6:42.319 obliterate Fluffy_Pillow 62.0/100: 62% runic_power | 2.0/6: 33% rune pillar_of_frost, unholy_strength
6:43.686 frost_strike Fluffy_Pillow 84.0/100: 84% runic_power | 0.0/6: 0% rune killing_machine, pillar_of_frost, unholy_strength
6:45.051 frost_strike Fluffy_Pillow 61.0/100: 61% runic_power | 0.0/6: 0% rune killing_machine, pillar_of_frost
6:46.415 frost_strike Fluffy_Pillow 36.0/100: 36% runic_power | 0.0/6: 0% rune killing_machine, pillar_of_frost
6:47.779 Waiting 0.900 sec 13.0/100: 13% runic_power | 1.0/6: 17% rune killing_machine, pillar_of_frost
6:48.679 obliterate Fluffy_Pillow 13.0/100: 13% runic_power | 3.0/6: 50% rune killing_machine, pillar_of_frost
6:50.045 howling_blast Fluffy_Pillow 35.0/100: 35% runic_power | 3.0/6: 50% rune pillar_of_frost, rime
6:51.410 obliterate Fluffy_Pillow 37.0/100: 37% runic_power | 3.0/6: 50% rune pillar_of_frost, unholy_strength
6:52.777 frost_strike Fluffy_Pillow 57.0/100: 57% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength
6:54.144 frost_strike Fluffy_Pillow 39.0/100: 39% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength
6:55.508 obliterate Fluffy_Pillow 16.0/100: 16% runic_power | 2.0/6: 33% rune pillar_of_frost, unholy_strength
6:56.873 frost_strike Fluffy_Pillow 36.0/100: 36% runic_power | 0.0/6: 0% rune pillar_of_frost, unholy_strength
6:58.238 obliterate Fluffy_Pillow 13.0/100: 13% runic_power | 2.0/6: 33% rune pillar_of_frost, unholy_strength
6:59.604 frost_strike Fluffy_Pillow 33.0/100: 33% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength
7:00.969 Waiting 5.900 sec 10.0/100: 10% runic_power | 1.0/6: 17% rune unholy_strength
7:06.869 obliterate Fluffy_Pillow 21.0/100: 21% runic_power | 3.0/6: 50% rune killing_machine, unholy_strength
7:08.233 obliterate Fluffy_Pillow 43.0/100: 43% runic_power | 2.0/6: 33% rune unholy_strength
7:09.599 frost_strike Fluffy_Pillow 71.0/100: 71% runic_power | 0.0/6: 0% rune unholy_strength
7:10.964 frost_strike Fluffy_Pillow 48.0/100: 48% runic_power | 0.0/6: 0% rune unholy_strength
7:12.330 frost_strike Fluffy_Pillow 28.0/100: 28% runic_power | 0.0/6: 0% rune unholy_strength
7:13.697 Waiting 2.200 sec 5.0/100: 5% runic_power | 0.0/6: 0% rune unholy_strength
7:15.897 obliterate Fluffy_Pillow 12.0/100: 12% runic_power | 2.0/6: 33% rune unholy_strength
7:17.265 howling_blast Fluffy_Pillow 34.0/100: 34% runic_power | 1.0/6: 17% rune rime, unholy_strength
7:18.631 frost_strike Fluffy_Pillow 34.0/100: 34% runic_power | 1.0/6: 17% rune unholy_strength
7:19.995 Waiting 5.000 sec 11.0/100: 11% runic_power | 1.0/6: 17% rune unholy_strength
7:24.995 obliterate Fluffy_Pillow 15.0/100: 15% runic_power | 3.0/6: 50% rune killing_machine
7:26.359 obliterate Fluffy_Pillow 40.0/100: 40% runic_power | 2.0/6: 33% rune killing_machine

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 22492 20786 9565 (6707)
Agility 7857 7532 0
Stamina 25273 25273 15435
Intellect 4327 4002 0
Spirit 0 0 0
Health 1516380 1516380 0
Runic Power 100 100 0
Rune 6 6 0
Crit 22.81% 21.72% 5851
Haste 10.17% 10.17% 3306
Swing Speed 23.39% 23.39% 3306
Damage / Heal Versatility 2.10% 2.10% 839
Attack Power 22492 20786 0
Mastery 37.55% 37.55% 5959
Armor 4255 4255 3868
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 827.00
Local Head Nightsfall Helmet
ilevel: 825, stats: { 525 Armor, +1028 StrInt, +1542 Sta, +807 Haste, +382 Mastery }, gems: { +100 Crit }
Local Neck Pendant of the Stormforger
ilevel: 805, stats: { +719 Sta, +975 Crit, +576 Haste }
Local Shoulders Tremorguard Pauldrons
ilevel: 845, stats: { 506 Armor, +929 StrInt, +1393 Sta, +584 Mastery, +378 Crit }
Local Chest Deathlord's Chestguard
ilevel: 830, stats: { 653 Armor, +1614 Sta, +1077 Str, +813 Mastery, +398 Crit }
Local Waist Slack Tide Girdle
ilevel: 810, stats: { 351 Armor, +1005 Sta, +670 StrInt, +584 Haste, +259 Crit }
Local Legs Skoldiir Legguards
ilevel: 830, stats: { 571 Armor, +1077 StrInt, +1615 Sta, +839 Crit, +372 Mastery }
Local Feet Rockbound Sabatons
ilevel: 830, stats: { 449 Armor, +807 StrInt, +1211 Sta, +609 Haste, +298 Vers }
Local Wrists Deathlord's Bracers
ilevel: 830, stats: { 286 Armor, +908 Sta, +605 Str, +428 Crit, +252 Mastery }, gems: { +100 Crit }
Local Hands Stormwake Handguards
ilevel: 830, stats: { 408 Armor, +807 StrInt, +1211 Sta, +609 Mastery, +298 Crit }
Local Finger1 Grasping Tentacle Loop
ilevel: 805, stats: { +719 Sta, +886 Mastery, +665 Haste }
Local Finger2 Loop of Eightfold Eyes
ilevel: 825, stats: { +867 Sta, +1147 Mastery, +525 Vers }, gems: { +100 Crit }
Local Trinket1 Nightmare Egg Shell
ilevel: 805, stats: { +811 StrAgi }
Local Trinket2 Faulty Countermeasure
ilevel: 825, stats: { +849 Crit }
Local Back Cloak of Unwavering Loyalty
ilevel: 825, stats: { 119 Armor, +578 StrAgiInt, +867 Sta, +430 Crit, +239 Mastery }
Local Main Hand Blades of the Fallen Prince
ilevel: 856, weapon: { 3484 - 6472, 2.6 }, stats: { +588 Str, +882 Sta, +291 Crit, +279 Mastery }, enchant: rune_of_razorice, relics: { +36 ilevels, +33 ilevels, +37 ilevels }
Local Off Hand Blades of the Fallen Prince
ilevel: 856, weapon: { 3484 - 6472, 2.6 }, stats: { +588 Str, +882 Sta, +291 Crit, +279 Mastery }, enchant: rune_of_the_fallen_crusader

Talents

Level
15 Shattering Strikes (Frost Death Knight) Icy Talons (Frost Death Knight) Murderous Efficiency (Frost Death Knight)
30 Freezing Fog (Frost Death Knight) Frozen Pulse (Frost Death Knight) Horn of Winter (Frost Death Knight)
45 Icecap (Frost Death Knight) Hungering Rune Weapon (Frost Death Knight) Avalanche (Frost Death Knight)
60 Abomination's Might (Frost Death Knight) Blinding Sleet (Frost Death Knight) Winter is Coming (Frost Death Knight)
75 Volatile Shielding (Frost Death Knight) Permafrost (Frost Death Knight) White Walker (Frost Death Knight)
90 Frostscythe (Frost Death Knight) Runic Attenuation (Frost Death Knight) Gathering Storm (Frost Death Knight)
100 Obliteration (Frost Death Knight) Breath of Sindragosa (Frost Death Knight) Glacial Advance (Frost Death Knight)

Profile

deathknight="Ethila"
origin="https://eu.api.battle.net/wow/character/hyjal/Ethila/advanced"
thumbnail="http://eu.battle.net/static-render/eu/hyjal/179/115079091-avatar.jpg"
level=110
race=human
role=attack
position=back
professions=jewelcrafting=728/mining=768
talents=http://eu.battle.net/wow/en/tool/talent-calculator#dZ!2002110
artifact=12:0:0:0:0:108:3:109:1:110:1:113:3:114:2:119:1:120:1:122:1:1090:3:1332:1
spec=frost

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,name=countless_armies
actions.precombat+=/food,name=the_hungry_magister
actions.precombat+=/augmentation,name=defiled
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=deadly_grace

# Executed every time the actor is available.
actions=auto_attack
actions+=/arcane_torrent,if=runic_power.deficit>20
actions+=/blood_fury,if=!talent.breath_of_sindragosa.enabled|dot.breath_of_sindragosa.ticking
actions+=/berserking
actions+=/use_item,slot=trinket2
actions+=/potion,name=deadly_grace
actions+=/pillar_of_frost
actions+=/sindragosas_fury
actions+=/obliteration
actions+=/breath_of_sindragosa,if=runic_power>=50
actions+=/run_action_list,name=bos,if=dot.breath_of_sindragosa.ticking
actions+=/call_action_list,name=generic

actions.bos=howling_blast,target_if=!dot.frost_fever.ticking
actions.bos+=/call_action_list,name=core
actions.bos+=/horn_of_winter
actions.bos+=/empower_rune_weapon,if=runic_power<=70
actions.bos+=/hungering_rune_weapon
actions.bos+=/howling_blast,if=buff.rime.react

actions.generic=howling_blast,target_if=!dot.frost_fever.ticking
actions.generic+=/howling_blast,if=buff.rime.react
actions.generic+=/frost_strike,if=runic_power>=80
actions.generic+=/call_action_list,name=core
actions.generic+=/horn_of_winter,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains>15
actions.generic+=/horn_of_winter,if=!talent.breath_of_sindragosa.enabled
actions.generic+=/frost_strike,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains>15
actions.generic+=/frost_strike,if=!talent.breath_of_sindragosa.enabled
actions.generic+=/empower_rune_weapon,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains>15
actions.generic+=/hungering_rune_weapon,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains>15
actions.generic+=/empower_rune_weapon,if=!talent.breath_of_sindragosa.enabled
actions.generic+=/hungering_rune_weapon,if=!talent.breath_of_sindragosa.enabled

actions.core=glacial_advance
actions.core+=/frost_strike,if=buff.obliteration.up&!buff.killing_machine.react
actions.core+=/remorseless_winter,if=spell_targets.remorseless_winter>=2
actions.core+=/frostscythe,if=!talent.breath_of_sindragosa.enabled&(buff.killing_machine.react|spell_targets.frostscythe>=4)
actions.core+=/obliterate,if=buff.killing_machine.react
actions.core+=/obliterate
actions.core+=/frostscythe,if=talent.frozen_pulse.enabled
actions.core+=/howling_blast,if=talent.frozen_pulse.enabled

head=nightsfall_helmet,id=139058,bonus_id=1726/1808/1487/1675,gems=100crit
neck=pendant_of_the_stormforger,id=133767,bonus_id=1826/1457
shoulders=tremorguard_pauldrons,id=134517,bonus_id=1726/1497/3337
back=cloak_of_unwavering_loyalty,id=134412,bonus_id=1726/1477
chest=deathlords_chestguard,id=139673,bonus_id=3386/3383
wrists=deathlords_bracers,id=139680,bonus_id=3386/3383,gems=100crit
hands=stormwake_handguards,id=134508,bonus_id=1726/1482/3339
waist=slack_tide_girdle,id=133770,bonus_id=1826/1462/3339
legs=skoldiir_legguards,id=134183,bonus_id=1726/1492/3339
feet=rockbound_sabatons,id=134141,bonus_id=1726/1492/3339
finger1=grasping_tentacle_loop,id=133634,bonus_id=1826/1457
finger2=loop_of_eightfold_eyes,id=134527,bonus_id=1726/1808/1477,gems=100crit
trinket1=nightmare_egg_shell,id=137312,bonus_id=1826/1457
trinket2=faulty_countermeasure,id=137539,bonus_id=1726/1477
main_hand=blades_of_the_fallen_prince,id=128292,bonus_id=717,gem_id=142060/137549/141267/0,relic_id=0/1826:1467:3339/3397:1492:1675/0,enchant=rune_of_razorice
off_hand=blades_of_the_fallen_prince,id=128293,enchant=rune_of_the_fallen_crusader

# Gear Summary
# gear_ilvl=827.00
# gear_strength=9565
# gear_stamina=15435
# gear_crit_rating=5736
# gear_haste_rating=3241
# gear_mastery_rating=5842
# gear_versatility_rating=823
# gear_armor=3868
# set_bonus=tier19oh_2pc=1

Yåmm

Yåmm : 256832 dps

  • Race: Night Elf
  • Class: Demonhunter
  • Spec: Havoc
  • Level: 110
  • Role: Attack
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
256831.8 256831.8 119.6 / 0.047% 24033.4 / 9.4% 18603.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
13.8 13.8 Fury 0.03% 55.8 100.0% 100%
Origin https://eu.api.battle.net/wow/character/hyjal/Yåmm/advanced
Artifact
Professions
  • leatherworking: 780
  • skinning: 800

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Yåmm 256832
Annihilation 23782 9.3% 28.0 12.51sec 382064 370570 Direct 56.0 122230 273770 191105 45.4% 0.0%  

Stats details: annihilation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.00 55.99 0.00 0.00 1.0310 0.0000 10699102.98 10699102.98 0.00 370570.21 370570.21
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.54 54.55% 122230.20 92982 139277 122247.44 113814 125905 3733041 3733041 0.00
crit 25.44 45.45% 273770.22 208279 311981 273811.21 253896 282028 6966062 6966062 0.00
 
 

Action details: annihilation

Static Values
  • id:201427
  • school:chaos
  • resource:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.momentum.enabled|buff.momentum.up|fury.deficit<=30+buff.prepared.up*8|buff.metamorphosis.remains<2
Spelldata
  • id:201427
  • name:Annihilation
  • school:chaos
  • tooltip:
  • description:Slice your target for ${$227518sw1+$201428sw1} Chaos damage. Critical strikes refund {$197125s1=20} Fury.
 
auto_attack_mh 9505 3.7% 182.3 2.47sec 23475 10821 Direct 182.3 18548 37099 23476 45.6% 19.0%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 182.26 182.26 0.00 0.00 2.1694 0.0000 4278611.81 6289964.64 31.98 10821.00 10821.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 64.55 35.42% 18547.99 16370 19644 18549.35 17877 19382 1197327 1760184 31.98
crit 83.06 45.57% 37099.28 32739 39287 37101.46 35699 38243 3081285 4529781 31.98
miss 34.65 19.01% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 4756 1.9% 182.3 2.47sec 11746 5414 Direct 182.3 9274 18548 11746 45.6% 19.0%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 182.26 182.26 0.00 0.00 2.1694 0.0000 2140781.61 3147151.75 31.98 5414.23 5414.23
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 64.55 35.42% 9274.13 8185 9822 9274.69 8840 9606 598666 880095 31.98
crit 83.14 45.62% 18548.18 16370 19644 18549.59 17987 19155 1542116 2267057 31.98
miss 34.57 18.97% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Chaos Strike 75792 29.5% 115.7 3.57sec 295075 205241 Direct 231.3 94285 211168 147593 45.6% 0.0%  

Stats details: chaos_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 115.68 231.28 0.00 0.00 1.4377 0.0000 34134691.33 34134691.33 0.00 205241.21 205241.21
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 125.80 54.39% 94284.71 71524 107286 94276.37 91803 96260 11860648 11860648 0.00
crit 105.48 45.61% 211168.37 160214 240322 211169.33 204273 216290 22274043 22274043 0.00
 
 

Action details: chaos_strike

Static Values
  • id:162794
  • school:chaos
  • resource:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.momentum.enabled|buff.momentum.up|fury.deficit<=30+buff.prepared.up*8
Spelldata
  • id:162794
  • name:Chaos Strike
  • school:chaos
  • tooltip:
  • description:Slice your target for ${$222031sw1+$199547sw1} Chaos damage. Critical strikes refund {$197125s1=20} Fury.
 
Deadly Grace 6312 2.4% 26.9 10.78sec 103844 0 Direct 26.9 71325 142665 103844 45.6% 0.0%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.95 26.95 0.00 0.00 0.0000 0.0000 2798257.64 2798257.64 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.66 54.42% 71324.93 60800 72960 71329.01 65222 72960 1045900 1045900 0.00
crit 12.28 45.58% 142665.42 121600 145920 142658.90 130720 145920 1752358 1752358 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:5.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=47572 to 71358} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:47572.00
  • base_dd_max:71358.00
 
Demon's Bite 11891 4.6% 84.2 5.40sec 63539 46941 Direct 84.2 43646 87292 63540 45.6% 0.0%  

Stats details: demons_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 84.24 84.24 0.00 0.00 1.3536 0.0000 5352331.85 7868434.81 31.98 46941.22 46941.22
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 45.84 54.42% 43645.55 40047 48057 43646.94 41805 45731 2000851 2941440 31.98
crit 38.39 45.58% 87291.80 80094 96113 87292.14 83195 91694 3351481 4926994 31.98
 
 

Action details: demons_bite

Static Values
  • id:162243
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:fury.deficit>=25
Spelldata
  • id:162243
  • name:Demon's Bite
  • school:physical
  • tooltip:
  • description:Quickly attack for $sw2 Physical damage. |cFFFFFFFFGenerates $m3 to $M3 Fury.|r
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.60
 
Eye Beam 9065 (13218) 3.5% (5.2%) 9.3 48.34sec 639960 309585 Periodic 92.8 0 43990 43990 100.0% 0.0% 3.7%

Stats details: eye_beam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.30 0.00 92.82 92.82 2.0672 0.1820 4082964.62 4082964.62 0.00 309585.33 309585.33
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 92.8 100.00% 43989.72 40311 48374 43990.25 40311 48374 4082965 4082965 0.00
 
 

Action details: eye_beam

Static Values
  • id:198013
  • school:chaos
  • resource:fury
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.demonic.enabled&buff.metamorphosis.down&(!talent.first_blood.enabled|fury>=80|fury.deficit<30)
Spelldata
  • id:198013
  • name:Eye Beam
  • school:chromatic
  • tooltip:
  • description:Blasts all enemies directly in front of you for $<dmg> Chaos damage. Eye Beam always critically strikes.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:2.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Anguish 4153 1.6% 0.0 0.00sec 0 0 Direct 9.2 139220 278282 202796 45.7% 0.0%  

Stats details: anguish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 9.22 0.00 0.00 0.0000 0.0000 1870670.92 1870670.92 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.01 54.28% 139219.72 124216 149060 139004.19 0 149060 697135 697135 0.00
crit 4.22 45.72% 278282.33 248433 298120 276693.42 0 298120 1173536 1173536 0.00
 
 

Action details: anguish

Static Values
  • id:202446
  • school:chaos
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202446
  • name:Anguish
  • school:chaos
  • tooltip:
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals {$202446s1=10} Chaos damage to the victim per application.}
 
Fel Barrage 18503 7.2% 13.4 34.46sec 623687 387106 Direct 66.6 85781 171583 124949 45.6% 0.0%  

Stats details: fel_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.35 66.65 66.68 0.00 1.6112 0.1999 8327427.72 8327427.72 0.00 387106.16 387106.16
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.23 54.35% 85780.75 62108 93162 85838.87 74308 93162 3107462 3107462 0.00
crit 30.42 45.65% 171582.84 124216 186325 171684.25 149060 186325 5219966 5219966 0.00
 
 

Action details: fel_barrage

Static Values
  • id:211053
  • school:chaos
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges>=5&(buff.momentum.up|!talent.momentum.enabled)&(active_enemies>desired_targets|raid_event.adds.in>30)
Spelldata
  • id:211053
  • name:Fel Barrage
  • school:chaos
  • tooltip:Unleashing Fel.
  • description:At your command, unleash Fel, inflicting ${{$211052s1=0}} Chaos damage to your target and nearby enemies for each charge. Max 5 charges. Your damaging attacks have a chance to generate a charge.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:1.00
  • base_tick_time:0.25
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Fel Rush 20028 7.8% 45.2 9.92sec 199339 493525 Direct 45.2 136949 273897 199335 45.6% 0.0%  

Stats details: fel_rush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.25 45.25 0.00 0.00 0.4039 0.0000 9019655.62 9019655.62 0.00 493524.60 493524.60
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.63 54.44% 136948.65 136949 136949 136948.65 136949 136949 3373602 3373602 0.00
crit 20.61 45.56% 273897.31 273897 273897 273897.31 273897 273897 5646054 5646054 0.00
 
 

Action details: fel_rush

Static Values
  • id:195072
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.2500
  • min_gcd:0.2500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.momentum.enabled|talent.fel_mastery.enabled)&(!talent.momentum.enabled|(charges=2|cooldown.vengeful_retreat.remains>4)&buff.momentum.down)&(!talent.fel_mastery.enabled|fury.deficit>=25)&raid_event.movement.in>charges*10
Spelldata
  • id:195072
  • name:Fel Rush
  • school:physical
  • tooltip:
  • description:Rush forward, incinerating anything in your path for {$192611s1=0} Chaos damage.$?a192939[ |cFFFFFFFFGenerates {$192939s1=25} Fury if you damage an enemy.|r][]
 
Fury of the Illidari 12021 (19206) 4.7% (7.5%) 7.9 60.77sec 1099438 827897 Periodic 109.6 33907 67765 49330 45.6% 0.0% 5.2%

Stats details: fury_of_the_illidari

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.86 0.00 54.79 109.57 1.3280 0.4283 5405306.11 5405306.11 0.00 254790.15 827897.01
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 59.7 54.45% 33906.78 19789 47494 33920.38 29075 38787 2022885 2022885 0.00
crit 49.9 45.55% 67765.23 39579 94989 67787.49 57273 80787 3382421 3382421 0.00
 
 

Action details: fury_of_the_illidari

Static Values
  • id:201467
  • school:chaos
  • resource:none
  • range:5.0
  • travel_speed:3.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>desired_targets|raid_event.adds.in>55
Spelldata
  • id:201467
  • name:Fury of the Illidari
  • school:physical
  • tooltip:
  • description:Throws the |cFFFFCC99Twinblades of the Deceiver|r in a whirlwind of energy, causing ${7*($201628sw1+$201789sw1)} Chaos damage over {$d=3 seconds} to all nearby enemies.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Rage of the Illidari 7185 2.8% 7.8 60.77sec 414432 0 Direct 7.8 414431 0 414431 0.0% 0.0%  

Stats details: rage_of_the_illidari

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.80 7.80 0.00 0.00 0.0000 0.0000 3231315.48 3231315.48 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.80 100.00% 414430.62 256470 598430 414593.75 354512 475241 3231315 3231315 0.00
 
 

Action details: rage_of_the_illidari

Static Values
  • id:217070
  • school:chaos
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:217070
  • name:Rage of the Illidari
  • school:chaos
  • tooltip:
  • description:{$@spelldesc201472=When Fury of the Illidari ends, {$s1=60}% of the damage it dealt erupts in an explosion of fel energy, dividing that Chaos damage among all neaby enemies.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:332460.86
  • base_dd_max:332460.86
 
Metamorphosis (_impact) 428 0.2% 2.3 242.81sec 83509 0 Direct 2.3 57347 114759 83505 45.6% 0.0%  

Stats details: metamorphosis_impact

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.31 2.31 0.00 0.00 0.0000 0.0000 193184.13 193184.13 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.26 54.43% 57347.38 49746 59696 47630.03 0 59696 72207 72207 0.00
crit 1.05 45.57% 114758.91 99493 119391 85988.41 0 119391 120977 120977 0.00
 
 

Action details: metamorphosis_impact

Static Values
  • id:200166
  • school:chaos
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:200166
  • name:Metamorphosis
  • school:chromatic
  • tooltip:Stunned.
  • description:{$@spelldesc191427=Leap into the air and land with explosive force, dealing {$200166s2=0} Chaos damage to enemies within 8 yds, and stunning them for {$200166d=3 seconds}. Upon landing, you are transformed into a hellish demon for {$162264d=30 seconds}, greatly empowering your Chaos Strike and Blade Dance abilities, and gaining {$162264s7=25}% Haste.}
 
Throw Glaive 17492 (51931) 6.8% (20.2%) 49.8 8.92sec 469677 345913 Direct 49.7 108662 217328 158217 45.6% 0.0%  

Stats details: throw_glaive

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.76 49.75 0.00 0.00 1.3578 0.0000 7871309.17 11571570.07 31.98 345913.47 345913.47
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 27.06 54.39% 108662.41 90568 108682 108662.58 107340 108682 2940461 4322756 31.98
crit 22.69 45.61% 217328.40 181137 217364 217328.20 214949 217364 4930848 7248814 31.98
 
 

Action details: throw_glaive

Static Values
  • id:185123
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.bloodlet.enabled&spell_targets>=2+talent.chaos_cleave.enabled&(!talent.master_of_the_glaive.enabled|!talent.momentum.enabled|buff.momentum.up)
Spelldata
  • id:185123
  • name:Throw Glaive
  • school:physical
  • tooltip:
  • description:Throw a demonic glaive at the target, dealing $sw1 Physical damage. The glaive can ricochet to ${$x1-1} additional enemies within 10 yards.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:4.90
 
    Bloodlet 34439 13.4% 0.0 0.00sec 0 0 Periodic 207.3 74759 0 74759 0.0% 0.0% 92.1%

Stats details: bloodlet

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 207.32 207.32 0.0000 2.0000 15499642.31 15499642.31 0.00 37380.42 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 207.3 100.00% 74758.83 37435 190194 74850.03 60614 90267 15499642 15499642 0.00
 
 

Action details: bloodlet

Static Values
  • id:207690
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:207690
  • name:Bloodlet
  • school:physical
  • tooltip:Inflicts $w1 damage every $t1 sec.
  • description:{$@spelldesc206473=Throw Glaive causes targets to bleed for {$s1=200}% of the damage inflicted over {$207690d=10 seconds}. If this effect is reapplied, any remaining damage will be added to the new Bloodlet.}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Vengeful Retreat 1481 0.6% 29.7 15.41sec 22424 0 Direct 29.7 15403 30806 22424 45.6% 0.0%  

Stats details: vengeful_retreat

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.73 29.73 0.00 0.00 0.0000 0.0000 666711.66 980129.29 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.18 54.42% 15402.79 15403 15403 15402.79 15403 15403 249205 366355 31.98
crit 13.55 45.58% 30805.58 30806 30806 30805.58 30806 30806 417507 613774 31.98
 
 

Action details: vengeful_retreat

Static Values
  • id:198793
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.prepared.enabled|talent.momentum.enabled)&buff.prepared.down&buff.momentum.down
Spelldata
  • id:198793
  • name:Vengeful Retreat
  • school:physical
  • tooltip:
  • description:Viciously assault nearby enemies and vault away. Assaulted enemies take $198813sw2 Physical damage and have their movement speed reduced by {$198813s1=70}% for {$198813d=3 seconds}.$?a203551[ |cFFFFFFFFGenerates $203650o1 Fury over {$203650d=5 seconds} if you damage an enemy.|r][]
 
Simple Action Stats Execute Interval
Yåmm
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Yåmm
  • harmful:false
  • if_expr:
 
Consume Magic 14.0 32.85sec

Stats details: consume_magic

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.05 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: consume_magic

Static Values
  • id:183752
  • school:chromatic
  • resource:none
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:183752
  • name:Consume Magic
  • school:chromatic
  • tooltip:
  • description:Interrupts the enemy's spellcasting and locks them from that school of magic for {$d=3 seconds}.|cFFFFFFFF{$?s178940=false}[ Generates {$218903s1=50} Fury on a successful interrupt.][ Generates ${{$218903s2=500}/10} Pain on a successful interrupt.]|r
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Yåmm
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Yåmm
  • harmful:false
  • if_expr:
 
Metamorphosis 2.3 242.81sec

Stats details: metamorphosis

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.31 0.00 0.00 0.00 1.2237 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: metamorphosis

Static Values
  • id:191427
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:1.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:240.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.metamorphosis.down&(!talent.demonic.enabled|!cooldown.eye_beam.ready)&(!talent.chaos_blades.enabled|cooldown.chaos_blades.ready)&(!talent.nemesis.enabled|debuff.nemesis.up|cooldown.nemesis.ready)
Spelldata
  • id:191427
  • name:Metamorphosis
  • school:physical
  • tooltip:
  • description:Leap into the air and land with explosive force, dealing {$200166s2=0} Chaos damage to enemies within 8 yds, and stunning them for {$200166d=3 seconds}. Upon landing, you are transformed into a hellish demon for {$162264d=30 seconds}, greatly empowering your Chaos Strike and Blade Dance abilities, and gaining {$162264s7=25}% Haste.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 14.32% 0.0(0.0) 1.0

Buff details

  • buff initial source:Yåmm
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Metamorphosis 2.3 0.0 242.8sec 242.8sec 14.84% 19.20% 0.0(0.0) 2.2

Buff details

  • buff initial source:Yåmm
  • cooldown name:buff_metamorphosis
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • metamorphosis_1:14.84%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:162264
  • name:Metamorphosis
  • tooltip:Chaos Strike and Blade Dance upgraded to $@spellname201427 and $@spellname210152. Haste increased by {$s7=25}%.
  • description:{$@spelldesc191427=Leap into the air and land with explosive force, dealing {$200166s2=0} Chaos damage to enemies within 8 yds, and stunning them for {$200166d=3 seconds}. Upon landing, you are transformed into a hellish demon for {$162264d=30 seconds}, greatly empowering your Chaos Strike and Blade Dance abilities, and gaining {$162264s7=25}% Haste.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Momentum 75.0 0.0 6.0sec 6.0sec 66.30% 65.66% 0.0(0.0) 74.3

Buff details

  • buff initial source:Yåmm
  • cooldown name:buff_momentum
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • momentum_1:66.30%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:208628
  • name:Momentum
  • tooltip:Damage done increased by {$s1=20}%.
  • description:Increases all damage done by {$s1=20}%.
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
out_of_range 29.7 29.7 15.4sec 7.6sec 2.14% 2.14% 29.7(29.7) 0.0

Buff details

  • buff initial source:Yåmm
  • cooldown name:buff_out_of_range
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • out_of_range_1:2.14%

Trigger Attempt Success

  • trigger_pct:100.00%
Potion of Deadly Grace 2.0 0.0 247.2sec 0.0sec 10.83% 10.90% 0.0(0.0) 2.0

Buff details

  • buff initial source:Yåmm
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:10.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Prepared 29.7 0.0 15.4sec 15.4sec 32.83% 32.87% 295.5(295.5) 29.4

Buff details

  • buff initial source:Yåmm
  • cooldown name:buff_prepared
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:4.00

Stack Uptimes

  • prepared_1:32.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:203650
  • name:Prepared
  • tooltip:Generating ${$m1*2} Fury every sec.
  • description:{$@spelldesc203551=Reduces the cooldown of Vengeful Retreat by 10 sec, and generates $203650o1 Fury over {$203650d=5 seconds} if you damage at least one enemy with Vengeful Retreat.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Rage of the Illidari 7.9 101.7 60.8sec 3.9sec 5.22% 5.27% 101.7(101.7) 0.0

Buff details

  • buff initial source:Yåmm
  • cooldown name:buff_rage_of_the_illidari
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • rage_of_the_illidari_1:5.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:217060
  • name:Rage of the Illidari
  • tooltip:
  • description:{$@spelldesc201472=When Fury of the Illidari ends, {$s1=60}% of the damage it dealt erupts in an explosion of fel energy, dividing that Chaos damage among all neaby enemies.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
vengeful_retreat_movement 29.7 0.0 15.4sec 15.4sec 6.60% 6.59% 0.0(0.0) 29.7

Buff details

  • buff initial source:Yåmm
  • cooldown name:buff_vengeful_retreat_movement
  • max_stacks:1
  • duration:1.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • vengeful_retreat_movement_1:6.60%

Trigger Attempt Success

  • trigger_pct:100.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Yåmm
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Yåmm
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (the_hungry_magister)

Buff details

  • buff initial source:Yåmm
  • cooldown name:buff_the_hungry_magister
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:375.00

Stack Uptimes

  • the_hungry_magister_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225602
  • name:Well Fed
  • tooltip:Critical Strike increased by $w1.
  • description:Increases critical strike by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Yåmm
annihilation Fury 28.0 1120.1 40.0 40.0 9552.2
chaos_strike Fury 115.7 4627.3 40.0 40.0 7376.8
eye_beam Fury 9.3 465.1 50.0 50.0 12799.4
Resource Gains Type Count Total Average Overflow
prepared Fury 295.54 1139.82 (18.19%) 3.86 42.35 3.58%
consume_magic Fury 14.05 580.22 (9.26%) 41.30 122.23 17.40%
fel_rush_dmg Fury 45.25 1131.18 (18.05%) 25.00 0.01 0.00%
demons_bite Fury 84.24 2105.47 (33.60%) 24.99 0.14 0.01%
annihilation Fury 12.72 254.34 (4.06%) 20.00 0.00 0.00%
chaos_strike Fury 52.72 1054.39 (16.83%) 20.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Fury 13.91 13.79
Combat End Resource Mean Min Max
Fury 53.55 0.00 110.00

Benefits & Uptimes

Benefits %
Uptimes %
Fury Cap 1.6%

Procs

Count Interval
delayed_swing__out_of_range 8.6 98.5sec
delayed_swing__channeling 26.0 33.8sec
demons_bite_in_meta 15.9 21.8sec
fel_barrage 51.0 8.7sec

Statistics & Data Analysis

Fight Length
Sample Data Yåmm Fight Length
Count 9999
Mean 450.42
Minimum 350.15
Maximum 555.44
Spread ( max - min ) 205.29
Range [ ( max - min ) / 2 * 100% ] 22.79%
DPS
Sample Data Yåmm Damage Per Second
Count 9999
Mean 256831.77
Minimum 238074.11
Maximum 283633.37
Spread ( max - min ) 45559.27
Range [ ( max - min ) / 2 * 100% ] 8.87%
Standard Deviation 6101.1135
5th Percentile 247157.81
95th Percentile 267190.76
( 95th Percentile - 5th Percentile ) 20032.95
Mean Distribution
Standard Deviation 61.0142
95.00% Confidence Intervall ( 256712.19 - 256951.36 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 21
0.1% Error 2167
0.1 Scale Factor Error with Delta=300 317761
0.05 Scale Factor Error with Delta=300 1271047
0.01 Scale Factor Error with Delta=300 31776193
Priority Target DPS
Sample Data Yåmm Priority Target Damage Per Second
Count 9999
Mean 256831.77
Minimum 238074.11
Maximum 283633.37
Spread ( max - min ) 45559.27
Range [ ( max - min ) / 2 * 100% ] 8.87%
Standard Deviation 6101.1135
5th Percentile 247157.81
95th Percentile 267190.76
( 95th Percentile - 5th Percentile ) 20032.95
Mean Distribution
Standard Deviation 61.0142
95.00% Confidence Intervall ( 256712.19 - 256951.36 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 21
0.1% Error 2167
0.1 Scale Factor Error with Delta=300 317761
0.05 Scale Factor Error with Delta=300 1271047
0.01 Scale Factor Error with Delta=300 31776193
DPS(e)
Sample Data Yåmm Damage Per Second (Effective)
Count 9999
Mean 256831.77
Minimum 238074.11
Maximum 283633.37
Spread ( max - min ) 45559.27
Range [ ( max - min ) / 2 * 100% ] 8.87%
Damage
Sample Data Yåmm Damage
Count 9999
Mean 115571964.96
Minimum 87245286.79
Maximum 147141832.77
Spread ( max - min ) 59896545.99
Range [ ( max - min ) / 2 * 100% ] 25.91%
DTPS
Sample Data Yåmm Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Yåmm Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Yåmm Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Yåmm Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Yåmm Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Yåmm Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data YåmmTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Yåmm Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=the_hungry_magister
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=deadly_grace
Default action list Executed every time the actor is available.
# count action,conditions
5 18.27 auto_attack
0.00 pick_up_fragment,if=talent.demonic_appetite.enabled&fury.deficit>=30
6 14.05 consume_magic
7 29.73 vengeful_retreat,if=(talent.prepared.enabled|talent.momentum.enabled)&buff.prepared.down&buff.momentum.down
Vengeful Retreat backwards through the target to minimize downtime.
8 45.25 fel_rush,animation_cancel=1,if=(talent.momentum.enabled|talent.fel_mastery.enabled)&(!talent.momentum.enabled|(charges=2|cooldown.vengeful_retreat.remains>4)&buff.momentum.down)&(!talent.fel_mastery.enabled|fury.deficit>=25)&raid_event.movement.in>charges*10
Fel Rush for Momentum and for fury from Fel Mastery.
0.00 eye_beam,if=talent.demonic.enabled&buff.metamorphosis.down&(!talent.first_blood.enabled|fury>=80|fury.deficit<30)
9 4.13 demons_bite,sync=metamorphosis,if=fury.deficit>=25
If Metamorphosis is ready, pool fury first before using it.
A 0.00 call_action_list,name=cooldown
B 7.86 fury_of_the_illidari,if=active_enemies>desired_targets|raid_event.adds.in>55
0.00 death_sweep,if=death_sweep_worth_using
Use Death Sweep if it is more effective than Annihilation. See the Demon Hunter section of the wiki for how this is calculated.
0.00 demons_bite,if=buff.metamorphosis.remains>gcd&cooldown.blade_dance.remains<gcd&fury<70&death_sweep_worth_using
0.00 blade_dance,if=blade_dance_worth_using
Use Blade Dance if it is more effective than Chaos Strike. See the Demon Hunter section of the wiki for how this is calculated.
C 8.99 fel_barrage,if=charges>=5&(buff.momentum.up|!talent.momentum.enabled)&(active_enemies>desired_targets|raid_event.adds.in>30)
Use Fel Barrage at max charges, saving it for Momentum and adds if possible.
0.00 throw_glaive,if=talent.bloodlet.enabled&spell_targets>=2+talent.chaos_cleave.enabled&(!talent.master_of_the_glaive.enabled|!talent.momentum.enabled|buff.momentum.up)
0.00 fel_eruption
0.00 felblade,if=fury.deficit>=30+buff.prepared.up*8
D 28.00 annihilation,if=!talent.momentum.enabled|buff.momentum.up|fury.deficit<=30+buff.prepared.up*8|buff.metamorphosis.remains<2
E 49.76 throw_glaive,if=talent.bloodlet.enabled&(!talent.master_of_the_glaive.enabled|!talent.momentum.enabled|buff.momentum.up)
F 9.30 eye_beam,if=!talent.demonic.enabled&(spell_targets.eye_beam_tick>desired_targets|(raid_event.adds.in>45&buff.metamorphosis.down&(artifact.anguish_of_the_deceiver.enabled|active_enemies>1|level=100)))
0.00 demons_bite,if=buff.metamorphosis.down&cooldown.blade_dance.remains<gcd&fury<55&blade_dance_worth_using
Pool fury for various different upcoming abilities.
0.00 demons_bite,if=talent.demonic.enabled&buff.metamorphosis.down&cooldown.eye_beam.remains<gcd&fury.deficit>=20
0.00 demons_bite,if=talent.demonic.enabled&buff.metamorphosis.down&cooldown.eye_beam.remains<2*gcd&fury.deficit>=45
0.00 throw_glaive,if=buff.metamorphosis.down&spell_targets>=3
G 115.68 chaos_strike,if=!talent.momentum.enabled|buff.momentum.up|fury.deficit<=30+buff.prepared.up*8
H 4.36 fel_barrage,if=charges=4&buff.metamorphosis.down&(buff.momentum.up|!talent.momentum.enabled)&(active_enemies>desired_targets|raid_event.adds.in>30)
Use Fel Barrage if its nearing max charges, saving it for Momentum and adds if possible.
0.00 fel_rush,animation_cancel=1,if=!talent.momentum.enabled&raid_event.movement.in>charges*10
I 80.11 demons_bite
0.00 throw_glaive
0.00 fel_rush,if=movement.distance>15|(buff.out_of_range.up&!talent.momentum.enabled)
0.00 vengeful_retreat,if=movement.distance>15
actions.cooldown
# count action,conditions
0.00 nemesis,target_if=min:target.time_to_die,if=raid_event.adds.exists&debuff.nemesis.down&(active_enemies>desired_targets|raid_event.adds.in>60)
0.00 nemesis,if=!raid_event.adds.exists&(cooldown.metamorphosis.remains>100|target.time_to_die<70)
0.00 nemesis,sync=metamorphosis,if=!raid_event.adds.exists
0.00 chaos_blades,if=buff.metamorphosis.up|cooldown.metamorphosis.remains>100|target.time_to_die<20
J 2.31 metamorphosis,if=buff.metamorphosis.down&(!talent.demonic.enabled|!cooldown.eye_beam.ready)&(!talent.chaos_blades.enabled|cooldown.chaos_blades.ready)&(!talent.nemesis.enabled|debuff.nemesis.up|cooldown.nemesis.ready)
Use Metamorphosis if Nemesis and Chaos Blades are ready.
K 1.00 potion,name=deadly_grace,if=buff.metamorphosis.remains>25

Sample Sequence

0124579596JBDD8C5DDE8EIDII7DDEID8DDEIIF58IDEID7IDHEI8GGE6GIGIG7GEG8GCG8IEGI7GBG8EGF5IIIG67EGG8GGG8EIGI7HGE8GIGIIGI7EGG8G6GEF5IIG7B5EG8GGH8GEII7GIG8EGG8GI6GI7E5GG8GGIIF5II7EGC8EGG8GIEB7GH56G8GEGIIIG7G5EG8G6GG8FEII7GIG8EGI6GIIG7EGG8GGI8E99J7KB6DC5D8DDDEIIFI7E65DDD8DDDE8DIEI7G5GI8EGGI86GEG7GIGI8GEGIF5B7IEG8GH5II8EGG7IGI8E6GGIGII7EGGG8CGEFII7GGE8GGI8GIBI7EGG6G8C5EG8GGG7EIG8GIGIIF5I7EGI8EGG86GGII7EGH58GGEIBII7GGE8GCG8GF5I7E

Sample Sequence Table

time name target resources buffs
Pre flask Yåmm 0.0/110: 0% fury
Pre food Yåmm 0.0/110: 0% fury
Pre augmentation Yåmm 0.0/110: 0% fury
Pre potion Fluffy_Pillow 0.0/110: 0% fury potion_of_deadly_grace
0:00.000 auto_attack Fluffy_Pillow 0.0/110: 0% fury potion_of_deadly_grace
0:00.000 vengeful_retreat Fluffy_Pillow 0.0/110: 0% fury potion_of_deadly_grace
0:00.000 demons_bite Fluffy_Pillow 0.0/110: 0% fury momentum, prepared, vengeful_retreat_movement, potion_of_deadly_grace
0:01.447 auto_attack Fluffy_Pillow 34.0/110: 31% fury bloodlust, momentum, prepared, potion_of_deadly_grace
0:01.447 demons_bite Fluffy_Pillow 34.0/110: 31% fury bloodlust, momentum, prepared, potion_of_deadly_grace
0:02.559 consume_magic Fluffy_Pillow 68.0/110: 62% fury bloodlust, momentum, prepared, potion_of_deadly_grace
0:02.559 metamorphosis Fluffy_Pillow 110.0/110: 100% fury bloodlust, momentum, prepared, potion_of_deadly_grace
0:03.564 fury_of_the_illidari Fluffy_Pillow 110.0/110: 100% fury bloodlust, metamorphosis, momentum, prepared, potion_of_deadly_grace
0:04.456 annihilation Fluffy_Pillow 110.0/110: 100% fury bloodlust, metamorphosis, prepared, rage_of_the_illidari, potion_of_deadly_grace
0:05.348 annihilation Fluffy_Pillow 98.0/110: 89% fury bloodlust, metamorphosis, rage_of_the_illidari, potion_of_deadly_grace
0:06.239 fel_rush Fluffy_Pillow 58.0/110: 53% fury bloodlust, metamorphosis, rage_of_the_illidari, potion_of_deadly_grace
0:06.571 fel_barrage Fluffy_Pillow 83.0/110: 75% fury bloodlust, metamorphosis, momentum, potion_of_deadly_grace
0:07.707 auto_attack Fluffy_Pillow 83.0/110: 75% fury bloodlust, metamorphosis, momentum, potion_of_deadly_grace
0:07.707 annihilation Fluffy_Pillow 83.0/110: 75% fury bloodlust, metamorphosis, momentum, potion_of_deadly_grace
0:08.599 annihilation Fluffy_Pillow 43.0/110: 39% fury bloodlust, metamorphosis, momentum, potion_of_deadly_grace
0:09.489 throw_glaive Fluffy_Pillow 3.0/110: 3% fury bloodlust, metamorphosis, momentum, potion_of_deadly_grace
0:10.382 fel_rush Fluffy_Pillow 3.0/110: 3% fury bloodlust, metamorphosis, potion_of_deadly_grace
0:10.840 throw_glaive Fluffy_Pillow 28.0/110: 25% fury bloodlust, metamorphosis, momentum, potion_of_deadly_grace
0:11.731 demons_bite Fluffy_Pillow 28.0/110: 25% fury bloodlust, metamorphosis, momentum, potion_of_deadly_grace
0:12.624 annihilation Fluffy_Pillow 48.0/110: 44% fury bloodlust, metamorphosis, momentum, potion_of_deadly_grace
0:13.517 demons_bite Fluffy_Pillow 28.0/110: 25% fury bloodlust, metamorphosis, momentum, potion_of_deadly_grace
0:14.406 demons_bite Fluffy_Pillow 49.0/110: 45% fury bloodlust, metamorphosis, potion_of_deadly_grace
0:15.299 vengeful_retreat Fluffy_Pillow 78.0/110: 71% fury bloodlust, metamorphosis, potion_of_deadly_grace
0:15.299 annihilation Fluffy_Pillow 78.0/110: 71% fury bloodlust, metamorphosis, momentum, prepared, vengeful_retreat_movement, potion_of_deadly_grace
0:16.191 annihilation Fluffy_Pillow 62.0/110: 56% fury bloodlust, metamorphosis, momentum, prepared, vengeful_retreat_movement, potion_of_deadly_grace
0:17.082 throw_glaive Fluffy_Pillow 30.0/110: 27% fury bloodlust, metamorphosis, momentum, prepared, potion_of_deadly_grace
0:17.974 demons_bite Fluffy_Pillow 38.0/110: 35% fury bloodlust, metamorphosis, momentum, prepared, potion_of_deadly_grace
0:18.865 annihilation Fluffy_Pillow 68.0/110: 62% fury bloodlust, metamorphosis, momentum, prepared, potion_of_deadly_grace
0:19.757 fel_rush Fluffy_Pillow 52.0/110: 47% fury bloodlust, metamorphosis, prepared, potion_of_deadly_grace
0:20.178 annihilation Fluffy_Pillow 81.0/110: 74% fury bloodlust, metamorphosis, momentum, prepared, potion_of_deadly_grace
0:21.069 annihilation Fluffy_Pillow 45.0/110: 41% fury bloodlust, metamorphosis, momentum, potion_of_deadly_grace
0:21.961 throw_glaive Fluffy_Pillow 5.0/110: 5% fury bloodlust, metamorphosis, momentum, potion_of_deadly_grace
0:22.853 demons_bite Fluffy_Pillow 5.0/110: 5% fury bloodlust, metamorphosis, momentum, potion_of_deadly_grace
0:23.743 demons_bite Fluffy_Pillow 32.0/110: 29% fury bloodlust, metamorphosis, momentum
0:24.635 eye_beam Fluffy_Pillow 59.0/110: 54% fury bloodlust, metamorphosis
0:26.079 auto_attack Fluffy_Pillow 9.0/110: 8% fury bloodlust, metamorphosis
0:26.079 fel_rush Fluffy_Pillow 9.0/110: 8% fury bloodlust, metamorphosis
0:26.616 demons_bite Fluffy_Pillow 34.0/110: 31% fury bloodlust, metamorphosis, momentum
0:27.506 annihilation Fluffy_Pillow 61.0/110: 55% fury bloodlust, metamorphosis, momentum
0:28.398 throw_glaive Fluffy_Pillow 21.0/110: 19% fury bloodlust, metamorphosis, momentum
0:29.289 demons_bite Fluffy_Pillow 21.0/110: 19% fury bloodlust, metamorphosis, momentum
0:30.181 annihilation Fluffy_Pillow 51.0/110: 46% fury bloodlust, metamorphosis, momentum
0:31.073 vengeful_retreat Fluffy_Pillow 11.0/110: 10% fury bloodlust, metamorphosis
0:31.073 demons_bite Fluffy_Pillow 11.0/110: 10% fury bloodlust, metamorphosis, momentum, prepared, vengeful_retreat_movement
0:31.964 annihilation Fluffy_Pillow 40.0/110: 36% fury bloodlust, metamorphosis, momentum, prepared, vengeful_retreat_movement
0:32.854 fel_barrage Fluffy_Pillow 28.0/110: 25% fury bloodlust, momentum, prepared
0:34.238 throw_glaive Fluffy_Pillow 40.0/110: 36% fury bloodlust, momentum, prepared
0:35.352 demons_bite Fluffy_Pillow 48.0/110: 44% fury bloodlust, prepared
0:36.466 fel_rush Fluffy_Pillow 83.0/110: 75% fury bloodlust
0:36.863 chaos_strike Fluffy_Pillow 108.0/110: 98% fury bloodlust, momentum
0:37.977 chaos_strike Fluffy_Pillow 88.0/110: 80% fury bloodlust, momentum
0:39.090 throw_glaive Fluffy_Pillow 68.0/110: 62% fury bloodlust, momentum
0:40.204 consume_magic Fluffy_Pillow 68.0/110: 62% fury bloodlust, momentum
0:40.204 chaos_strike Fluffy_Pillow 110.0/110: 100% fury bloodlust, momentum
0:41.319 demons_bite Fluffy_Pillow 70.0/110: 64% fury
0:42.765 chaos_strike Fluffy_Pillow 96.0/110: 87% fury
0:44.212 demons_bite Fluffy_Pillow 76.0/110: 69% fury
0:45.659 chaos_strike Fluffy_Pillow 103.0/110: 94% fury
0:47.104 vengeful_retreat Fluffy_Pillow 63.0/110: 57% fury
0:47.104 chaos_strike Fluffy_Pillow 63.0/110: 57% fury momentum, prepared, vengeful_retreat_movement
0:48.550 throw_glaive Fluffy_Pillow 51.0/110: 46% fury momentum, prepared
0:49.997 chaos_strike Fluffy_Pillow 63.0/110: 57% fury momentum, prepared
0:51.444 fel_rush Fluffy_Pillow 55.0/110: 50% fury prepared
0:51.855 chaos_strike Fluffy_Pillow 84.0/110: 76% fury momentum, prepared
0:53.302 fel_barrage Fluffy_Pillow 48.0/110: 44% fury momentum
0:54.980 chaos_strike Fluffy_Pillow 48.0/110: 44% fury momentum
0:56.426 fel_rush Fluffy_Pillow 8.0/110: 7% fury
0:56.836 demons_bite Fluffy_Pillow 33.0/110: 30% fury momentum
0:58.283 throw_glaive Fluffy_Pillow 61.0/110: 55% fury momentum
0:59.729 chaos_strike Fluffy_Pillow 61.0/110: 55% fury momentum
1:01.176 demons_bite Fluffy_Pillow 41.0/110: 37% fury
1:02.623 vengeful_retreat Fluffy_Pillow 70.0/110: 64% fury
1:02.623 chaos_strike Fluffy_Pillow 70.0/110: 64% fury momentum, prepared, vengeful_retreat_movement
1:04.070 fury_of_the_illidari Fluffy_Pillow 58.0/110: 53% fury momentum, prepared
1:05.517 chaos_strike Fluffy_Pillow 70.0/110: 64% fury momentum, prepared, rage_of_the_illidari
1:06.964 fel_rush Fluffy_Pillow 62.0/110: 56% fury prepared, rage_of_the_illidari
1:07.274 throw_glaive Fluffy_Pillow 91.0/110: 83% fury momentum, prepared
1:08.791 chaos_strike Fluffy_Pillow 95.0/110: 86% fury momentum
1:10.237 eye_beam Fluffy_Pillow 75.0/110: 68% fury momentum
1:12.514 auto_attack Fluffy_Pillow 25.0/110: 23% fury
1:12.514 demons_bite Fluffy_Pillow 25.0/110: 23% fury
1:13.959 demons_bite Fluffy_Pillow 52.0/110: 47% fury
1:15.406 demons_bite Fluffy_Pillow 77.0/110: 70% fury
1:16.853 chaos_strike Fluffy_Pillow 99.0/110: 90% fury
1:18.299 consume_magic Fluffy_Pillow 79.0/110: 72% fury
1:18.299 vengeful_retreat Fluffy_Pillow 110.0/110: 100% fury
1:18.299 throw_glaive Fluffy_Pillow 110.0/110: 100% fury momentum, prepared, vengeful_retreat_movement
1:19.749 chaos_strike Fluffy_Pillow 110.0/110: 100% fury momentum, prepared
1:21.195 chaos_strike Fluffy_Pillow 82.0/110: 75% fury momentum, prepared
1:22.641 fel_rush Fluffy_Pillow 54.0/110: 49% fury prepared
1:23.022 chaos_strike Fluffy_Pillow 83.0/110: 75% fury momentum, prepared
1:24.468 chaos_strike Fluffy_Pillow 67.0/110: 61% fury momentum
1:25.915 chaos_strike Fluffy_Pillow 47.0/110: 43% fury momentum
1:27.359 fel_rush Fluffy_Pillow 7.0/110: 6% fury
1:27.754 throw_glaive Fluffy_Pillow 32.0/110: 29% fury momentum
1:29.201 demons_bite Fluffy_Pillow 32.0/110: 29% fury momentum
1:30.648 chaos_strike Fluffy_Pillow 52.0/110: 47% fury momentum
1:32.095 demons_bite Fluffy_Pillow 12.0/110: 11% fury
1:33.541 vengeful_retreat Fluffy_Pillow 34.0/110: 31% fury
1:33.541 fel_barrage Fluffy_Pillow 34.0/110: 31% fury momentum, prepared, vengeful_retreat_movement
1:35.260 chaos_strike Fluffy_Pillow 46.0/110: 42% fury momentum, prepared
1:36.707 throw_glaive Fluffy_Pillow 18.0/110: 16% fury momentum, prepared
1:38.154 fel_rush Fluffy_Pillow 30.0/110: 27% fury prepared
1:38.587 chaos_strike Fluffy_Pillow 59.0/110: 54% fury momentum
1:40.034 demons_bite Fluffy_Pillow 39.0/110: 35% fury momentum
1:41.479 chaos_strike Fluffy_Pillow 64.0/110: 58% fury momentum
1:42.926 demons_bite Fluffy_Pillow 44.0/110: 40% fury
1:44.373 demons_bite Fluffy_Pillow 67.0/110: 61% fury
1:45.820 chaos_strike Fluffy_Pillow 91.0/110: 83% fury
1:47.266 demons_bite Fluffy_Pillow 51.0/110: 46% fury
1:48.712 vengeful_retreat Fluffy_Pillow 74.0/110: 67% fury
1:48.712 throw_glaive Fluffy_Pillow 74.0/110: 67% fury momentum, prepared, vengeful_retreat_movement
1:50.159 chaos_strike Fluffy_Pillow 82.0/110: 75% fury momentum, prepared
1:51.604 chaos_strike Fluffy_Pillow 74.0/110: 67% fury momentum, prepared
1:53.051 fel_rush Fluffy_Pillow 66.0/110: 60% fury prepared
1:53.433 chaos_strike Fluffy_Pillow 95.0/110: 86% fury momentum, prepared
1:54.880 consume_magic Fluffy_Pillow 79.0/110: 72% fury momentum
1:54.880 chaos_strike Fluffy_Pillow 110.0/110: 100% fury momentum
1:56.328 throw_glaive Fluffy_Pillow 90.0/110: 82% fury momentum
1:57.774 eye_beam Fluffy_Pillow 90.0/110: 82% fury
1:59.992 auto_attack Fluffy_Pillow 40.0/110: 36% fury
1:59.992 demons_bite Fluffy_Pillow 40.0/110: 36% fury
2:01.437 demons_bite Fluffy_Pillow 67.0/110: 61% fury
2:02.885 chaos_strike Fluffy_Pillow 93.0/110: 85% fury
2:04.332 vengeful_retreat Fluffy_Pillow 53.0/110: 48% fury
2:04.332 fury_of_the_illidari Fluffy_Pillow 53.0/110: 48% fury momentum, prepared, vengeful_retreat_movement
2:05.779 auto_attack Fluffy_Pillow 61.0/110: 55% fury momentum, prepared, rage_of_the_illidari
2:05.779 throw_glaive Fluffy_Pillow 61.0/110: 55% fury momentum, prepared, rage_of_the_illidari
2:07.226 chaos_strike Fluffy_Pillow 73.0/110: 66% fury momentum, prepared, rage_of_the_illidari
2:08.672 fel_rush Fluffy_Pillow 65.0/110: 59% fury prepared
2:09.087 chaos_strike Fluffy_Pillow 94.0/110: 85% fury momentum, prepared
2:10.533 chaos_strike Fluffy_Pillow 58.0/110: 53% fury momentum
2:11.980 fel_barrage Fluffy_Pillow 18.0/110: 16% fury momentum
2:13.639 fel_rush Fluffy_Pillow 18.0/110: 16% fury
2:14.005 chaos_strike Fluffy_Pillow 43.0/110: 39% fury momentum
2:15.451 throw_glaive Fluffy_Pillow 23.0/110: 21% fury momentum
2:16.898 demons_bite Fluffy_Pillow 23.0/110: 21% fury momentum
2:18.345 demons_bite Fluffy_Pillow 46.0/110: 42% fury
2:19.792 vengeful_retreat Fluffy_Pillow 66.0/110: 60% fury
2:19.792 chaos_strike Fluffy_Pillow 66.0/110: 60% fury momentum, prepared, vengeful_retreat_movement
2:21.238 demons_bite Fluffy_Pillow 34.0/110: 31% fury momentum, prepared
2:22.683 chaos_strike Fluffy_Pillow 73.0/110: 66% fury momentum, prepared
2:24.129 fel_rush Fluffy_Pillow 65.0/110: 59% fury prepared
2:24.564 throw_glaive Fluffy_Pillow 94.0/110: 85% fury momentum, prepared
2:26.011 chaos_strike Fluffy_Pillow 98.0/110: 89% fury momentum
2:27.458 chaos_strike Fluffy_Pillow 58.0/110: 53% fury momentum
2:28.903 fel_rush Fluffy_Pillow 38.0/110: 35% fury
2:29.286 chaos_strike Fluffy_Pillow 63.0/110: 57% fury momentum
2:30.732 demons_bite Fluffy_Pillow 23.0/110: 21% fury momentum
2:32.179 consume_magic Fluffy_Pillow 45.0/110: 41% fury momentum
2:32.179 chaos_strike Fluffy_Pillow 95.0/110: 86% fury momentum
2:33.626 demons_bite Fluffy_Pillow 55.0/110: 50% fury
2:35.072 vengeful_retreat Fluffy_Pillow 77.0/110: 70% fury
2:35.072 throw_glaive Fluffy_Pillow 77.0/110: 70% fury momentum, prepared, vengeful_retreat_movement
2:36.517 auto_attack Fluffy_Pillow 85.0/110: 77% fury momentum, prepared
2:36.517 chaos_strike Fluffy_Pillow 85.0/110: 77% fury momentum, prepared
2:37.964 chaos_strike Fluffy_Pillow 77.0/110: 70% fury momentum, prepared
2:39.411 fel_rush Fluffy_Pillow 49.0/110: 45% fury prepared
2:39.785 chaos_strike Fluffy_Pillow 78.0/110: 71% fury momentum, prepared
2:41.232 chaos_strike Fluffy_Pillow 62.0/110: 56% fury momentum
2:42.678 demons_bite Fluffy_Pillow 22.0/110: 20% fury momentum
2:44.125 demons_bite Fluffy_Pillow 42.0/110: 38% fury
2:45.572 eye_beam Fluffy_Pillow 67.0/110: 61% fury
2:47.785 auto_attack Fluffy_Pillow 17.0/110: 15% fury
2:47.785 demons_bite Fluffy_Pillow 17.0/110: 15% fury
2:49.231 demons_bite Fluffy_Pillow 40.0/110: 36% fury
2:50.680 vengeful_retreat Fluffy_Pillow 63.0/110: 57% fury
2:50.680 throw_glaive Fluffy_Pillow 63.0/110: 57% fury momentum, prepared, vengeful_retreat_movement
2:52.126 chaos_strike Fluffy_Pillow 71.0/110: 65% fury momentum, prepared
2:53.575 fel_barrage Fluffy_Pillow 63.0/110: 57% fury momentum, prepared
2:55.318 fel_rush Fluffy_Pillow 79.0/110: 72% fury prepared
2:55.790 throw_glaive Fluffy_Pillow 108.0/110: 98% fury momentum
2:57.238 chaos_strike Fluffy_Pillow 108.0/110: 98% fury momentum
2:58.683 chaos_strike Fluffy_Pillow 68.0/110: 62% fury momentum
3:00.130 fel_rush Fluffy_Pillow 28.0/110: 25% fury
3:00.497 chaos_strike Fluffy_Pillow 53.0/110: 48% fury momentum
3:01.944 demons_bite Fluffy_Pillow 13.0/110: 12% fury momentum
3:03.389 throw_glaive Fluffy_Pillow 43.0/110: 39% fury momentum
3:04.836 fury_of_the_illidari Fluffy_Pillow 43.0/110: 39% fury
3:06.282 vengeful_retreat Fluffy_Pillow 43.0/110: 39% fury rage_of_the_illidari
3:06.282 chaos_strike Fluffy_Pillow 43.0/110: 39% fury momentum, prepared, rage_of_the_illidari, vengeful_retreat_movement
3:07.728 fel_barrage Fluffy_Pillow 31.0/110: 28% fury momentum, prepared, rage_of_the_illidari
3:09.378 auto_attack Fluffy_Pillow 47.0/110: 43% fury momentum, prepared
3:09.378 consume_magic Fluffy_Pillow 47.0/110: 43% fury momentum, prepared
3:09.378 chaos_strike Fluffy_Pillow 97.0/110: 88% fury momentum, prepared
3:10.826 fel_rush Fluffy_Pillow 69.0/110: 63% fury prepared
3:11.178 chaos_strike Fluffy_Pillow 94.0/110: 85% fury momentum, prepared
3:12.624 throw_glaive Fluffy_Pillow 58.0/110: 53% fury momentum
3:14.071 chaos_strike Fluffy_Pillow 58.0/110: 53% fury momentum
3:15.516 demons_bite Fluffy_Pillow 18.0/110: 16% fury
3:16.963 demons_bite Fluffy_Pillow 42.0/110: 38% fury
3:18.408 demons_bite Fluffy_Pillow 63.0/110: 57% fury
3:19.855 chaos_strike Fluffy_Pillow 90.0/110: 82% fury
3:21.301 vengeful_retreat Fluffy_Pillow 50.0/110: 45% fury
3:21.301 chaos_strike Fluffy_Pillow 50.0/110: 45% fury momentum, prepared, vengeful_retreat_movement
3:22.746 auto_attack Fluffy_Pillow 38.0/110: 35% fury momentum, prepared
3:22.746 throw_glaive Fluffy_Pillow 38.0/110: 35% fury momentum, prepared
3:24.192 chaos_strike Fluffy_Pillow 50.0/110: 45% fury momentum, prepared
3:25.639 fel_rush Fluffy_Pillow 22.0/110: 20% fury prepared
3:25.997 chaos_strike Fluffy_Pillow 51.0/110: 46% fury momentum, prepared
3:27.443 consume_magic Fluffy_Pillow 15.0/110: 14% fury momentum
3:27.443 chaos_strike Fluffy_Pillow 65.0/110: 59% fury momentum
3:28.890 chaos_strike Fluffy_Pillow 45.0/110: 41% fury momentum
3:30.336 fel_rush Fluffy_Pillow 25.0/110: 23% fury
3:30.756 eye_beam Fluffy_Pillow 50.0/110: 45% fury momentum
3:33.070 throw_glaive Fluffy_Pillow 0.0/110: 0% fury momentum
3:34.517 demons_bite Fluffy_Pillow 0.0/110: 0% fury
3:35.963 demons_bite Fluffy_Pillow 27.0/110: 25% fury
3:37.409 vengeful_retreat Fluffy_Pillow 55.0/110: 50% fury
3:37.409 chaos_strike Fluffy_Pillow 55.0/110: 50% fury momentum, prepared, vengeful_retreat_movement
3:38.856 demons_bite Fluffy_Pillow 23.0/110: 21% fury momentum, prepared
3:40.301 chaos_strike Fluffy_Pillow 55.0/110: 50% fury momentum, prepared
3:41.747 fel_rush Fluffy_Pillow 27.0/110: 25% fury prepared
3:42.144 throw_glaive Fluffy_Pillow 56.0/110: 51% fury momentum, prepared
3:43.589 chaos_strike Fluffy_Pillow 60.0/110: 55% fury momentum
3:45.038 demons_bite Fluffy_Pillow 20.0/110: 18% fury momentum
3:46.483 consume_magic Fluffy_Pillow 47.0/110: 43% fury
3:46.483 chaos_strike Fluffy_Pillow 97.0/110: 88% fury
3:47.929 demons_bite Fluffy_Pillow 57.0/110: 52% fury
3:49.375 demons_bite Fluffy_Pillow 77.0/110: 70% fury
3:50.821 chaos_strike Fluffy_Pillow 98.0/110: 89% fury
3:52.267 vengeful_retreat Fluffy_Pillow 58.0/110: 53% fury
3:52.409 throw_glaive Fluffy_Pillow 58.0/110: 53% fury momentum, prepared, vengeful_retreat_movement
3:53.857 chaos_strike Fluffy_Pillow 66.0/110: 60% fury momentum, prepared
3:55.302 chaos_strike Fluffy_Pillow 58.0/110: 53% fury momentum, prepared
3:56.747 fel_rush Fluffy_Pillow 30.0/110: 27% fury prepared
3:57.139 chaos_strike Fluffy_Pillow 59.0/110: 54% fury momentum, prepared
3:58.586 chaos_strike Fluffy_Pillow 43.0/110: 39% fury momentum
4:00.031 demons_bite Fluffy_Pillow 3.0/110: 3% fury momentum
4:01.477 fel_rush Fluffy_Pillow 31.0/110: 28% fury
4:01.905 throw_glaive Fluffy_Pillow 56.0/110: 51% fury momentum
4:03.350 demons_bite Fluffy_Pillow 56.0/110: 51% fury momentum
4:04.797 demons_bite Fluffy_Pillow 82.0/110: 75% fury momentum
4:06.241 metamorphosis Fluffy_Pillow 108.0/110: 98% fury
4:07.630 vengeful_retreat Fluffy_Pillow 108.0/110: 98% fury metamorphosis
4:07.630 potion Fluffy_Pillow 108.0/110: 98% fury metamorphosis, momentum, prepared, vengeful_retreat_movement
4:07.630 fury_of_the_illidari Fluffy_Pillow 108.0/110: 98% fury metamorphosis, momentum, prepared, vengeful_retreat_movement, potion_of_deadly_grace
4:08.788 consume_magic Fluffy_Pillow 110.0/110: 100% fury metamorphosis, momentum, out_of_range, prepared, rage_of_the_illidari, potion_of_deadly_grace
4:08.788 Waiting 0.100 sec 110.0/110: 100% fury metamorphosis, momentum, out_of_range, prepared, rage_of_the_illidari, potion_of_deadly_grace
4:08.888 annihilation Fluffy_Pillow 110.0/110: 100% fury metamorphosis, momentum, prepared, rage_of_the_illidari, potion_of_deadly_grace
4:10.045 fel_barrage Fluffy_Pillow 78.0/110: 71% fury metamorphosis, momentum, prepared, rage_of_the_illidari, potion_of_deadly_grace
4:11.344 auto_attack Fluffy_Pillow 90.0/110: 82% fury metamorphosis, momentum, prepared, potion_of_deadly_grace
4:11.344 annihilation Fluffy_Pillow 90.0/110: 82% fury metamorphosis, momentum, prepared, potion_of_deadly_grace
4:12.500 fel_rush Fluffy_Pillow 58.0/110: 53% fury metamorphosis, prepared, potion_of_deadly_grace
4:12.915 annihilation Fluffy_Pillow 87.0/110: 79% fury metamorphosis, momentum, potion_of_deadly_grace
4:14.073 annihilation Fluffy_Pillow 67.0/110: 61% fury metamorphosis, momentum, potion_of_deadly_grace
4:15.228 annihilation Fluffy_Pillow 47.0/110: 43% fury metamorphosis, momentum, potion_of_deadly_grace
4:16.386 throw_glaive Fluffy_Pillow 7.0/110: 6% fury metamorphosis, momentum, potion_of_deadly_grace
4:17.543 demons_bite Fluffy_Pillow 7.0/110: 6% fury metamorphosis, potion_of_deadly_grace
4:18.701 demons_bite Fluffy_Pillow 30.0/110: 27% fury metamorphosis, potion_of_deadly_grace
4:19.858 eye_beam Fluffy_Pillow 51.0/110: 46% fury metamorphosis, potion_of_deadly_grace
4:21.644 demons_bite Fluffy_Pillow 1.0/110: 1% fury metamorphosis, potion_of_deadly_grace
4:22.802 vengeful_retreat Fluffy_Pillow 25.0/110: 23% fury metamorphosis, potion_of_deadly_grace
4:22.802 throw_glaive Fluffy_Pillow 25.0/110: 23% fury metamorphosis, momentum, prepared, vengeful_retreat_movement, potion_of_deadly_grace
4:23.959 consume_magic Fluffy_Pillow 33.0/110: 30% fury metamorphosis, momentum, out_of_range, prepared, potion_of_deadly_grace
4:23.959 Waiting 0.100 sec 83.0/110: 75% fury metamorphosis, momentum, out_of_range, prepared, potion_of_deadly_grace
4:24.059 auto_attack Fluffy_Pillow 83.0/110: 75% fury metamorphosis, momentum, prepared, potion_of_deadly_grace
4:24.059 annihilation Fluffy_Pillow 83.0/110: 75% fury metamorphosis, momentum, prepared, potion_of_deadly_grace
4:25.217 annihilation Fluffy_Pillow 71.0/110: 65% fury metamorphosis, momentum, prepared, potion_of_deadly_grace
4:26.375 annihilation Fluffy_Pillow 63.0/110: 57% fury metamorphosis, momentum, prepared, potion_of_deadly_grace
4:27.531 fel_rush Fluffy_Pillow 51.0/110: 46% fury metamorphosis, prepared, potion_of_deadly_grace
4:27.996 annihilation Fluffy_Pillow 80.0/110: 73% fury metamorphosis, momentum, potion_of_deadly_grace
4:29.154 annihilation Fluffy_Pillow 60.0/110: 55% fury metamorphosis, momentum, potion_of_deadly_grace
4:30.313 annihilation Fluffy_Pillow 40.0/110: 36% fury metamorphosis, momentum, potion_of_deadly_grace
4:31.470 throw_glaive Fluffy_Pillow 20.0/110: 18% fury metamorphosis, momentum, potion_of_deadly_grace
4:32.628 fel_rush Fluffy_Pillow 20.0/110: 18% fury metamorphosis, potion_of_deadly_grace
4:33.000 annihilation Fluffy_Pillow 45.0/110: 41% fury metamorphosis, momentum
4:34.158 demons_bite Fluffy_Pillow 5.0/110: 5% fury metamorphosis, momentum
4:35.316 throw_glaive Fluffy_Pillow 35.0/110: 32% fury metamorphosis, momentum
4:36.473 demons_bite Fluffy_Pillow 35.0/110: 32% fury momentum
4:37.918 vengeful_retreat Fluffy_Pillow 55.0/110: 50% fury
4:37.918 chaos_strike Fluffy_Pillow 55.0/110: 50% fury momentum, prepared, vengeful_retreat_movement
4:39.364 auto_attack Fluffy_Pillow 43.0/110: 39% fury momentum, prepared
4:39.364 chaos_strike Fluffy_Pillow 43.0/110: 39% fury momentum, prepared
4:40.811 demons_bite Fluffy_Pillow 35.0/110: 32% fury momentum, prepared
4:42.258 fel_rush Fluffy_Pillow 77.0/110: 70% fury prepared
4:42.642 throw_glaive Fluffy_Pillow 106.0/110: 96% fury momentum, prepared
4:44.163 chaos_strike Fluffy_Pillow 110.0/110: 100% fury momentum
4:45.609 chaos_strike Fluffy_Pillow 70.0/110: 64% fury momentum
4:47.056 demons_bite Fluffy_Pillow 30.0/110: 27% fury
4:48.502 fel_rush Fluffy_Pillow 57.0/110: 52% fury
4:49.160 consume_magic Fluffy_Pillow 82.0/110: 75% fury momentum
4:49.160 chaos_strike Fluffy_Pillow 110.0/110: 100% fury momentum
4:50.606 throw_glaive Fluffy_Pillow 90.0/110: 82% fury momentum
4:52.052 chaos_strike Fluffy_Pillow 90.0/110: 82% fury momentum
4:53.500 vengeful_retreat Fluffy_Pillow 50.0/110: 45% fury
4:53.500 chaos_strike Fluffy_Pillow 50.0/110: 45% fury momentum, prepared, vengeful_retreat_movement
4:54.946 demons_bite Fluffy_Pillow 18.0/110: 16% fury momentum, prepared
4:56.392 chaos_strike Fluffy_Pillow 57.0/110: 52% fury momentum, prepared
4:57.839 demons_bite Fluffy_Pillow 29.0/110: 26% fury prepared
4:59.286 fel_rush Fluffy_Pillow 60.0/110: 55% fury
4:59.679 chaos_strike Fluffy_Pillow 85.0/110: 77% fury momentum
5:01.125 throw_glaive Fluffy_Pillow 45.0/110: 41% fury momentum
5:02.570 chaos_strike Fluffy_Pillow 45.0/110: 41% fury momentum
5:04.016 demons_bite Fluffy_Pillow 25.0/110: 23% fury
5:05.462 eye_beam Fluffy_Pillow 51.0/110: 46% fury
5:07.618 auto_attack Fluffy_Pillow 1.0/110: 1% fury
5:07.618 fury_of_the_illidari Fluffy_Pillow 1.0/110: 1% fury
5:09.076 vengeful_retreat Fluffy_Pillow 1.0/110: 1% fury rage_of_the_illidari
5:09.076 demons_bite Fluffy_Pillow 1.0/110: 1% fury momentum, prepared, rage_of_the_illidari, vengeful_retreat_movement
5:10.524 throw_glaive Fluffy_Pillow 30.0/110: 27% fury momentum, prepared, rage_of_the_illidari
5:11.970 chaos_strike Fluffy_Pillow 42.0/110: 38% fury momentum, prepared
5:13.418 fel_rush Fluffy_Pillow 14.0/110: 13% fury prepared
5:13.855 chaos_strike Fluffy_Pillow 43.0/110: 39% fury momentum, prepared
5:15.300 fel_barrage Fluffy_Pillow 7.0/110: 6% fury momentum
5:16.917 auto_attack Fluffy_Pillow 7.0/110: 6% fury momentum
5:16.917 demons_bite Fluffy_Pillow 7.0/110: 6% fury momentum
5:18.364 demons_bite Fluffy_Pillow 37.0/110: 34% fury
5:19.810 fel_rush Fluffy_Pillow 64.0/110: 58% fury
5:20.231 throw_glaive Fluffy_Pillow 89.0/110: 81% fury momentum
5:21.676 chaos_strike Fluffy_Pillow 89.0/110: 81% fury momentum
5:23.122 chaos_strike Fluffy_Pillow 69.0/110: 63% fury momentum
5:24.568 vengeful_retreat Fluffy_Pillow 29.0/110: 26% fury
5:24.568 demons_bite Fluffy_Pillow 29.0/110: 26% fury momentum, prepared, vengeful_retreat_movement
5:26.015 chaos_strike Fluffy_Pillow 64.0/110: 58% fury momentum, prepared
5:27.462 demons_bite Fluffy_Pillow 36.0/110: 33% fury momentum, prepared
5:28.906 fel_rush Fluffy_Pillow 75.0/110: 68% fury prepared
5:29.305 throw_glaive Fluffy_Pillow 104.0/110: 95% fury momentum, prepared
5:30.752 consume_magic Fluffy_Pillow 108.0/110: 98% fury momentum
5:30.752 chaos_strike Fluffy_Pillow 110.0/110: 100% fury momentum
5:32.199 chaos_strike Fluffy_Pillow 90.0/110: 82% fury momentum
5:33.645 demons_bite Fluffy_Pillow 70.0/110: 64% fury
5:35.090 chaos_strike Fluffy_Pillow 92.0/110: 84% fury
5:36.537 demons_bite Fluffy_Pillow 52.0/110: 47% fury
5:37.984 demons_bite Fluffy_Pillow 78.0/110: 71% fury
5:39.430 vengeful_retreat Fluffy_Pillow 104.0/110: 95% fury
5:39.568 throw_glaive Fluffy_Pillow 104.0/110: 95% fury momentum, prepared, vengeful_retreat_movement
5:41.015 chaos_strike Fluffy_Pillow 110.0/110: 100% fury momentum, prepared
5:42.462 chaos_strike Fluffy_Pillow 102.0/110: 93% fury momentum, prepared
5:43.906 chaos_strike Fluffy_Pillow 94.0/110: 85% fury prepared
5:45.353 fel_rush Fluffy_Pillow 82.0/110: 75% fury
5:45.705 fel_barrage Fluffy_Pillow 107.0/110: 97% fury momentum
5:47.469 chaos_strike Fluffy_Pillow 107.0/110: 97% fury momentum
5:48.915 throw_glaive Fluffy_Pillow 87.0/110: 79% fury momentum
5:50.362 eye_beam Fluffy_Pillow 87.0/110: 79% fury
5:52.732 demons_bite Fluffy_Pillow 37.0/110: 34% fury
5:54.179 demons_bite Fluffy_Pillow 57.0/110: 52% fury
5:55.626 vengeful_retreat Fluffy_Pillow 82.0/110: 75% fury
5:55.626 chaos_strike Fluffy_Pillow 82.0/110: 75% fury momentum, prepared, vengeful_retreat_movement
5:57.074 chaos_strike Fluffy_Pillow 50.0/110: 45% fury momentum, prepared
5:58.521 throw_glaive Fluffy_Pillow 22.0/110: 20% fury momentum, prepared
5:59.968 fel_rush Fluffy_Pillow 34.0/110: 31% fury prepared
6:00.373 chaos_strike Fluffy_Pillow 63.0/110: 57% fury momentum, prepared
6:01.818 chaos_strike Fluffy_Pillow 47.0/110: 43% fury momentum
6:03.265 demons_bite Fluffy_Pillow 7.0/110: 6% fury momentum
6:04.711 fel_rush Fluffy_Pillow 30.0/110: 27% fury
6:05.101 chaos_strike Fluffy_Pillow 55.0/110: 50% fury momentum
6:06.546 demons_bite Fluffy_Pillow 15.0/110: 14% fury momentum
6:07.991 fury_of_the_illidari Fluffy_Pillow 41.0/110: 37% fury momentum
6:09.437 demons_bite Fluffy_Pillow 41.0/110: 37% fury rage_of_the_illidari
6:10.882 vengeful_retreat Fluffy_Pillow 65.0/110: 59% fury rage_of_the_illidari
6:10.882 throw_glaive Fluffy_Pillow 65.0/110: 59% fury momentum, prepared, rage_of_the_illidari, vengeful_retreat_movement
6:12.330 chaos_strike Fluffy_Pillow 73.0/110: 66% fury momentum, prepared
6:13.778 chaos_strike Fluffy_Pillow 45.0/110: 41% fury momentum, prepared
6:15.224 consume_magic Fluffy_Pillow 37.0/110: 34% fury prepared
6:15.224 chaos_strike Fluffy_Pillow 87.0/110: 79% fury prepared
6:16.672 fel_rush Fluffy_Pillow 55.0/110: 50% fury
6:17.079 fel_barrage Fluffy_Pillow 80.0/110: 73% fury momentum
6:18.803 auto_attack Fluffy_Pillow 80.0/110: 73% fury momentum
6:18.803 throw_glaive Fluffy_Pillow 80.0/110: 73% fury momentum
6:20.249 chaos_strike Fluffy_Pillow 80.0/110: 73% fury momentum
6:21.696 fel_rush Fluffy_Pillow 60.0/110: 55% fury
6:22.106 chaos_strike Fluffy_Pillow 85.0/110: 77% fury momentum
6:23.553 chaos_strike Fluffy_Pillow 65.0/110: 59% fury momentum
6:25.000 chaos_strike Fluffy_Pillow 45.0/110: 41% fury momentum
6:26.445 vengeful_retreat Fluffy_Pillow 5.0/110: 5% fury
6:26.445 throw_glaive Fluffy_Pillow 5.0/110: 5% fury momentum, prepared, vengeful_retreat_movement
6:28.009 demons_bite Fluffy_Pillow 17.0/110: 15% fury momentum, prepared
6:29.457 chaos_strike Fluffy_Pillow 58.0/110: 53% fury momentum, prepared
6:30.903 fel_rush Fluffy_Pillow 26.0/110: 24% fury prepared
6:31.311 chaos_strike Fluffy_Pillow 55.0/110: 50% fury momentum, prepared
6:32.759 demons_bite Fluffy_Pillow 19.0/110: 17% fury momentum
6:34.206 chaos_strike Fluffy_Pillow 47.0/110: 43% fury momentum
6:35.653 demons_bite Fluffy_Pillow 7.0/110: 6% fury
6:37.100 demons_bite Fluffy_Pillow 35.0/110: 32% fury
6:38.546 eye_beam Fluffy_Pillow 58.0/110: 53% fury
6:40.591 auto_attack Fluffy_Pillow 8.0/110: 7% fury
6:40.591 demons_bite Fluffy_Pillow 8.0/110: 7% fury
6:42.038 vengeful_retreat Fluffy_Pillow 37.0/110: 34% fury
6:42.038 throw_glaive Fluffy_Pillow 37.0/110: 34% fury momentum, prepared, vengeful_retreat_movement
6:43.485 chaos_strike Fluffy_Pillow 45.0/110: 41% fury momentum, prepared
6:44.933 demons_bite Fluffy_Pillow 17.0/110: 15% fury momentum, prepared
6:46.379 fel_rush Fluffy_Pillow 55.0/110: 50% fury prepared
6:46.762 throw_glaive Fluffy_Pillow 84.0/110: 76% fury momentum, prepared
6:48.208 chaos_strike Fluffy_Pillow 88.0/110: 80% fury momentum
6:49.654 chaos_strike Fluffy_Pillow 48.0/110: 44% fury momentum
6:51.103 fel_rush Fluffy_Pillow 8.0/110: 7% fury
6:51.510 consume_magic Fluffy_Pillow 33.0/110: 30% fury momentum
6:51.510 chaos_strike Fluffy_Pillow 83.0/110: 75% fury momentum
6:52.957 chaos_strike Fluffy_Pillow 43.0/110: 39% fury momentum
6:54.403 demons_bite Fluffy_Pillow 3.0/110: 3% fury momentum
6:55.850 demons_bite Fluffy_Pillow 27.0/110: 25% fury
6:57.296 vengeful_retreat Fluffy_Pillow 53.0/110: 48% fury
6:57.296 throw_glaive Fluffy_Pillow 53.0/110: 48% fury momentum, prepared, vengeful_retreat_movement
6:58.743 chaos_strike Fluffy_Pillow 61.0/110: 55% fury momentum, prepared
7:00.188 fel_barrage Fluffy_Pillow 33.0/110: 30% fury momentum, prepared
7:01.778 auto_attack Fluffy_Pillow 45.0/110: 41% fury prepared
7:01.778 fel_rush Fluffy_Pillow 45.0/110: 41% fury prepared
7:02.133 chaos_strike Fluffy_Pillow 74.0/110: 67% fury momentum, prepared
7:03.579 chaos_strike Fluffy_Pillow 58.0/110: 53% fury momentum
7:05.025 throw_glaive Fluffy_Pillow 18.0/110: 16% fury momentum
7:06.472 demons_bite Fluffy_Pillow 18.0/110: 16% fury
7:07.918 fury_of_the_illidari Fluffy_Pillow 45.0/110: 41% fury
7:09.437 demons_bite Fluffy_Pillow 45.0/110: 41% fury rage_of_the_illidari
7:10.883 demons_bite Fluffy_Pillow 75.0/110: 68% fury rage_of_the_illidari
7:12.330 vengeful_retreat Fluffy_Pillow 96.0/110: 87% fury
7:12.330 chaos_strike Fluffy_Pillow 96.0/110: 87% fury momentum, prepared, vengeful_retreat_movement
7:13.775 chaos_strike Fluffy_Pillow 84.0/110: 76% fury momentum, prepared
7:15.222 throw_glaive Fluffy_Pillow 56.0/110: 51% fury momentum, prepared
7:16.669 fel_rush Fluffy_Pillow 68.0/110: 62% fury prepared
7:17.073 chaos_strike Fluffy_Pillow 97.0/110: 88% fury momentum, prepared
7:18.520 fel_barrage Fluffy_Pillow 81.0/110: 74% fury momentum
7:20.255 chaos_strike Fluffy_Pillow 81.0/110: 74% fury momentum
7:21.703 fel_rush Fluffy_Pillow 61.0/110: 55% fury
7:22.163 chaos_strike Fluffy_Pillow 86.0/110: 78% fury momentum
7:23.610 eye_beam Fluffy_Pillow 66.0/110: 60% fury momentum
7:25.762 auto_attack Fluffy_Pillow 16.0/110: 15% fury
7:25.762 demons_bite Fluffy_Pillow 16.0/110: 15% fury
7:27.209 vengeful_retreat Fluffy_Pillow 37.0/110: 34% fury
7:27.330 throw_glaive Fluffy_Pillow 37.0/110: 34% fury momentum, prepared, vengeful_retreat_movement

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 8802 8477 0
Agility 24327 22621 12511 (7693)
Stamina 29389 29389 18335
Intellect 5325 5000 0
Spirit 0 0 0
Health 1763340 1763340 0
Fury 110 110 0
Crit 45.59% 44.52% 9983
Haste 3.99% 3.99% 1298
Damage / Heal Versatility 2.25% 2.25% 898
Attack Power 24327 22621 0
Mastery 24.85% 24.85% 5899
Armor 1993 1993 1993
Run Speed 9 0 0

Gear

Source Slot Average Item Level: 847.00
Local Head Soulstarve Hood
ilevel: 845, stats: { 263 Armor, +1238 AgiInt, +1857 Sta, +777 Haste, +503 Crit }
Local Neck Rough-Hammered Silver Necklace
ilevel: 840, stats: { +997 Sta, +1163 Crit, +606 Mastery }
Local Shoulders Dreadleather Shoulderguard of the Peerless
ilevel: 850, stats: { 247 Armor, +1459 Sta, +973 AgiInt, +419 Crit, +559 Mastery }
Local Chest Biornskin Vest
ilevel: 840, stats: { 318 Armor, +1182 AgiInt, +1773 Sta, +817 Crit, +440 Mastery }
Local Waist Dreadleather Belt of the Peerless
ilevel: 850, stats: { 185 Armor, +1459 Sta, +973 AgiInt, +490 Crit, +490 Mastery }
Local Legs Breeches of the Shattered Abyss
ilevel: 840, stats: { 279 Armor, +1772 Sta, +1182 Agi, +736 Crit, +521 Haste }
Local Feet Shellshock Footguards
ilevel: 845, stats: { 223 Armor, +929 AgiInt, +1393 Sta, +563 Mastery, +398 Crit }, gems: { +150 Crit }
Local Wrists Dreadleather Bindings of the Peerless
ilevel: 850, stats: { 144 Armor, +1094 Sta, +729 AgiInt, +419 Crit, +314 Mastery }
Local Hands Dreadleather Gloves of the Peerless
ilevel: 850, stats: { 206 Armor, +1459 Sta, +973 AgiInt, +559 Crit, +419 Mastery }
Local Finger1 Val'kyr Ascension Signet
ilevel: 840, stats: { +997 Sta, +1061 Crit, +707 Mastery }, enchant: { +150 Crit }
Local Finger2 Prophetic Band of the Peerless
ilevel: 850, stats: { +1094 Sta, +1049 Crit, +786 Mastery }, gems: { +150 Crit }, enchant: { +150 Crit }
Local Trinket1 An'she's Token of Guile
ilevel: 840, stats: { +1123 Agi, +898 Vers }
Local Trinket2 Forest Creeper's Guile
ilevel: 835, stats: { +1073 Agi, +882 Crit }
Local Back Putrid Carapace
ilevel: 845, stats: { 128 Armor, +696 StrAgiInt, +1045 Sta, +437 Mastery, +283 Crit }, enchant: { +150 Agi }
Local Main Hand Twinblades of the Deceiver
ilevel: 866, weapon: { 3825 - 7105, 2.6 }, stats: { +645 Agi, +968 Sta, +302 Crit, +289 Mastery }, relics: { +43 ilevels, +37 ilevels, +36 ilevels }
Local Off Hand Twinblades of the Deceiver
ilevel: 866, weapon: { 3825 - 7105, 2.6 }, stats: { +645 Agi, +968 Sta, +302 Crit, +289 Mastery }

Talents

Level
15 Fel Mastery (Havoc Demon Hunter) Chaos Cleave (Havoc Demon Hunter) Blind Fury (Havoc Demon Hunter)
30 Prepared (Havoc Demon Hunter) Demon Blades (Havoc Demon Hunter) Demonic Appetite (Havoc Demon Hunter)
45 Felblade First Blood (Havoc Demon Hunter) Bloodlet (Havoc Demon Hunter)
60 Netherwalk (Havoc Demon Hunter) Desperate Instincts (Havoc Demon Hunter) Soul Rending (Havoc Demon Hunter)
75 Momentum (Havoc Demon Hunter) Fel Eruption (Havoc Demon Hunter) Nemesis (Havoc Demon Hunter)
90 Master of the Glaive (Havoc Demon Hunter) Unleashed Power (Havoc Demon Hunter) Demon Reborn (Havoc Demon Hunter)
100 Chaos Blades (Havoc Demon Hunter) Fel Barrage (Havoc Demon Hunter) Demonic (Havoc Demon Hunter)

Profile

demonhunter="Yåmm"
origin="https://eu.api.battle.net/wow/character/hyjal/Yåmm/advanced"
thumbnail="http://eu.battle.net/static-render/eu/hyjal/230/142092774-avatar.jpg"
level=110
race=night_elf
timeofday=day
role=attack
position=back
professions=leatherworking=780/skinning=800
talent_override=fel_barrage,if=desired_targets>1|raid_event.adds.exists
artifact=3:0:0:0:0:1001:3:1002:3:1003:3:1005:3:1006:3:1010:1:1012:1:1013:1:1015:1:1016:1:1330:1
spec=havoc

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=the_hungry_magister
actions.precombat+=/augmentation,type=defiled
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=deadly_grace

# Executed every time the actor is available.
actions=auto_attack
actions+=/pick_up_fragment,if=talent.demonic_appetite.enabled&fury.deficit>=30
actions+=/consume_magic
# Vengeful Retreat backwards through the target to minimize downtime.
actions+=/vengeful_retreat,if=(talent.prepared.enabled|talent.momentum.enabled)&buff.prepared.down&buff.momentum.down
# Fel Rush for Momentum and for fury from Fel Mastery.
actions+=/fel_rush,animation_cancel=1,if=(talent.momentum.enabled|talent.fel_mastery.enabled)&(!talent.momentum.enabled|(charges=2|cooldown.vengeful_retreat.remains>4)&buff.momentum.down)&(!talent.fel_mastery.enabled|fury.deficit>=25)&raid_event.movement.in>charges*10
actions+=/eye_beam,if=talent.demonic.enabled&buff.metamorphosis.down&(!talent.first_blood.enabled|fury>=80|fury.deficit<30)
# If Metamorphosis is ready, pool fury first before using it.
actions+=/demons_bite,sync=metamorphosis,if=fury.deficit>=25
actions+=/call_action_list,name=cooldown
actions+=/fury_of_the_illidari,if=active_enemies>desired_targets|raid_event.adds.in>55
# Use Death Sweep if it is more effective than Annihilation. See the Demon Hunter section of the wiki for how this is calculated.
actions+=/death_sweep,if=death_sweep_worth_using
actions+=/demons_bite,if=buff.metamorphosis.remains>gcd&cooldown.blade_dance.remains<gcd&fury<70&death_sweep_worth_using
# Use Blade Dance if it is more effective than Chaos Strike. See the Demon Hunter section of the wiki for how this is calculated.
actions+=/blade_dance,if=blade_dance_worth_using
# Use Fel Barrage at max charges, saving it for Momentum and adds if possible.
actions+=/fel_barrage,if=charges>=5&(buff.momentum.up|!talent.momentum.enabled)&(active_enemies>desired_targets|raid_event.adds.in>30)
actions+=/throw_glaive,if=talent.bloodlet.enabled&spell_targets>=2+talent.chaos_cleave.enabled&(!talent.master_of_the_glaive.enabled|!talent.momentum.enabled|buff.momentum.up)
actions+=/fel_eruption
actions+=/felblade,if=fury.deficit>=30+buff.prepared.up*8
actions+=/annihilation,if=!talent.momentum.enabled|buff.momentum.up|fury.deficit<=30+buff.prepared.up*8|buff.metamorphosis.remains<2
actions+=/throw_glaive,if=talent.bloodlet.enabled&(!talent.master_of_the_glaive.enabled|!talent.momentum.enabled|buff.momentum.up)
actions+=/eye_beam,if=!talent.demonic.enabled&(spell_targets.eye_beam_tick>desired_targets|(raid_event.adds.in>45&buff.metamorphosis.down&(artifact.anguish_of_the_deceiver.enabled|active_enemies>1|level=100)))
# Pool fury for various different upcoming abilities.
actions+=/demons_bite,if=buff.metamorphosis.down&cooldown.blade_dance.remains<gcd&fury<55&blade_dance_worth_using
actions+=/demons_bite,if=talent.demonic.enabled&buff.metamorphosis.down&cooldown.eye_beam.remains<gcd&fury.deficit>=20
actions+=/demons_bite,if=talent.demonic.enabled&buff.metamorphosis.down&cooldown.eye_beam.remains<2*gcd&fury.deficit>=45
actions+=/throw_glaive,if=buff.metamorphosis.down&spell_targets>=3
actions+=/chaos_strike,if=!talent.momentum.enabled|buff.momentum.up|fury.deficit<=30+buff.prepared.up*8
# Use Fel Barrage if its nearing max charges, saving it for Momentum and adds if possible.
actions+=/fel_barrage,if=charges=4&buff.metamorphosis.down&(buff.momentum.up|!talent.momentum.enabled)&(active_enemies>desired_targets|raid_event.adds.in>30)
actions+=/fel_rush,animation_cancel=1,if=!talent.momentum.enabled&raid_event.movement.in>charges*10
actions+=/demons_bite
actions+=/throw_glaive
actions+=/fel_rush,if=movement.distance>15|(buff.out_of_range.up&!talent.momentum.enabled)
actions+=/vengeful_retreat,if=movement.distance>15

actions.cooldown=nemesis,target_if=min:target.time_to_die,if=raid_event.adds.exists&debuff.nemesis.down&(active_enemies>desired_targets|raid_event.adds.in>60)
actions.cooldown+=/nemesis,if=!raid_event.adds.exists&(cooldown.metamorphosis.remains>100|target.time_to_die<70)
actions.cooldown+=/nemesis,sync=metamorphosis,if=!raid_event.adds.exists
actions.cooldown+=/chaos_blades,if=buff.metamorphosis.up|cooldown.metamorphosis.remains>100|target.time_to_die<20
# Use Metamorphosis if Nemesis and Chaos Blades are ready.
actions.cooldown+=/metamorphosis,if=buff.metamorphosis.down&(!talent.demonic.enabled|!cooldown.eye_beam.ready)&(!talent.chaos_blades.enabled|cooldown.chaos_blades.ready)&(!talent.nemesis.enabled|debuff.nemesis.up|cooldown.nemesis.ready)
actions.cooldown+=/potion,name=deadly_grace,if=buff.metamorphosis.remains>25

head=soulstarve_hood,id=134440,bonus_id=1727/1497/3336
neck=roughhammered_silver_necklace,id=134187,bonus_id=3432/1502/3336
shoulders=dreadleather_shoulderguard,id=128889,bonus_id=689/1687/3408/601/669
back=putrid_carapace,id=134408,bonus_id=1727/1497/3336,enchant=150agi
chest=biornskin_vest,id=134197,bonus_id=1727/1502/1813
wrists=dreadleather_bindings,id=128891,bonus_id=689/1685/3408/601/669
hands=dreadleather_gloves,id=128886,bonus_id=689/1685/3408/601/669
waist=dreadleather_belt,id=128890,bonus_id=689/1686/3408/600/669
legs=breeches_of_the_shattered_abyss,id=139719,bonus_id=3385/3384
feet=shellshock_footguards,id=134441,bonus_id=1727/1808/1497/3336,gems=150crit
finger1=valkyr_ascension_signet,id=133679,bonus_id=1727/1492/1813,enchant=150crit
finger2=prophetic_band,id=130229,bonus_id=3348/689/601/669,gems=150crit,enchant=150crit
trinket1=anshes_token_of_guile,id=139113,bonus_id=3397/607/1502/3336
trinket2=forest_creepers_guile,id=139075,bonus_id=3432/603/1497/1674
main_hand=twinblades_of_the_deceiver,id=127829,bonus_id=719,gem_id=141277/141254/142058/0,relic_id=3432:1512:3337/3397:1492:1675/0/0
off_hand=twinblades_of_the_deceiver,id=127830

# Gear Summary
# gear_ilvl=847.00
# gear_agility=12511
# gear_stamina=18335
# gear_crit_rating=9983
# gear_haste_rating=1298
# gear_mastery_rating=5899
# gear_versatility_rating=898
# gear_armor=1993

Kehål

Kehål : 88566 dps, 56846 dtps, 24146 hps (24146 aps), 75.6k TMI, 79.1k ETMI

  • Race: Night Elf
  • Class: Demonhunter
  • Spec: Vengeance
  • Level: 110
  • Role: Tank
  • Position: front

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR APS APS Error APS Range APR
88566.3 88566.3 31.2 / 0.035% 6209.3 / 7.0% 9409.3 24145.9 68.21 / 0.28% 4793 / 19.9% 0.0
DTPS DTPS Error DTPS Range   TMI TMI Error TMI Min TMI Max TMI Range   MSD Mean MSD Min MSD Max MSD Freq.   Window Bin Size
56846.2 39.33 / 0.07% 7789 / 13.7%       75.6k 49 / 0.06% 66.3k 84.8k 9.5k / 12.6%       47.0% 29.5% 67.7% 5.0       6.00s 0.50s
RPS Out RPS In Primary Resource Waiting APM Active Skill
9.4 9.4 Pain 0.00% 55.5 100.0% 100%
Origin https://eu.api.battle.net/wow/character/hyjal/Kehål/advanced
Artifact
Professions
  • leatherworking: 1
  • skinning: 242

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% B% Up%
Kehål 88566
auto_attack_mh 5911 6.7% 203.4 2.22sec 13085 5903 Direct 203.4 12366 24731 13085 24.8% 19.0% 6.1%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 203.39 203.39 0.00 0.00 2.2168 0.0000 2661283.60 4002915.40 33.52 5902.62 5902.62
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 105.58 51.91% 12651.71 12461 13630 12651.61 12569 12757 1335783 1963728 31.98
hit (blocked) 8.61 4.23% 8856.10 8723 9541 8853.48 0 9353 76215 160063 52.37
crit 46.70 22.96% 25303.48 24923 27261 25303.22 25041 25671 1181738 1737266 31.98
crit (blocked) 3.81 1.87% 17715.88 17446 19082 17315.93 0 19073 67547 141859 51.20
miss 38.68 19.02% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 2847 3.2% 196.0 2.30sec 6541 2841 Direct 196.0 6182 12362 6541 24.8% 19.0% 6.1%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 195.95 195.95 0.00 0.00 2.3019 0.0000 1281669.21 1927739.61 33.51 2841.42 2841.42
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 101.81 51.96% 6324.67 6231 6815 6324.53 6282 6370 643914 946614 31.98
hit (blocked) 8.27 4.22% 4426.68 4361 4771 4425.65 0 4703 36587 76838 52.37
crit 44.95 22.94% 12648.91 12461 13630 12648.72 12526 12815 568610 835910 31.98
crit (blocked) 3.68 1.88% 8855.67 8723 9541 8626.90 0 9537 32558 68377 51.03
miss 37.25 19.01% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Cleansing Flame 4438 5.0% 28.8 15.67sec 69446 0 Direct 28.8 69446 0 69446 0.0% 0.0% 0.0%  

Stats details: cleansing_flame

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.75 28.75 0.00 0.00 0.0000 0.0000 1996608.05 1996608.05 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.75 100.00% 69445.85 69446 69446 69445.85 69446 69446 1996608 1996608 0.00
 
 

Action details: cleansing_flame

Static Values
  • id:201408
  • school:holy
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:201408
  • name:Cleansing Flame
  • school:holy
  • tooltip:Damage against Demons increased by {$s2=10}%.
  • description:Deals {$s1=60162} damage. Increases damage against Demons by {$s2=10}%.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63030.38
  • base_dd_max:63030.38
 
Fiery Brand 6189 7.0% 8.0 60.42sec 348668 0 Direct 8.0 158256 316412 197481 24.8% 0.0% 0.0%  
Periodic 31.5 30702 61405 38300 24.7% 0.0% 0.0% 14.0%

Stats details: fiery_brand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.98 7.98 31.52 31.52 0.0000 2.0000 2783971.32 2783971.32 0.00 44164.08 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.00 75.20% 158255.76 155623 172079 158216.66 155623 163327 950183 950183 0.00
crit 1.98 24.80% 316412.29 311247 344339 283146.65 0 337005 626644 626644 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.7 75.26% 30701.52 30260 33477 30696.92 30260 31208 728226 728226 0.00
crit 7.8 24.74% 61405.21 60520 66726 61389.25 0 64712 478918 478918 0.00
 
 

Action details: fiery_brand

Static Values
  • id:204021
  • school:fire
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.demon_spikes.down&buff.metamorphosis.down
Spelldata
  • id:204021
  • name:Fiery Brand
  • school:fire
  • tooltip:Dealing {$s1=40}% less damage to the branding Demon Hunter.
  • description:Brand an enemy with a demonic symbol, instantly dealing $sw2 Fire damage and reducing the damage they do to you by {$s1=40}% for {$207744d=8 seconds}.
 
Immolation Aura 16647 18.8% 33.4 13.65sec 224408 187990 Direct 232.2 25869 51649 32271 24.8% 0.0% 0.0%  

Stats details: immolation_aura

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.40 232.23 0.00 0.00 1.1937 0.0000 7494419.29 7494419.29 0.00 187990.25 187990.25
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 174.56 75.17% 25868.83 16211 107744 25869.78 22050 28954 4515652 4515652 0.00
crit 57.67 24.83% 51648.86 32422 214332 51664.05 34996 74140 2978768 2978768 0.00
 
 

Action details: immolation_aura

Static Values
  • id:178740
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:pain<=80
Spelldata
  • id:178740
  • name:Immolation Aura
  • school:fire
  • tooltip:Burns nearby enemies for {$178741s1=0} Fire damage every $178740t1 sec.$?a207548[ Movement speed increased by $w4%.][]
  • description:Engulf yourself in flames, instantly causing {$187727s1=0} Fire damage to enemies within $187727A1 yards and radiating {$178741s1=0} Fire damage every sec. Lasts {$d=6 seconds}. |cFFFFFFFFGenerates ${{$s3=80}/10+{$178741s2=20}/10*{$d=6 seconds}} Pain over {$d=6 seconds}.|r
 
Infernal Strike 4824 (11021) 5.4% (12.4%) 23.8 19.70sec 208066 0 Direct 23.8 73054 145902 91194 24.9% 0.0% 0.0%  

Stats details: infernal_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.85 23.80 0.00 0.00 0.0000 0.0000 2170340.28 2170340.28 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.87 75.10% 73053.69 63547 98224 73069.27 66315 79529 1305714 1305714 0.00
crit 5.93 24.90% 145901.97 127095 196747 145775.02 0 191635 864626 864626 0.00
 
 

Action details: infernal_strike

Static Values
  • id:189110
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:1.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!sigil_placed&!in_flight&remains-travel_time-delay<0.3*duration&artifact.fiery_demise.enabled&dot.fiery_brand.ticking
Spelldata
  • id:189110
  • name:Infernal Strike
  • school:physical
  • tooltip:
  • description:Leap through the air toward a targeted location, dealing {$189112s1=1} Fire damage to all enemies within $189112a1 yards.
 
    Sigil of Flame (_dmg) 6197 7.0% 0.0 0.00sec 0 0 Direct 23.7 41082 82162 51298 24.9% 0.0% 0.0%  
Periodic 91.2 13843 27695 17289 24.9% 0.0% 0.0% 40.4%

Stats details: sigil_of_flame_dmg

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 23.70 91.16 91.16 0.0000 1.9939 2791876.57 2791876.57 0.00 15358.97 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.80 75.13% 41082.02 35664 55075 41084.40 37101 44611 731461 731461 0.00
crit 5.89 24.87% 82162.19 71327 109925 82068.31 0 106535 484233 484233 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 68.5 75.12% 13843.01 162 20045 13831.47 12705 14657 948011 948011 0.00
crit 22.7 24.88% 27694.94 324 40055 27671.36 23988 30968 628172 628172 0.00
 
 

Action details: sigil_of_flame_dmg

Static Values
  • id:204598
  • school:fire
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:204598
  • name:Sigil of Flame
  • school:fire
  • tooltip:Suffering {$s2=0} Fire damage every $t2 sec.
  • description:{$@spelldesc204596=Place a Sigil of Flame at the target location that activates after {$d=2 seconds}. Deals {$204598s1=0} Fire damage, and an additional $204598o2 Fire damage over {$204598d=6 seconds}, to all enemies affected by the sigil.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.600000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Shear 20336 23.0% 211.9 2.12sec 43202 32395 Direct 211.9 34602 69206 43203 24.9% 0.0% 7.5%  

Stats details: shear

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 211.90 211.90 0.00 0.00 1.3336 0.0000 9154445.11 13767563.18 33.51 32395.14 32395.14
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 147.28 69.51% 35399.15 34866 38103 35399.09 35198 35580 5213646 7664553 31.98
hit (blocked) 11.95 5.64% 24777.67 24406 26672 24778.53 24406 25714 296193 622045 52.38
crit 48.72 22.99% 70795.29 69732 76206 70794.86 69986 71792 3449305 5070804 31.98
crit (blocked) 3.94 1.86% 49554.02 48812 53344 48516.93 0 53341 195302 410161 51.29
 
 

Action details: shear

Static Values
  • id:203782
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:203782
  • name:Shear
  • school:physical
  • tooltip:
  • description:Shears an enemy for $sw2 Physical damage, and has a small chance to shatter a Lesser Soul Fragment from your target that heals you for {$203794s1=0} health when consumed. |cFFFFFFFFGenerates ${$m3/10} Pain.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.00
 
Sigil of Flame 3782 4.3% 15.1 30.76sec 112896 95095 Direct 15.0 37939 75925 47362 24.8% 0.0% 0.0%  
Periodic 58.9 13463 26933 16822 24.9% 0.0% 0.0% 25.8%

Stats details: sigil_of_flame

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.07 15.00 58.87 58.87 1.1873 1.9765 1700875.97 1700875.97 0.00 12670.51 95095.38
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.28 75.19% 37938.81 35664 54919 37961.58 35664 46363 427995 427995 0.00
crit 3.72 24.81% 75924.83 71327 109925 74879.57 0 105700 282578 282578 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 44.2 75.06% 13463.15 143 20086 13478.87 12510 15989 594872 594872 0.00
crit 14.7 24.94% 26932.78 298 39941 26963.41 18627 36312 395432 395432 0.00
 
 

Action details: sigil_of_flame

Static Values
  • id:204596
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains-delay<=0.3*duration
Spelldata
  • id:204596
  • name:Sigil of Flame
  • school:physical
  • tooltip:Sigil of Flame is active.
  • description:Place a Sigil of Flame at the target location that activates after {$d=2 seconds}. Deals {$204598s1=0} Fire damage, and an additional $204598o2 Fire damage over {$204598d=6 seconds}, to all enemies affected by the sigil.
 
Soul Carver 6997 7.9% 8.0 60.46sec 394764 287416 Direct 15.9 89186 178352 111503 25.0% 0.0% 7.5%  
Periodic 23.8 46124 92236 57550 24.8% 0.0% 0.0% 5.3%

Stats details: soul_carver

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.97 15.95 23.80 23.80 1.3735 1.0000 3147490.63 3147490.63 0.00 90580.48 287415.82
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.07 69.40% 89197.87 58599 127950 89173.69 59009 117955 987108 987108 0.00
hit (blocked) 0.89 5.57% 89037.47 58599 128009 53798.48 0 125613 79076 79076 0.00
crit 3.68 23.10% 178383.75 117199 255557 175242.29 0 251108 657073 657073 0.00
crit (blocked) 0.31 1.93% 177973.90 117199 251191 47139.68 0 251132 54683 54683 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.9 75.22% 46124.14 45392 50191 46112.74 45392 47049 825655 825655 0.00
crit 5.9 24.78% 92236.00 90783 100093 92071.25 0 98107 543896 543896 0.00
 
 

Action details: soul_carver

Static Values
  • id:207407
  • school:fire
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:40.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.fiery_brand.ticking
Spelldata
  • id:207407
  • name:Soul Carver
  • school:fire
  • tooltip:Suffering {$s1=1} Fire damage every $t sec.
  • description:Carve into the soul of your target, dealing ${$sw2+$214743sw1} Fire damage and an additional ${3*{$s1=1}} Fire damage over {$d=3 seconds}. Immediately shatters {$s4=2} Lesser Soul Fragments from the target and 1 additional Lesser Soul Fragment every $t sec.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:1.500000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:3.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:4.90
 
Soul Cleave 10398 11.7% 49.7 8.84sec 94249 70013 Direct 49.7 75541 151077 94248 24.8% 0.0% 7.5%  

Stats details: soul_cleave

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.70 49.70 0.00 0.00 1.3462 0.0000 4683787.42 7043641.95 33.50 70012.82 70012.82
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.60 69.63% 77267.49 38353 83826 77267.63 74180 78681 2673786 3930718 31.98
hit (blocked) 2.78 5.60% 54068.18 27330 58678 51039.41 0 58668 150491 316051 49.43
crit 11.38 22.90% 154573.55 76721 167652 154558.21 0 162192 1759175 2586154 31.97
crit (blocked) 0.93 1.87% 108168.09 55201 117351 65537.05 0 117346 100335 210718 31.73
 
 

Action details: soul_cleave

Static Values
  • id:228477
  • school:physical
  • resource:pain
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:30.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:soul_fragments=5
Spelldata
  • id:228477
  • name:Soul Cleave
  • school:physical
  • tooltip:
  • description:Viciously strike all enemies in front of you for up to $<cleaveDamage> Physical damage and heal yourself for up to $<cleaveHeal>, based on Pain spent. Consumes all Soul Fragments within {$s1=20} yds.
 
Simple Action Stats Execute Interval
Kehål
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kehål
  • harmful:false
  • if_expr:
 
Consume Soul (_lesser) 73.5 5.94sec

Stats details: consume_soul_lesser

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 73.48 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: consume_soul_lesser

Static Values
  • id:203794
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kehål
  • harmful:false
  • if_expr:
Spelldata
  • id:203794
  • name:Consume Soul
  • school:shadow
  • tooltip:
  • description:Consume a Lesser Soul Fragment, healing you for {$s1=0} health.
 
Demon Spikes 31.2 14.54sec

Stats details: demon_spikes

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.23 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: demon_spikes

Static Values
  • id:203720
  • school:physical
  • resource:pain
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=2|buff.demon_spikes.down&!dot.fiery_brand.ticking&buff.metamorphosis.down
Spelldata
  • id:203720
  • name:Demon Spikes
  • school:physical
  • tooltip:
  • description:Surge with fel power, increasing your Parry chance by {$203819s1=20}% and reducing Physical damage taken by {$203819s2=10}% for {$203819d=6 seconds}.
 
Empower Wards 12.6 37.08sec

Stats details: empower_wards

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.58 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: empower_wards

Static Values
  • id:218256
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.casting.up
Spelldata
  • id:218256
  • name:Empower Wards
  • school:fire
  • tooltip:Magical damage taken reduced by {$s1=30}%.
  • description:Reduces magical damage taken by {$s1=30}% for {$d=6 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kehål
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kehål
  • harmful:false
  • if_expr:
 
potion 1.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Soul Cleave (_heal) 49.7 8.84sec

Stats details: soul_cleave_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 49.70 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: soul_cleave_heal

Static Values
  • id:228477
  • school:physical
  • resource:pain
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kehål
  • harmful:false
  • if_expr:
Spelldata
  • id:228477
  • name:Soul Cleave
  • school:physical
  • tooltip:
  • description:Viciously strike all enemies in front of you for up to $<cleaveDamage> Physical damage and heal yourself for up to $<cleaveHeal>, based on Pain spent. Consumes all Soul Fragments within {$s1=20} yds.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 10.52% 0.0(0.0) 1.0

Buff details

  • buff initial source:Kehål
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Cleansing Flame 22.2 6.6 20.4sec 15.6sec 28.42% 28.47% 6.6(6.6) 21.9

Buff details

  • buff initial source:Kehål
  • cooldown name:buff_cleansing_flame
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • cleansing_flame_1:28.42%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201408
  • name:Cleansing Flame
  • tooltip:Damage against Demons increased by {$s2=10}%.
  • description:Deals {$s1=60162} damage. Increases damage against Demons by {$s2=10}%.
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Demon Spikes 31.2 0.0 14.5sec 14.5sec 41.35% 35.84% 0.0(0.0) 30.8

Buff details

  • buff initial source:Kehål
  • cooldown name:buff_demon_spikes
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • demon_spikes_1:41.35%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:203819
  • name:Demon Spikes
  • tooltip:Parry chance increased by $w1%. Physical damage taken reduced by ${-$W2}.2%.
  • description:{$@spelldesc203720=Surge with fel power, increasing your Parry chance by {$203819s1=20}% and reducing Physical damage taken by {$203819s2=10}% for {$203819d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Empower Wards 12.6 0.0 37.1sec 37.1sec 16.66% 16.17% 0.0(0.0) 12.4

Buff details

  • buff initial source:Kehål
  • cooldown name:buff_empower_wards
  • max_stacks:1
  • duration:6.00
  • cooldown:20.00
  • default_chance:100.00%
  • default_value:-0.30

Stack Uptimes

  • empower_wards_1:16.66%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:218256
  • name:Empower Wards
  • tooltip:Magical damage taken reduced by {$s1=30}%.
  • description:Reduces magical damage taken by {$s1=30}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:20.00
  • default_chance:100.00%
Immolation Aura 33.4 0.0 13.6sec 13.6sec 44.21% 44.24% 198.8(198.8) 33.0

Buff details

  • buff initial source:Kehål
  • cooldown name:buff_immolation_aura
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30

Stack Uptimes

  • immolation_aura_1:44.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:178740
  • name:Immolation Aura
  • tooltip:Burns nearby enemies for {$178741s1=0} Fire damage every $178740t1 sec.$?a207548[ Movement speed increased by $w4%.][]
  • description:Engulf yourself in flames, instantly causing {$187727s1=0} Fire damage to enemies within $187727A1 yards and radiating {$178741s1=0} Fire damage every sec. Lasts {$d=6 seconds}. |cFFFFFFFFGenerates ${{$s3=80}/10+{$178741s2=20}/10*{$d=6 seconds}} Pain over {$d=6 seconds}.|r
  • max_stacks:0
  • duration:6.00
  • cooldown:15.00
  • default_chance:0.00%
Metamorphosis 7.7 0.4 53.2sec 50.6sec 8.89% 8.94% 40.0(40.0) 7.6

Buff details

  • buff initial source:Kehål
  • cooldown name:buff_metamorphosis
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30

Stack Uptimes

  • metamorphosis_1:8.89%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187827
  • name:Metamorphosis
  • tooltip:Maximum health increased by {$s2=30}%. Generating ${{$s4=70}/10} Pain every $t4 sec.
  • description:Transform to demon form for {$d=15 seconds}, increasing current and maximum health by {$s2=30}%. |cFFFFFFFFGenerates ${{$s4=70}/10} Pain every $t4 sec.|r
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Siphoned Power 12.5 9.4 37.0sec 20.4sec 30.95% 31.00% 0.0(0.0) 12.2

Buff details

  • buff initial source:Kehål
  • cooldown name:buff_siphoned_power
  • max_stacks:15
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • siphoned_power_1:0.24%
  • siphoned_power_2:1.88%
  • siphoned_power_3:1.11%
  • siphoned_power_4:9.23%
  • siphoned_power_5:9.83%
  • siphoned_power_6:1.91%
  • siphoned_power_7:3.92%
  • siphoned_power_8:1.45%
  • siphoned_power_9:0.49%
  • siphoned_power_10:0.91%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:218561
  • name:Siphoned Power
  • tooltip:Agility increased by $w1%.
  • description:{$@spelldesc218256=Reduces magical damage taken by {$s1=30}% for {$d=6 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Soul Barrier 21.8 0.0 20.9sec 20.9sec 38.29% 84.78% 0.0(0.0) 21.4

Buff details

  • buff initial source:Kehål
  • cooldown name:buff_soul_barrier
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1500.00

Stack Uptimes

  • soul_barrier_1:38.29%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:227225
  • name:Soul Barrier
  • tooltip:Absorbs $w1 damage. Cannot be reduced below ${{$s3=200}/100*$AP*$pctH}.
  • description:Shield yourself for {$d=8 seconds}, absorbing ${{$s1=1500}/100*$AP*$pctH} damage. Consuming a Soul Fragment adds ${{$s2=250}/100*$AP*$pctH} to the shield. Soul Barrier's absorption cannot be reduced below ${{$s3=200}/100*$AP*$pctH}. Consumes all Soul Fragments within 20 yds.
  • max_stacks:0
  • duration:8.00
  • cooldown:20.00
  • default_chance:0.00%
Unbending Potion 1.0 0.0 0.0sec 0.0sec 5.19% 5.26% 0.0(0.0) 1.0

Buff details

  • buff initial source:Kehål
  • cooldown name:buff_unbending_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:bonus_armor
  • amount:3500.00

Stack Uptimes

  • unbending_potion_1:5.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188029
  • name:Unbending Potion
  • tooltip:Armor increased by {$s1=3500}.
  • description:Increases your bonus armor by {$s1=3500} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Kehål
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Kehål
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (the_hungry_magister)

Buff details

  • buff initial source:Kehål
  • cooldown name:buff_the_hungry_magister
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:375.00

Stack Uptimes

  • the_hungry_magister_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225602
  • name:Well Fed
  • tooltip:Critical Strike increased by $w1.
  • description:Increases critical strike by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Kehål
demon_spikes Pain 31.2 624.6 20.0 20.0 0.0
soul_barrier Pain 21.8 652.5 30.0 30.0 16650.5
soul_cleave Pain 49.7 2959.8 59.6 59.6 1582.4
Resource Gains Type Count Total Average Overflow
damage_taken Pain 314.18 1231.73 (28.73%) 3.92 2.99 0.24%
immolation_aura Pain 33.40 267.17 (6.23%) 8.00 0.00 0.00%
metamorphosis Pain 39.65 272.90 (6.36%) 6.88 4.63 1.67%
soul_barrier Health 121.23 10864656.03 (100.00%) 89623.86 0.00 0.00%
immolation_aura_tick Pain 198.84 397.01 (9.26%) 2.00 0.66 0.17%
shear Pain 211.90 2118.99 (49.42%) 10.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Health 45080.71 56859.06
Pain 9.52 9.41
Combat End Resource Mean Min Max
Pain 51.75 0.00 100.00

Benefits & Uptimes

Benefits %
Uptimes %
Pain Cap 0.2%

Procs

Count Interval
parry_haste 25.4 17.2sec
soul_fragment_lesser 107.2 4.5sec
fueled_by_pain 8.1 50.6sec
soul_fragment_overflow 2.6 111.6sec

Statistics & Data Analysis

Fight Length
Sample Data Kehål Fight Length
Count 9999
Mean 450.42
Minimum 350.15
Maximum 555.44
Spread ( max - min ) 205.29
Range [ ( max - min ) / 2 * 100% ] 22.79%
DPS
Sample Data Kehål Damage Per Second
Count 9999
Mean 88566.28
Minimum 82519.08
Maximum 96183.23
Spread ( max - min ) 13664.16
Range [ ( max - min ) / 2 * 100% ] 7.71%
Standard Deviation 1589.5059
5th Percentile 86009.92
95th Percentile 91270.22
( 95th Percentile - 5th Percentile ) 5260.30
Mean Distribution
Standard Deviation 15.8959
95.00% Confidence Intervall ( 88535.13 - 88597.44 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 12
0.1% Error 1237
0.1 Scale Factor Error with Delta=300 21567
0.05 Scale Factor Error with Delta=300 86271
0.01 Scale Factor Error with Delta=300 2156790
Priority Target DPS
Sample Data Kehål Priority Target Damage Per Second
Count 9999
Mean 88566.28
Minimum 82519.08
Maximum 96183.23
Spread ( max - min ) 13664.16
Range [ ( max - min ) / 2 * 100% ] 7.71%
Standard Deviation 1589.5059
5th Percentile 86009.92
95th Percentile 91270.22
( 95th Percentile - 5th Percentile ) 5260.30
Mean Distribution
Standard Deviation 15.8959
95.00% Confidence Intervall ( 88535.13 - 88597.44 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 12
0.1% Error 1237
0.1 Scale Factor Error with Delta=300 21567
0.05 Scale Factor Error with Delta=300 86271
0.01 Scale Factor Error with Delta=300 2156790
DPS(e)
Sample Data Kehål Damage Per Second (Effective)
Count 9999
Mean 88566.28
Minimum 82519.08
Maximum 96183.23
Spread ( max - min ) 13664.16
Range [ ( max - min ) / 2 * 100% ] 7.71%
Damage
Sample Data Kehål Damage
Count 9999
Mean 39866767.45
Minimum 30099665.67
Maximum 50700705.08
Spread ( max - min ) 20601039.40
Range [ ( max - min ) / 2 * 100% ] 25.84%
DTPS
Sample Data Kehål Damage Taken Per Second
Count 9999
Mean 56846.18
Minimum 47489.84
Maximum 64055.83
Spread ( max - min ) 16565.99
Range [ ( max - min ) / 2 * 100% ] 14.57%
Standard Deviation 2006.5139
5th Percentile 53456.20
95th Percentile 60124.88
( 95th Percentile - 5th Percentile ) 6668.68
Mean Distribution
Standard Deviation 20.0661
95.00% Confidence Intervall ( 56806.85 - 56885.51 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 47
0.1% Error 4786
0.1 Scale Factor Error with Delta=300 34369
0.05 Scale Factor Error with Delta=300 137476
0.01 Scale Factor Error with Delta=300 3436908
HPS
Sample Data Kehål Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Kehål Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Kehål Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Kehål Healing Taken Per Second
Count 9999
Mean 37096.04
Minimum 31896.28
Maximum 44433.60
Spread ( max - min ) 12537.32
Range [ ( max - min ) / 2 * 100% ] 16.90%
TMI
Sample Data Kehål Theck-Meloree Index
Count 9999
Mean 75642.68
Minimum 66307.96
Maximum 84801.60
Spread ( max - min ) 18493.64
Range [ ( max - min ) / 2 * 100% ] 12.22%
Standard Deviation 2507.3820
5th Percentile 71420.80
95th Percentile 79641.26
( 95th Percentile - 5th Percentile ) 8220.46
Mean Distribution
Standard Deviation 25.0751
95.00% Confidence Intervall ( 75593.53 - 75691.82 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 42
0.1% Error 4220
0.1 Scale Factor Error with Delta=300 53669
0.05 Scale Factor Error with Delta=300 214676
0.01 Scale Factor Error with Delta=300 5366914
ETMI
Sample Data KehålTheck-Meloree Index (Effective)
Count 9999
Mean 79080.41
Minimum 73765.36
Maximum 84548.13
Spread ( max - min ) 10782.77
Range [ ( max - min ) / 2 * 100% ] 6.82%
Standard Deviation 1427.7055
5th Percentile 76766.03
95th Percentile 81421.10
( 95th Percentile - 5th Percentile ) 4655.07
Mean Distribution
Standard Deviation 14.2778
95.00% Confidence Intervall ( 79052.43 - 79108.40 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 12
0.1% Error 1252
0.1 Scale Factor Error with Delta=300 17400
0.05 Scale Factor Error with Delta=300 69601
0.01 Scale Factor Error with Delta=300 1740046
MSD
Sample Data Kehål Max Spike Value
Count 1247
Mean 46.99
Minimum 29.52
Maximum 67.71
Spread ( max - min ) 38.19
Range [ ( max - min ) / 2 * 100% ] 40.64%
Standard Deviation 6.1632
5th Percentile 37.49
95th Percentile 57.95
( 95th Percentile - 5th Percentile ) 20.46
Mean Distribution
Standard Deviation 0.1745
95.00% Confidence Intervall ( 46.65 - 47.33 )
Normalized 95.00% Confidence Intervall ( 99.27% - 100.73% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 660
0.1% Error 66080
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 1
0.01 Scale Factor Error with Delta=300 32

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=the_hungry_magister
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=unbending_potion
Default action list Executed every time the actor is available.
# count action,conditions
5 1.00 auto_attack
6 7.98 fiery_brand,if=buff.demon_spikes.down&buff.metamorphosis.down
7 31.23 demon_spikes,if=charges=2|buff.demon_spikes.down&!dot.fiery_brand.ticking&buff.metamorphosis.down
8 12.58 empower_wards,if=debuff.casting.up
9 7.66 infernal_strike,if=!sigil_placed&!in_flight&remains-travel_time-delay<0.3*duration&artifact.fiery_demise.enabled&dot.fiery_brand.ticking
A 16.19 infernal_strike,if=!sigil_placed&!in_flight&remains-travel_time-delay<0.3*duration&(!artifact.fiery_demise.enabled|(max_charges-charges_fractional)*recharge_time<cooldown.fiery_brand.remains+5)&(cooldown.sigil_of_flame.remains>7|charges=2)
0.00 spirit_bomb,if=debuff.frailty.down
B 7.97 soul_carver,if=dot.fiery_brand.ticking
C 33.40 immolation_aura,if=pain<=80
0.00 felblade,if=pain<=70
D 21.75 soul_barrier
E 7.17 soul_cleave,if=soul_fragments=5
0.00 metamorphosis,if=buff.demon_spikes.down&!dot.fiery_brand.ticking&buff.metamorphosis.down&incoming_damage_5s>health.max*0.70
0.00 fel_devastation,if=incoming_damage_5s>health.max*0.70
0.00 soul_cleave,if=incoming_damage_5s>=health.max*0.70
0.00 fel_eruption
F 15.07 sigil_of_flame,if=remains-delay<=0.3*duration
0.00 fracture,if=pain>=80&soul_fragments<4&incoming_damage_4s<=health.max*0.20
G 42.52 soul_cleave,if=pain>=80
H 211.90 shear

Sample Sequence

0124569BC8FH7HHDHH7AHHHCHHGHH7HHAHGHCHGDHHHHF7HHGCHHHAG8HHGHD7HCHHHGHHH69BGCHHD7FHHHHGC87HHAHHGHHDHGCH7HGHFHHGAHCH7DHHGH8HHGC69BHHEHH7DFHCHHH7HHAGHHHGCDHH87HHHGHFCHHAGH7HDHHHCHGH69BHEHHH7C8DFHHHH7HGAHCHGHHGDH7HHCHHGFHHH8AG7HCDHHHHHG69BHCEHH78HHDFHHC7HAHGHHHGHHCD7HHHHGHHFCHG7AH8HHDHHHGC69BHHEHH7HHHCDFGH7HAHHHGCHH8GH7HDHHHCGHHFH7HHAGHCDHH69BGHHHECHH87HGHDF7HHCAHHGHHHG7HHCDHHHHHGH7FCH8HAHGHDH6B9HCEHHG7HHHHHG7CFHDHAHHH

Sample Sequence Table

time name target resources buffs
Pre flask Kehål 0.0/100: 0% pain
Pre food Kehål 0.0/100: 0% pain
Pre augmentation Kehål 0.0/100: 0% pain
Pre potion Fluffy_Pillow 0.0/100: 0% pain unbending_potion
0:00.000 auto_attack Fluffy_Pillow 0.0/100: 0% pain unbending_potion
0:00.000 fiery_brand Fluffy_Pillow 0.0/100: 0% pain unbending_potion
0:00.000 infernal_strike Fluffy_Pillow 0.0/100: 0% pain unbending_potion
0:00.000 soul_carver Fluffy_Pillow 0.0/100: 0% pain unbending_potion
0:01.374 immolation_aura Fluffy_Pillow 0.0/100: 0% pain bloodlust, cleansing_flame, unbending_potion
0:02.074 empower_wards Fluffy_Pillow 8.0/100: 8% pain bloodlust, empower_wards, immolation_aura, cleansing_flame, unbending_potion
0:02.130 sigil_of_flame Fluffy_Pillow 8.0/100: 8% pain bloodlust, empower_wards, immolation_aura, cleansing_flame, unbending_potion
0:02.885 shear Fluffy_Pillow 10.0/100: 10% pain bloodlust, empower_wards, immolation_aura, cleansing_flame, unbending_potion
0:02.885 demon_spikes Fluffy_Pillow 0.0/100: 0% pain bloodlust, demon_spikes, empower_wards, immolation_aura, cleansing_flame, unbending_potion
0:03.943 shear Fluffy_Pillow 2.0/100: 2% pain bloodlust, demon_spikes, empower_wards, immolation_aura, cleansing_flame, unbending_potion
0:05.001 shear Fluffy_Pillow 16.6/100: 17% pain bloodlust, demon_spikes, empower_wards, immolation_aura, siphoned_power, unbending_potion
0:06.059 soul_barrier Kehål 32.6/100: 33% pain bloodlust, demon_spikes, empower_wards, immolation_aura, siphoned_power(4), unbending_potion
0:07.118 shear Fluffy_Pillow 7.8/100: 8% pain bloodlust, demon_spikes, empower_wards, immolation_aura, siphoned_power(6), soul_barrier, unbending_potion
0:08.175 shear Fluffy_Pillow 22.8/100: 23% pain bloodlust, demon_spikes, siphoned_power(6), soul_barrier, unbending_potion
0:08.918 demon_spikes Fluffy_Pillow 12.8/100: 13% pain bloodlust, demon_spikes, siphoned_power(6), soul_barrier, unbending_potion
0:09.234 infernal_strike Fluffy_Pillow 14.6/100: 15% pain bloodlust, demon_spikes, siphoned_power(6), soul_barrier, unbending_potion
0:09.234 shear Fluffy_Pillow 14.6/100: 15% pain bloodlust, demon_spikes, siphoned_power(6), soul_barrier, unbending_potion
0:10.292 shear Fluffy_Pillow 27.9/100: 28% pain bloodlust, demon_spikes, siphoned_power(6), soul_barrier, unbending_potion
0:11.348 shear Fluffy_Pillow 39.7/100: 40% pain bloodlust, demon_spikes, siphoned_power(6), soul_barrier, unbending_potion
0:12.407 immolation_aura Fluffy_Pillow 53.3/100: 53% pain bloodlust, demon_spikes, siphoned_power(6), soul_barrier, unbending_potion
0:13.161 shear Fluffy_Pillow 63.1/100: 63% pain bloodlust, demon_spikes, immolation_aura, siphoned_power(6), soul_barrier, unbending_potion
0:14.218 shear Fluffy_Pillow 78.4/100: 78% pain bloodlust, demon_spikes, immolation_aura, siphoned_power(6), unbending_potion
0:15.274 soul_cleave Fluffy_Pillow 92.2/100: 92% pain bloodlust, immolation_aura, siphoned_power(6), unbending_potion
0:16.331 shear Fluffy_Pillow 38.9/100: 39% pain bloodlust, immolation_aura, siphoned_power(6), cleansing_flame, unbending_potion
0:17.388 shear Fluffy_Pillow 52.7/100: 53% pain bloodlust, immolation_aura, cleansing_flame, unbending_potion
0:17.886 demon_spikes Fluffy_Pillow 44.7/100: 45% pain bloodlust, demon_spikes, immolation_aura, cleansing_flame, unbending_potion
0:18.445 shear Fluffy_Pillow 46.7/100: 47% pain bloodlust, demon_spikes, cleansing_flame, unbending_potion
0:19.503 shear Fluffy_Pillow 58.5/100: 59% pain bloodlust, demon_spikes, cleansing_flame, unbending_potion
0:20.561 infernal_strike Fluffy_Pillow 68.5/100: 69% pain bloodlust, demon_spikes, unbending_potion
0:20.561 shear Fluffy_Pillow 68.5/100: 69% pain bloodlust, demon_spikes, unbending_potion
0:21.620 soul_cleave Fluffy_Pillow 80.4/100: 80% pain bloodlust, demon_spikes, unbending_potion
0:22.676 shear Fluffy_Pillow 30.4/100: 30% pain bloodlust, metamorphosis, demon_spikes, cleansing_flame, unbending_potion
0:23.732 immolation_aura Fluffy_Pillow 49.2/100: 49% pain bloodlust, metamorphosis, demon_spikes, cleansing_flame
0:24.487 shear Fluffy_Pillow 63.5/100: 64% pain bloodlust, metamorphosis, immolation_aura, cleansing_flame
0:25.544 soul_cleave Fluffy_Pillow 82.5/100: 83% pain bloodlust, metamorphosis, immolation_aura, cleansing_flame
0:26.601 soul_barrier Kehål 37.2/100: 37% pain bloodlust, metamorphosis, immolation_aura, cleansing_flame
0:27.657 shear Fluffy_Pillow 16.2/100: 16% pain bloodlust, immolation_aura, soul_barrier
0:28.714 shear Fluffy_Pillow 34.5/100: 34% pain bloodlust, immolation_aura, soul_barrier
0:29.769 shear Fluffy_Pillow 48.5/100: 48% pain bloodlust, soul_barrier
0:30.827 shear Fluffy_Pillow 64.9/100: 65% pain bloodlust, soul_barrier
0:31.886 sigil_of_flame Fluffy_Pillow 74.9/100: 75% pain bloodlust, soul_barrier
0:32.886 demon_spikes Fluffy_Pillow 81.7/100: 82% pain bloodlust, soul_barrier
0:32.886 shear Fluffy_Pillow 61.7/100: 62% pain bloodlust, demon_spikes, soul_barrier
0:33.943 shear Fluffy_Pillow 71.7/100: 72% pain bloodlust, demon_spikes, soul_barrier
0:35.000 soul_cleave Fluffy_Pillow 86.4/100: 86% pain bloodlust, demon_spikes
0:36.059 immolation_aura Fluffy_Pillow 35.7/100: 36% pain bloodlust, demon_spikes
0:36.814 shear Fluffy_Pillow 43.7/100: 44% pain bloodlust, demon_spikes, immolation_aura
0:37.870 shear Fluffy_Pillow 55.7/100: 56% pain bloodlust, demon_spikes, immolation_aura
0:38.928 shear Fluffy_Pillow 67.7/100: 68% pain bloodlust, immolation_aura
0:39.985 infernal_strike Fluffy_Pillow 79.7/100: 80% pain bloodlust, immolation_aura
0:40.001 soul_cleave Fluffy_Pillow 86.1/100: 86% pain bloodlust, immolation_aura
0:40.101 empower_wards Fluffy_Pillow 28.1/100: 28% pain bloodlust, metamorphosis, empower_wards, immolation_aura
0:41.059 shear Fluffy_Pillow 35.1/100: 35% pain metamorphosis, empower_wards, immolation_aura
0:42.432 shear Fluffy_Pillow 65.7/100: 66% pain metamorphosis, empower_wards, siphoned_power(4)
0:43.805 soul_cleave Fluffy_Pillow 82.7/100: 83% pain metamorphosis, empower_wards, siphoned_power(4)
0:45.178 shear Fluffy_Pillow 43.1/100: 43% pain empower_wards, siphoned_power(4)
0:46.552 soul_barrier Kehål 60.1/100: 60% pain siphoned_power(6)
0:47.886 demon_spikes Fluffy_Pillow 10.1/100: 10% pain demon_spikes, siphoned_power(6), soul_barrier
0:47.974 shear Fluffy_Pillow 10.1/100: 10% pain demon_spikes, siphoned_power(6), soul_barrier
0:49.347 immolation_aura Fluffy_Pillow 26.7/100: 27% pain demon_spikes, siphoned_power(6), soul_barrier
0:50.601 shear Fluffy_Pillow 42.4/100: 42% pain demon_spikes, immolation_aura, siphoned_power(6), soul_barrier
0:51.973 shear Fluffy_Pillow 54.4/100: 54% pain demon_spikes, immolation_aura, siphoned_power(6), soul_barrier
0:53.347 shear Fluffy_Pillow 72.2/100: 72% pain demon_spikes, immolation_aura, siphoned_power(6), soul_barrier
0:54.722 soul_cleave Fluffy_Pillow 94.8/100: 95% pain immolation_aura, siphoned_power(6)
0:56.095 shear Fluffy_Pillow 44.4/100: 44% pain
0:57.469 shear Fluffy_Pillow 54.4/100: 54% pain
0:58.844 shear Fluffy_Pillow 71.9/100: 72% pain
1:00.000 fiery_brand Fluffy_Pillow 88.4/100: 88% pain
1:00.218 infernal_strike Fluffy_Pillow 89.5/100: 89% pain
1:00.218 soul_carver Fluffy_Pillow 89.5/100: 89% pain
1:01.591 soul_cleave Fluffy_Pillow 89.5/100: 89% pain
1:02.964 immolation_aura Fluffy_Pillow 34.6/100: 35% pain
1:04.292 shear Fluffy_Pillow 49.7/100: 50% pain immolation_aura
1:05.668 shear Fluffy_Pillow 66.3/100: 66% pain immolation_aura
1:07.042 soul_barrier Kehål 84.0/100: 84% pain immolation_aura
1:08.042 demon_spikes Fluffy_Pillow 36.0/100: 36% pain demon_spikes, immolation_aura, soul_barrier
1:08.416 sigil_of_flame Fluffy_Pillow 36.0/100: 36% pain demon_spikes, immolation_aura, soul_barrier
1:09.669 shear Fluffy_Pillow 38.0/100: 38% pain demon_spikes, soul_barrier
1:11.042 shear Fluffy_Pillow 52.3/100: 52% pain demon_spikes, soul_barrier
1:12.414 shear Fluffy_Pillow 62.3/100: 62% pain demon_spikes, soul_barrier
1:13.786 shear Fluffy_Pillow 72.3/100: 72% pain demon_spikes, soul_barrier
1:15.159 soul_cleave Fluffy_Pillow 86.9/100: 87% pain
1:16.534 immolation_aura Fluffy_Pillow 33.5/100: 33% pain
1:17.129 empower_wards Fluffy_Pillow 41.5/100: 41% pain empower_wards, immolation_aura, cleansing_flame
1:17.886 demon_spikes Fluffy_Pillow 23.5/100: 23% pain demon_spikes, empower_wards, immolation_aura, cleansing_flame
1:17.984 shear Fluffy_Pillow 23.5/100: 23% pain demon_spikes, empower_wards, immolation_aura, cleansing_flame
1:19.357 shear Fluffy_Pillow 42.5/100: 43% pain demon_spikes, empower_wards, immolation_aura, siphoned_power(5), cleansing_flame
1:20.729 infernal_strike Fluffy_Pillow 58.8/100: 59% pain demon_spikes, empower_wards, immolation_aura, siphoned_power(5), cleansing_flame
1:20.729 shear Fluffy_Pillow 60.8/100: 61% pain demon_spikes, empower_wards, immolation_aura, siphoned_power(5), cleansing_flame
1:22.103 shear Fluffy_Pillow 72.8/100: 73% pain demon_spikes, empower_wards, immolation_aura, siphoned_power(5)
1:23.477 soul_cleave Fluffy_Pillow 84.8/100: 85% pain demon_spikes, siphoned_power(5)
1:24.849 shear Fluffy_Pillow 38.2/100: 38% pain metamorphosis, siphoned_power(5), cleansing_flame
1:26.222 shear Fluffy_Pillow 55.2/100: 55% pain metamorphosis, siphoned_power(5), cleansing_flame
1:27.595 soul_barrier Kehål 81.1/100: 81% pain metamorphosis, siphoned_power(5), cleansing_flame
1:28.969 shear Fluffy_Pillow 63.8/100: 64% pain metamorphosis, siphoned_power(5), soul_barrier
1:30.344 soul_cleave Fluffy_Pillow 88.4/100: 88% pain metamorphosis, soul_barrier
1:31.719 immolation_aura Fluffy_Pillow 44.2/100: 44% pain metamorphosis, soul_barrier
1:32.972 shear Fluffy_Pillow 67.7/100: 68% pain metamorphosis, immolation_aura, soul_barrier
1:33.572 demon_spikes Fluffy_Pillow 59.5/100: 59% pain demon_spikes, immolation_aura, soul_barrier
1:34.345 shear Fluffy_Pillow 70.7/100: 71% pain demon_spikes, immolation_aura, soul_barrier
1:35.718 soul_cleave Fluffy_Pillow 84.5/100: 85% pain demon_spikes, immolation_aura
1:37.092 shear Fluffy_Pillow 35.1/100: 35% pain demon_spikes, immolation_aura
1:38.464 sigil_of_flame Fluffy_Pillow 51.7/100: 52% pain demon_spikes
1:39.717 shear Fluffy_Pillow 53.5/100: 54% pain
1:41.092 shear Fluffy_Pillow 71.5/100: 72% pain
1:42.467 soul_cleave Fluffy_Pillow 88.1/100: 88% pain
1:43.840 infernal_strike Fluffy_Pillow 29.9/100: 30% pain
1:43.840 shear Fluffy_Pillow 29.9/100: 30% pain
1:45.214 immolation_aura Fluffy_Pillow 47.6/100: 48% pain
1:46.664 shear Fluffy_Pillow 63.9/100: 64% pain immolation_aura
1:47.886 demon_spikes Fluffy_Pillow 55.9/100: 56% pain demon_spikes, immolation_aura, cleansing_flame
1:48.038 soul_barrier Kehål 59.8/100: 60% pain demon_spikes, immolation_aura, cleansing_flame
1:49.412 shear Fluffy_Pillow 40.8/100: 41% pain metamorphosis, demon_spikes, immolation_aura, soul_barrier, cleansing_flame
1:50.786 shear Fluffy_Pillow 63.8/100: 64% pain metamorphosis, demon_spikes, immolation_aura, soul_barrier, cleansing_flame
1:52.159 soul_cleave Fluffy_Pillow 93.8/100: 94% pain metamorphosis, demon_spikes, soul_barrier, cleansing_flame
1:53.532 shear Fluffy_Pillow 40.8/100: 41% pain demon_spikes, soul_barrier
1:54.132 empower_wards Fluffy_Pillow 57.5/100: 57% pain empower_wards, soul_barrier, cleansing_flame
1:54.904 shear Fluffy_Pillow 57.5/100: 57% pain empower_wards, soul_barrier, cleansing_flame
1:56.277 shear Fluffy_Pillow 76.6/100: 77% pain empower_wards, siphoned_power(5), cleansing_flame
1:57.651 soul_cleave Fluffy_Pillow 86.6/100: 87% pain empower_wards, siphoned_power(5), cleansing_flame
1:59.024 immolation_aura Fluffy_Pillow 32.8/100: 33% pain empower_wards, siphoned_power(5)
2:00.000 fiery_brand Fluffy_Pillow 46.5/100: 47% pain empower_wards, immolation_aura, siphoned_power(5)
2:00.353 infernal_strike Fluffy_Pillow 48.5/100: 49% pain immolation_aura, siphoned_power(5)
2:00.353 soul_carver Fluffy_Pillow 48.5/100: 49% pain immolation_aura, siphoned_power(5)
2:01.725 shear Fluffy_Pillow 50.5/100: 51% pain immolation_aura, siphoned_power(5)
2:03.100 shear Fluffy_Pillow 66.7/100: 67% pain immolation_aura, siphoned_power(5)
2:04.475 soul_cleave Fluffy_Pillow 84.4/100: 84% pain immolation_aura, siphoned_power(5)
2:05.850 shear Fluffy_Pillow 26.4/100: 26% pain siphoned_power(5)
2:07.224 shear Fluffy_Pillow 39.9/100: 40% pain
2:08.024 demon_spikes Fluffy_Pillow 36.4/100: 36% pain demon_spikes
2:08.600 soul_barrier Kehål 38.2/100: 38% pain demon_spikes
2:09.975 sigil_of_flame Fluffy_Pillow 8.2/100: 8% pain demon_spikes, soul_barrier
2:11.229 shear Fluffy_Pillow 14.2/100: 14% pain demon_spikes, soul_barrier
2:12.603 immolation_aura Fluffy_Pillow 30.5/100: 31% pain demon_spikes, soul_barrier
2:14.045 shear Fluffy_Pillow 40.5/100: 41% pain immolation_aura, soul_barrier
2:15.419 shear Fluffy_Pillow 54.3/100: 54% pain immolation_aura, soul_barrier
2:16.794 shear Fluffy_Pillow 70.1/100: 70% pain immolation_aura
2:17.886 demon_spikes Fluffy_Pillow 62.1/100: 62% pain demon_spikes, immolation_aura
2:18.166 shear Fluffy_Pillow 64.0/100: 64% pain demon_spikes, immolation_aura
2:19.540 shear Fluffy_Pillow 76.0/100: 76% pain demon_spikes
2:20.913 infernal_strike Fluffy_Pillow 92.4/100: 92% pain demon_spikes
2:20.913 soul_cleave Fluffy_Pillow 92.4/100: 92% pain demon_spikes
2:22.287 shear Fluffy_Pillow 38.9/100: 39% pain demon_spikes, cleansing_flame
2:23.662 shear Fluffy_Pillow 48.9/100: 49% pain demon_spikes, cleansing_flame
2:25.035 shear Fluffy_Pillow 66.6/100: 67% pain cleansing_flame
2:26.409 soul_cleave Fluffy_Pillow 84.1/100: 84% pain
2:27.782 immolation_aura Fluffy_Pillow 24.1/100: 24% pain
2:29.035 soul_barrier Kehål 40.5/100: 41% pain immolation_aura
2:30.410 shear Fluffy_Pillow 18.7/100: 19% pain immolation_aura, soul_barrier
2:31.783 shear Fluffy_Pillow 32.7/100: 33% pain immolation_aura, soul_barrier
2:32.083 empower_wards Fluffy_Pillow 56.3/100: 56% pain empower_wards, immolation_aura, soul_barrier
2:32.886 demon_spikes Fluffy_Pillow 38.3/100: 38% pain demon_spikes, empower_wards, immolation_aura, soul_barrier
2:33.157 shear Fluffy_Pillow 38.3/100: 38% pain demon_spikes, empower_wards, immolation_aura, soul_barrier
2:34.531 shear Fluffy_Pillow 57.7/100: 58% pain demon_spikes, empower_wards, siphoned_power(5), soul_barrier
2:35.903 shear Fluffy_Pillow 67.7/100: 68% pain demon_spikes, empower_wards, siphoned_power(5), soul_barrier, cleansing_flame
2:37.276 soul_cleave Fluffy_Pillow 82.1/100: 82% pain demon_spikes, empower_wards, siphoned_power(5), cleansing_flame
2:38.650 shear Fluffy_Pillow 22.1/100: 22% pain demon_spikes, siphoned_power(5), cleansing_flame
2:40.024 sigil_of_flame Fluffy_Pillow 38.7/100: 39% pain siphoned_power(5), cleansing_flame
2:41.280 immolation_aura Fluffy_Pillow 38.7/100: 39% pain siphoned_power(5)
2:42.726 shear Fluffy_Pillow 54.6/100: 55% pain immolation_aura, siphoned_power(5)
2:44.100 shear Fluffy_Pillow 72.5/100: 72% pain immolation_aura
2:45.472 infernal_strike Fluffy_Pillow 84.5/100: 84% pain immolation_aura
2:45.472 soul_cleave Fluffy_Pillow 84.5/100: 84% pain immolation_aura
2:46.844 shear Fluffy_Pillow 35.3/100: 35% pain immolation_aura, cleansing_flame
2:47.886 demon_spikes Fluffy_Pillow 27.3/100: 27% pain demon_spikes, cleansing_flame
2:48.219 shear Fluffy_Pillow 31.6/100: 32% pain demon_spikes, cleansing_flame
2:49.592 soul_barrier Kehål 43.4/100: 43% pain demon_spikes, cleansing_flame
2:50.966 shear Fluffy_Pillow 18.0/100: 18% pain demon_spikes, soul_barrier
2:52.340 shear Fluffy_Pillow 34.2/100: 34% pain demon_spikes, soul_barrier
2:53.714 shear Fluffy_Pillow 46.0/100: 46% pain demon_spikes, soul_barrier
2:55.088 immolation_aura Fluffy_Pillow 64.4/100: 64% pain soul_barrier
2:56.418 shear Fluffy_Pillow 74.4/100: 74% pain immolation_aura, soul_barrier
2:57.791 soul_cleave Fluffy_Pillow 88.2/100: 88% pain immolation_aura, cleansing_flame
2:59.166 shear Fluffy_Pillow 40.0/100: 40% pain immolation_aura, cleansing_flame
3:00.000 fiery_brand Fluffy_Pillow 56.5/100: 56% pain immolation_aura, cleansing_flame
3:00.540 infernal_strike Fluffy_Pillow 58.5/100: 58% pain immolation_aura, cleansing_flame
3:00.540 soul_carver Fluffy_Pillow 58.5/100: 58% pain immolation_aura, cleansing_flame
3:01.912 shear Fluffy_Pillow 65.7/100: 66% pain
3:03.286 soul_cleave Fluffy_Pillow 76.8/100: 77% pain cleansing_flame
3:04.660 shear Fluffy_Pillow 20.5/100: 21% pain cleansing_flame
3:06.034 shear Fluffy_Pillow 35.4/100: 35% pain cleansing_flame
3:07.408 shear Fluffy_Pillow 46.5/100: 47% pain
3:08.008 demon_spikes Fluffy_Pillow 42.6/100: 43% pain demon_spikes
3:08.783 immolation_aura Fluffy_Pillow 42.6/100: 43% pain demon_spikes
3:09.155 empower_wards Fluffy_Pillow 50.6/100: 51% pain demon_spikes, empower_wards, immolation_aura
3:10.109 soul_barrier Kehål 56.7/100: 57% pain demon_spikes, empower_wards, immolation_aura
3:11.482 sigil_of_flame Fluffy_Pillow 31.5/100: 31% pain demon_spikes, empower_wards, immolation_aura, siphoned_power(5), soul_barrier
3:12.736 shear Fluffy_Pillow 38.1/100: 38% pain demon_spikes, empower_wards, immolation_aura, siphoned_power(5), soul_barrier
3:14.109 shear Fluffy_Pillow 56.2/100: 56% pain empower_wards, immolation_aura, siphoned_power(5), soul_barrier
3:15.481 shear Fluffy_Pillow 68.2/100: 68% pain siphoned_power(5), soul_barrier, cleansing_flame
3:16.855 shear Fluffy_Pillow 78.2/100: 78% pain siphoned_power(5), soul_barrier, cleansing_flame
3:17.886 demon_spikes Fluffy_Pillow 68.2/100: 68% pain demon_spikes, siphoned_power(5), soul_barrier, cleansing_flame
3:18.228 shear Fluffy_Pillow 72.3/100: 72% pain demon_spikes, siphoned_power(5), cleansing_flame
3:19.601 soul_cleave Fluffy_Pillow 82.3/100: 82% pain demon_spikes, siphoned_power(5)
3:20.976 infernal_strike Fluffy_Pillow 33.4/100: 33% pain metamorphosis, demon_spikes, siphoned_power(5), cleansing_flame
3:20.976 shear Fluffy_Pillow 33.4/100: 33% pain metamorphosis, demon_spikes, siphoned_power(5), cleansing_flame
3:22.349 immolation_aura Fluffy_Pillow 54.8/100: 55% pain metamorphosis, demon_spikes, cleansing_flame
3:23.799 shear Fluffy_Pillow 78.8/100: 79% pain metamorphosis, demon_spikes, immolation_aura, cleansing_flame
3:25.171 soul_cleave Fluffy_Pillow 100.0/100: 100% pain immolation_aura
3:26.543 shear Fluffy_Pillow 48.0/100: 48% pain immolation_aura
3:27.917 shear Fluffy_Pillow 62.0/100: 62% pain immolation_aura
3:29.291 soul_cleave Fluffy_Pillow 80.6/100: 81% pain
3:30.665 soul_barrier Kehål 35.9/100: 36% pain
3:32.039 shear Fluffy_Pillow 12.5/100: 12% pain soul_barrier
3:32.886 demon_spikes Fluffy_Pillow 4.3/100: 4% pain demon_spikes, soul_barrier
3:33.413 shear Fluffy_Pillow 4.3/100: 4% pain demon_spikes, soul_barrier
3:34.786 shear Fluffy_Pillow 20.2/100: 20% pain demon_spikes, soul_barrier
3:36.160 immolation_aura Fluffy_Pillow 36.1/100: 36% pain demon_spikes, soul_barrier
3:37.491 shear Fluffy_Pillow 46.1/100: 46% pain demon_spikes, immolation_aura, soul_barrier
3:38.864 shear Fluffy_Pillow 63.9/100: 64% pain demon_spikes, immolation_aura, cleansing_flame
3:40.237 soul_cleave Fluffy_Pillow 84.5/100: 84% pain immolation_aura, cleansing_flame
3:41.611 sigil_of_flame Fluffy_Pillow 28.5/100: 28% pain immolation_aura, cleansing_flame
3:42.865 shear Fluffy_Pillow 38.2/100: 38% pain cleansing_flame
3:44.239 shear Fluffy_Pillow 56.0/100: 56% pain
3:45.613 shear Fluffy_Pillow 66.0/100: 66% pain
3:46.113 empower_wards Fluffy_Pillow 84.0/100: 84% pain empower_wards
3:46.987 infernal_strike Fluffy_Pillow 84.0/100: 84% pain empower_wards
3:46.987 soul_cleave Fluffy_Pillow 84.0/100: 84% pain empower_wards
3:47.886 demon_spikes Fluffy_Pillow 4.0/100: 4% pain demon_spikes, empower_wards
3:48.359 shear Fluffy_Pillow 12.0/100: 12% pain demon_spikes, empower_wards, siphoned_power(7)
3:49.733 immolation_aura Fluffy_Pillow 22.0/100: 22% pain demon_spikes, empower_wards, siphoned_power(7)
3:51.180 soul_barrier Kehål 36.5/100: 37% pain demon_spikes, empower_wards, immolation_aura, siphoned_power(7), cleansing_flame
3:52.556 shear Fluffy_Pillow 8.5/100: 9% pain demon_spikes, immolation_aura, siphoned_power(7), soul_barrier, cleansing_flame
3:53.929 shear Fluffy_Pillow 22.5/100: 23% pain immolation_aura, siphoned_power(7), soul_barrier, cleansing_flame
3:55.301 shear Fluffy_Pillow 40.8/100: 41% pain immolation_aura, siphoned_power(7), soul_barrier, cleansing_flame
3:56.674 shear Fluffy_Pillow 58.9/100: 59% pain siphoned_power(7), soul_barrier
3:58.048 shear Fluffy_Pillow 75.2/100: 75% pain siphoned_power(7), soul_barrier
3:59.420 soul_cleave Fluffy_Pillow 92.2/100: 92% pain
4:00.000 fiery_brand Fluffy_Pillow 38.5/100: 38% pain
4:00.794 infernal_strike Fluffy_Pillow 38.5/100: 38% pain
4:00.794 soul_carver Fluffy_Pillow 38.5/100: 38% pain
4:02.167 shear Fluffy_Pillow 38.5/100: 38% pain
4:03.542 immolation_aura Fluffy_Pillow 48.5/100: 48% pain cleansing_flame
4:04.872 soul_cleave Fluffy_Pillow 62.4/100: 62% pain immolation_aura, cleansing_flame
4:06.245 shear Fluffy_Pillow 8.3/100: 8% pain immolation_aura, cleansing_flame
4:07.617 shear Fluffy_Pillow 20.3/100: 20% pain immolation_aura, cleansing_flame
4:08.017 demon_spikes Fluffy_Pillow 18.4/100: 18% pain demon_spikes, immolation_aura
4:08.117 empower_wards Fluffy_Pillow 18.4/100: 18% pain demon_spikes, empower_wards, immolation_aura
4:08.989 shear Fluffy_Pillow 20.4/100: 20% pain demon_spikes, empower_wards, immolation_aura
4:10.363 shear Fluffy_Pillow 36.6/100: 37% pain demon_spikes, empower_wards
4:11.736 soul_barrier Kehål 47.9/100: 48% pain demon_spikes, empower_wards, siphoned_power(2)
4:13.109 sigil_of_flame Fluffy_Pillow 19.1/100: 19% pain demon_spikes, empower_wards, siphoned_power(4), soul_barrier
4:14.362 shear Fluffy_Pillow 23.5/100: 23% pain siphoned_power(4), soul_barrier
4:15.737 shear Fluffy_Pillow 35.3/100: 35% pain siphoned_power(4), soul_barrier
4:17.112 immolation_aura Fluffy_Pillow 53.8/100: 54% pain siphoned_power(4), soul_barrier
4:17.886 demon_spikes Fluffy_Pillow 41.8/100: 42% pain demon_spikes, immolation_aura, siphoned_power(4), soul_barrier
4:18.564 shear Fluffy_Pillow 48.4/100: 48% pain demon_spikes, immolation_aura, siphoned_power(4), soul_barrier
4:19.939 infernal_strike Fluffy_Pillow 62.2/100: 62% pain demon_spikes, immolation_aura, siphoned_power(4)
4:20.001 shear Fluffy_Pillow 66.1/100: 66% pain demon_spikes, immolation_aura, siphoned_power(4)
4:21.375 soul_cleave Fluffy_Pillow 82.0/100: 82% pain demon_spikes, immolation_aura, siphoned_power(4)
4:22.750 shear Fluffy_Pillow 28.2/100: 28% pain demon_spikes, immolation_aura, siphoned_power(4)
4:24.123 shear Fluffy_Pillow 48.9/100: 49% pain cleansing_flame
4:25.496 shear Fluffy_Pillow 64.7/100: 65% pain cleansing_flame
4:26.867 soul_cleave Fluffy_Pillow 80.6/100: 81% pain cleansing_flame
4:28.241 shear Fluffy_Pillow 30.4/100: 30% pain
4:29.612 shear Fluffy_Pillow 42.2/100: 42% pain cleansing_flame
4:30.984 immolation_aura Fluffy_Pillow 58.5/100: 59% pain cleansing_flame
4:32.255 soul_barrier Kehål 75.1/100: 75% pain immolation_aura, cleansing_flame
4:32.886 demon_spikes Fluffy_Pillow 25.1/100: 25% pain demon_spikes, immolation_aura, soul_barrier, cleansing_flame
4:33.628 shear Fluffy_Pillow 27.1/100: 27% pain demon_spikes, immolation_aura, soul_barrier
4:35.001 shear Fluffy_Pillow 43.8/100: 44% pain demon_spikes, immolation_aura, soul_barrier
4:36.374 shear Fluffy_Pillow 62.0/100: 62% pain demon_spikes, immolation_aura, soul_barrier
4:37.748 shear Fluffy_Pillow 74.0/100: 74% pain demon_spikes, soul_barrier
4:39.122 soul_cleave Fluffy_Pillow 88.5/100: 89% pain soul_barrier
4:40.497 shear Fluffy_Pillow 34.5/100: 34% pain
4:41.871 shear Fluffy_Pillow 44.5/100: 44% pain cleansing_flame
4:43.243 sigil_of_flame Fluffy_Pillow 60.3/100: 60% pain cleansing_flame
4:44.496 immolation_aura Fluffy_Pillow 66.7/100: 67% pain cleansing_flame
4:45.945 shear Fluffy_Pillow 76.7/100: 77% pain immolation_aura
4:47.319 soul_cleave Fluffy_Pillow 94.3/100: 94% pain immolation_aura
4:47.886 demon_spikes Fluffy_Pillow 16.3/100: 16% pain demon_spikes, immolation_aura
4:48.692 infernal_strike Fluffy_Pillow 16.3/100: 16% pain demon_spikes, immolation_aura
4:48.692 shear Fluffy_Pillow 18.3/100: 18% pain demon_spikes, immolation_aura
4:49.192 empower_wards Fluffy_Pillow 28.3/100: 28% pain demon_spikes, empower_wards, immolation_aura
4:50.067 shear Fluffy_Pillow 34.8/100: 35% pain demon_spikes, empower_wards, immolation_aura
4:51.439 shear Fluffy_Pillow 46.8/100: 47% pain demon_spikes, empower_wards, cleansing_flame
4:52.815 soul_barrier Kehål 58.0/100: 58% pain demon_spikes, empower_wards, siphoned_power(2), cleansing_flame
4:54.188 shear Fluffy_Pillow 35.1/100: 35% pain empower_wards, siphoned_power(4), soul_barrier, cleansing_flame
4:55.561 shear Fluffy_Pillow 45.1/100: 45% pain siphoned_power(4), soul_barrier, cleansing_flame
4:56.934 shear Fluffy_Pillow 63.4/100: 63% pain siphoned_power(4), soul_barrier
4:58.307 soul_cleave Fluffy_Pillow 82.4/100: 82% pain siphoned_power(4), soul_barrier
4:59.681 immolation_aura Fluffy_Pillow 22.4/100: 22% pain siphoned_power(4), soul_barrier
5:00.000 fiery_brand Fluffy_Pillow 36.9/100: 37% pain immolation_aura, siphoned_power(4), soul_barrier, cleansing_flame
5:00.937 infernal_strike Fluffy_Pillow 40.0/100: 40% pain immolation_aura, siphoned_power(4), cleansing_flame
5:00.937 soul_carver Fluffy_Pillow 40.0/100: 40% pain immolation_aura, siphoned_power(4), cleansing_flame
5:02.311 shear Fluffy_Pillow 49.6/100: 50% pain immolation_aura, siphoned_power(4), cleansing_flame
5:03.685 shear Fluffy_Pillow 63.6/100: 64% pain immolation_aura, siphoned_power(4), cleansing_flame
5:05.057 soul_cleave Fluffy_Pillow 80.6/100: 81% pain immolation_aura
5:06.430 shear Fluffy_Pillow 27.6/100: 28% pain
5:07.803 shear Fluffy_Pillow 37.6/100: 38% pain
5:08.003 demon_spikes Fluffy_Pillow 34.2/100: 34% pain demon_spikes, cleansing_flame
5:09.178 shear Fluffy_Pillow 36.0/100: 36% pain demon_spikes, cleansing_flame
5:10.551 shear Fluffy_Pillow 51.8/100: 52% pain demon_spikes, cleansing_flame
5:11.924 shear Fluffy_Pillow 61.8/100: 62% pain demon_spikes, cleansing_flame
5:13.298 immolation_aura Fluffy_Pillow 71.8/100: 72% pain demon_spikes
5:14.626 soul_barrier Kehål 86.4/100: 86% pain immolation_aura
5:15.998 sigil_of_flame Fluffy_Pillow 65.4/100: 65% pain metamorphosis, immolation_aura, soul_barrier
5:17.252 soul_cleave Fluffy_Pillow 81.0/100: 81% pain metamorphosis, immolation_aura, soul_barrier
5:18.625 shear Fluffy_Pillow 38.0/100: 38% pain metamorphosis, immolation_aura, soul_barrier
5:19.725 demon_spikes Fluffy_Pillow 44.0/100: 44% pain demon_spikes, soul_barrier, cleansing_flame
5:19.999 shear Fluffy_Pillow 44.0/100: 44% pain demon_spikes, soul_barrier, cleansing_flame
5:21.373 infernal_strike Fluffy_Pillow 54.0/100: 54% pain demon_spikes, soul_barrier, cleansing_flame
5:21.373 shear Fluffy_Pillow 54.0/100: 54% pain demon_spikes, soul_barrier, cleansing_flame
5:22.746 shear Fluffy_Pillow 64.0/100: 64% pain demon_spikes, cleansing_flame
5:24.118 shear Fluffy_Pillow 74.0/100: 74% pain demon_spikes, cleansing_flame
5:25.492 soul_cleave Fluffy_Pillow 84.0/100: 84% pain demon_spikes
5:26.866 immolation_aura Fluffy_Pillow 37.3/100: 37% pain
5:28.317 shear Fluffy_Pillow 54.2/100: 54% pain immolation_aura
5:29.691 shear Fluffy_Pillow 66.2/100: 66% pain immolation_aura
5:30.191 empower_wards Fluffy_Pillow 85.0/100: 85% pain empower_wards, immolation_aura
5:31.064 soul_cleave Fluffy_Pillow 87.0/100: 87% pain empower_wards, immolation_aura
5:32.436 shear Fluffy_Pillow 35.9/100: 36% pain empower_wards, immolation_aura
5:32.886 demon_spikes Fluffy_Pillow 25.9/100: 26% pain demon_spikes, empower_wards, immolation_aura
5:33.808 shear Fluffy_Pillow 29.1/100: 29% pain demon_spikes, empower_wards, siphoned_power(2)
5:35.179 soul_barrier Kehål 45.0/100: 45% pain demon_spikes, empower_wards, siphoned_power(4)
5:36.552 shear Fluffy_Pillow 15.0/100: 15% pain demon_spikes, siphoned_power(4), soul_barrier, cleansing_flame
5:37.925 shear Fluffy_Pillow 26.8/100: 27% pain demon_spikes, siphoned_power(4), soul_barrier, cleansing_flame
5:39.297 shear Fluffy_Pillow 46.4/100: 46% pain siphoned_power(4), soul_barrier, cleansing_flame
5:40.671 immolation_aura Fluffy_Pillow 62.0/100: 62% pain siphoned_power(4), soul_barrier
5:42.007 soul_cleave Fluffy_Pillow 80.7/100: 81% pain immolation_aura, siphoned_power(4), soul_barrier
5:43.382 shear Fluffy_Pillow 24.5/100: 24% pain immolation_aura, siphoned_power(4)
5:44.755 shear Fluffy_Pillow 44.7/100: 45% pain immolation_aura, siphoned_power(4)
5:46.130 sigil_of_flame Fluffy_Pillow 64.3/100: 64% pain immolation_aura
5:47.384 shear Fluffy_Pillow 68.1/100: 68% pain cleansing_flame
5:47.886 demon_spikes Fluffy_Pillow 58.1/100: 58% pain demon_spikes, cleansing_flame
5:48.758 shear Fluffy_Pillow 62.5/100: 62% pain demon_spikes, cleansing_flame
5:50.132 shear Fluffy_Pillow 78.8/100: 79% pain demon_spikes, cleansing_flame
5:51.506 infernal_strike Fluffy_Pillow 90.6/100: 91% pain demon_spikes
5:51.506 soul_cleave Fluffy_Pillow 90.6/100: 91% pain demon_spikes
5:52.880 shear Fluffy_Pillow 34.6/100: 35% pain demon_spikes
5:54.254 immolation_aura Fluffy_Pillow 51.2/100: 51% pain
5:55.700 soul_barrier Kehål 69.2/100: 69% pain immolation_aura
5:57.073 shear Fluffy_Pillow 48.0/100: 48% pain immolation_aura, soul_barrier
5:58.445 shear Fluffy_Pillow 66.8/100: 67% pain immolation_aura, soul_barrier
5:59.817 fiery_brand Fluffy_Pillow 80.8/100: 81% pain immolation_aura, soul_barrier
6:00.000 infernal_strike Fluffy_Pillow 80.8/100: 81% pain immolation_aura, soul_barrier
6:00.000 soul_carver Fluffy_Pillow 80.8/100: 81% pain immolation_aura, soul_barrier
6:01.373 soul_cleave Fluffy_Pillow 82.8/100: 83% pain soul_barrier
6:02.748 shear Fluffy_Pillow 26.9/100: 27% pain soul_barrier
6:04.123 shear Fluffy_Pillow 40.5/100: 41% pain
6:05.497 shear Fluffy_Pillow 50.5/100: 51% pain
6:06.871 soul_cleave Fluffy_Pillow 64.3/100: 64% pain
6:08.244 immolation_aura Fluffy_Pillow 17.2/100: 17% pain metamorphosis
6:09.498 shear Fluffy_Pillow 34.2/100: 34% pain metamorphosis, immolation_aura
6:10.872 shear Fluffy_Pillow 66.0/100: 66% pain metamorphosis, immolation_aura
6:11.172 empower_wards Fluffy_Pillow 76.0/100: 76% pain metamorphosis, empower_wards, immolation_aura
6:11.872 demon_spikes Fluffy_Pillow 65.0/100: 65% pain demon_spikes, empower_wards, immolation_aura
6:12.246 shear Fluffy_Pillow 71.5/100: 72% pain demon_spikes, empower_wards, immolation_aura
6:13.620 soul_cleave Fluffy_Pillow 83.5/100: 84% pain demon_spikes, empower_wards, immolation_aura
6:14.995 shear Fluffy_Pillow 31.3/100: 31% pain demon_spikes, empower_wards, siphoned_power(2)
6:16.368 soul_barrier Kehål 49.5/100: 50% pain demon_spikes, empower_wards, siphoned_power(9)
6:17.741 sigil_of_flame Fluffy_Pillow 19.5/100: 20% pain demon_spikes, siphoned_power(9), soul_barrier
6:18.041 demon_spikes Fluffy_Pillow 5.2/100: 5% pain demon_spikes, siphoned_power(9), soul_barrier
6:18.995 shear Fluffy_Pillow 7.1/100: 7% pain demon_spikes, siphoned_power(9), soul_barrier, cleansing_flame
6:20.369 shear Fluffy_Pillow 23.5/100: 24% pain demon_spikes, siphoned_power(9), soul_barrier, cleansing_flame
6:21.744 immolation_aura Fluffy_Pillow 33.5/100: 34% pain demon_spikes, siphoned_power(9), soul_barrier, cleansing_flame
6:23.189 infernal_strike Fluffy_Pillow 49.4/100: 49% pain demon_spikes, immolation_aura, siphoned_power(9), soul_barrier
6:23.189 shear Fluffy_Pillow 49.4/100: 49% pain demon_spikes, immolation_aura, siphoned_power(9), soul_barrier
6:24.563 shear Fluffy_Pillow 70.1/100: 70% pain immolation_aura, siphoned_power(9)
6:25.938 soul_cleave Fluffy_Pillow 84.1/100: 84% pain immolation_aura, siphoned_power(9)
6:27.311 shear Fluffy_Pillow 34.2/100: 34% pain immolation_aura
6:28.685 shear Fluffy_Pillow 54.3/100: 54% pain
6:30.057 shear Fluffy_Pillow 70.1/100: 70% pain
6:31.430 soul_cleave Fluffy_Pillow 81.9/100: 82% pain
6:32.804 demon_spikes Fluffy_Pillow 29.7/100: 30% pain
6:32.886 shear Fluffy_Pillow 9.7/100: 10% pain demon_spikes
6:34.258 shear Fluffy_Pillow 23.7/100: 24% pain demon_spikes
6:35.632 immolation_aura Fluffy_Pillow 33.7/100: 34% pain demon_spikes
6:36.886 soul_barrier Kehål 47.8/100: 48% pain demon_spikes, immolation_aura
6:38.259 shear Fluffy_Pillow 23.8/100: 24% pain demon_spikes, immolation_aura, soul_barrier
6:39.632 shear Fluffy_Pillow 35.8/100: 36% pain immolation_aura, soul_barrier
6:41.005 shear Fluffy_Pillow 49.8/100: 50% pain immolation_aura, soul_barrier
6:42.379 shear Fluffy_Pillow 68.2/100: 68% pain soul_barrier
6:43.752 shear Fluffy_Pillow 78.2/100: 78% pain soul_barrier
6:45.126 soul_cleave Fluffy_Pillow 88.2/100: 88% pain
6:46.499 shear Fluffy_Pillow 33.8/100: 34% pain
6:47.873 demon_spikes Fluffy_Pillow 43.8/100: 44% pain cleansing_flame
6:47.886 sigil_of_flame Fluffy_Pillow 23.8/100: 24% pain demon_spikes, cleansing_flame
6:49.140 immolation_aura Fluffy_Pillow 28.0/100: 28% pain demon_spikes, cleansing_flame
6:50.576 shear Fluffy_Pillow 41.9/100: 42% pain demon_spikes, immolation_aura, cleansing_flame
6:51.176 empower_wards Fluffy_Pillow 51.9/100: 52% pain demon_spikes, empower_wards, immolation_aura, cleansing_flame
6:51.948 shear Fluffy_Pillow 53.9/100: 54% pain demon_spikes, empower_wards, immolation_aura
6:53.322 infernal_strike Fluffy_Pillow 68.6/100: 69% pain demon_spikes, empower_wards, immolation_aura, siphoned_power(4)
6:53.322 shear Fluffy_Pillow 68.6/100: 69% pain demon_spikes, empower_wards, immolation_aura, siphoned_power(4)
6:54.696 soul_cleave Fluffy_Pillow 89.2/100: 89% pain empower_wards, immolation_aura, siphoned_power(4)
6:56.070 shear Fluffy_Pillow 37.9/100: 38% pain empower_wards, siphoned_power(4), cleansing_flame
6:57.443 soul_barrier Kehål 56.0/100: 56% pain siphoned_power(7), cleansing_flame
6:58.820 shear Fluffy_Pillow 33.8/100: 34% pain siphoned_power(7), soul_barrier, cleansing_flame
7:00.000 fiery_brand Fluffy_Pillow 49.6/100: 50% pain siphoned_power(7), soul_barrier
7:00.195 soul_carver Fluffy_Pillow 50.7/100: 51% pain siphoned_power(7), soul_barrier
7:01.568 infernal_strike Fluffy_Pillow 50.7/100: 51% pain siphoned_power(7), soul_barrier
7:01.568 shear Fluffy_Pillow 50.7/100: 51% pain siphoned_power(7), soul_barrier
7:02.941 immolation_aura Fluffy_Pillow 65.7/100: 66% pain siphoned_power(7), soul_barrier, cleansing_flame
7:04.269 soul_cleave Fluffy_Pillow 80.7/100: 81% pain immolation_aura, siphoned_power(7), soul_barrier, cleansing_flame
7:05.643 shear Fluffy_Pillow 29.7/100: 30% pain metamorphosis, immolation_aura, siphoned_power(7), cleansing_flame
7:07.017 shear Fluffy_Pillow 55.4/100: 55% pain metamorphosis, immolation_aura, cleansing_flame
7:08.391 soul_cleave Fluffy_Pillow 89.4/100: 89% pain metamorphosis, immolation_aura
7:09.291 demon_spikes Fluffy_Pillow 18.4/100: 18% pain demon_spikes
7:09.763 shear Fluffy_Pillow 18.4/100: 18% pain demon_spikes
7:11.136 shear Fluffy_Pillow 34.3/100: 34% pain demon_spikes
7:12.507 shear Fluffy_Pillow 46.1/100: 46% pain demon_spikes, cleansing_flame
7:13.882 shear Fluffy_Pillow 56.1/100: 56% pain demon_spikes, cleansing_flame
7:15.255 shear Fluffy_Pillow 67.9/100: 68% pain demon_spikes, cleansing_flame
7:16.629 soul_cleave Fluffy_Pillow 84.7/100: 85% pain cleansing_flame
7:17.886 demon_spikes Fluffy_Pillow 4.7/100: 5% pain demon_spikes, cleansing_flame
7:18.001 immolation_aura Fluffy_Pillow 4.7/100: 5% pain demon_spikes, cleansing_flame
7:19.256 sigil_of_flame Fluffy_Pillow 14.7/100: 15% pain demon_spikes, immolation_aura
7:20.510 shear Fluffy_Pillow 20.7/100: 21% pain demon_spikes, immolation_aura, cleansing_flame
7:21.882 soul_barrier Kehål 32.7/100: 33% pain demon_spikes, immolation_aura, cleansing_flame
7:23.256 shear Fluffy_Pillow 6.7/100: 7% pain demon_spikes, immolation_aura, soul_barrier, cleansing_flame
7:24.630 infernal_strike Fluffy_Pillow 24.4/100: 24% pain soul_barrier, cleansing_flame
7:24.630 shear Fluffy_Pillow 24.4/100: 24% pain soul_barrier, cleansing_flame
7:26.003 shear Fluffy_Pillow 48.4/100: 48% pain soul_barrier
7:27.375 shear Fluffy_Pillow 58.4/100: 58% pain soul_barrier

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 8802 8477 0
Agility 17231 15606 6572 (4304)
Stamina 25881 25881 8819
Intellect 5325 5000 0
Spirit 0 0 0
Health 1552860 1552860 0
Pain 100 100 0
Crit 24.85% 23.77% 2721
Haste 9.56% 9.56% 3107
Damage / Heal Versatility 1.55% 1.55% 619
Mitigation Versatility 0.77% 0.77% 619
Attack Power 19617 17767 0
Mastery 20.77% 20.77% 2047
Armor 3434 3434 1561
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 12.49% 11.30% 0
Tank-Parry 9.80% 9.29% 2721
Tank-Block 0.00% 0.00% 0
Tank-Crit -6.00% -6.00% 0

Gear

Source Slot Average Item Level: 746.00
Local Head Helm of the Shattered Abyss
ilevel: 810, stats: { 234 Armor, +1340 Sta, +894 Agi, +803 Crit, +321 Haste }
Local Neck Radiant Charm of Elune
ilevel: 680, stats: { +225 Sta, +285 Mastery, +214 Crit }
Local Shoulders Amice of the Enlightened
ilevel: 820, stats: { 223 Armor, +1103 Sta, +736 AgiInt, +569 Haste, +306 Vers }
Local Chest Shaladrassil Tunic
ilevel: 800, stats: { 279 Armor, +814 AgiInt, +1221 Sta, +774 Haste, +310 Mastery }
Local Waist Sablehide Waistcord
ilevel: 680, stats: { 97 Armor, +200 AgiInt, +300 Sta, +167 Crit, +99 Vers }
Local Legs Valor-Bound Legwraps
ilevel: 800, stats: { 244 Armor, +814 AgiInt, +1221 Sta, +635 Crit, +449 Haste }
Local Feet Treads of the Receding Nightmare
ilevel: 680, stats: { 119 Armor, +200 AgiInt, +300 Sta, +173 Mastery, +93 Haste }
Local Wrists Sablehide Armbands
ilevel: 680, stats: { 76 Armor, +150 AgiInt, +225 Sta, +138 Mastery, +61 Crit }
Local Hands Earthguard Grips
ilevel: 800, stats: { 174 Armor, +611 AgiInt, +916 Sta, +302 Mastery, +511 Haste }
Local Finger1 Band of Sablehide
ilevel: 680, stats: { +225 Sta, +271 Mastery, +228 Crit }
Local Finger2 Tranquil Azurewing Band
ilevel: 680, stats: { +225 Sta, +285 Crit, +214 Vers }
Local Trinket1 Life-Giving Berries
ilevel: 680, stats: { +253 StrAgiInt }
Local Trinket2 Infallible Tracking Charm
ilevel: 815, stats: { +890 Agi }
Local Back Cloak of the Everliving Keeper
ilevel: 815, stats: { 115 Armor, +526 StrAgiInt, +790 Sta, +390 Haste, +252 Mastery }
Local Main Hand Aldrachi Warblades
ilevel: 761, weapon: { 1437 - 2671, 2.6 }, stats: { +242 Agi, +364 Sta, +164 Crit, +158 Mastery }, relics: { +4 ilevels, +7 ilevels }
Local Off Hand Aldrachi Warblades
ilevel: 761, weapon: { 1437 - 2671, 2.6 }, stats: { +242 Agi, +364 Sta, +164 Crit, +158 Mastery }

Talents

Level
15 Abyssal Strike (Vengeance Demon Hunter) Agonizing Flames (Vengeance Demon Hunter) Razor Spikes (Vengeance Demon Hunter)
30 Feast of Souls (Vengeance Demon Hunter) Fallout (Vengeance Demon Hunter) Burning Alive (Vengeance Demon Hunter)
45 Felblade Flame Crash (Vengeance Demon Hunter) Fel Eruption (Vengeance Demon Hunter)
60 Feed the Demon (Vengeance Demon Hunter) Fracture (Vengeance Demon Hunter) Soul Rending (Vengeance Demon Hunter)
75 Concentrated Sigils (Vengeance Demon Hunter) Sigil of Chains (Vengeance Demon Hunter) Quickened Sigils (Vengeance Demon Hunter)
90 Fel Devastation (Vengeance Demon Hunter) Blade Turning (Vengeance Demon Hunter) Spirit Bomb (Vengeance Demon Hunter)
100 Last Resort (Vengeance Demon Hunter) Nether Bond (Vengeance Demon Hunter) Soul Barrier (Vengeance Demon Hunter)

Profile

demonhunter="Kehål"
origin="https://eu.api.battle.net/wow/character/hyjal/Kehål/advanced"
thumbnail="http://eu.battle.net/static-render/eu/hyjal/206/142692302-avatar.jpg"
level=110
race=night_elf
timeofday=day
role=tank
position=front
professions=leatherworking=1/skinning=242
artifact=60:0:0:0:0:1096:1:1099:2:1231:3:1234:3:1236:1:1328:1:1434:1
spec=vengeance

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=the_hungry_magister
actions.precombat+=/augmentation,type=defiled
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=unbending_potion

# Executed every time the actor is available.
actions=auto_attack
actions+=/fiery_brand,if=buff.demon_spikes.down&buff.metamorphosis.down
actions+=/demon_spikes,if=charges=2|buff.demon_spikes.down&!dot.fiery_brand.ticking&buff.metamorphosis.down
actions+=/empower_wards,if=debuff.casting.up
actions+=/infernal_strike,if=!sigil_placed&!in_flight&remains-travel_time-delay<0.3*duration&artifact.fiery_demise.enabled&dot.fiery_brand.ticking
actions+=/infernal_strike,if=!sigil_placed&!in_flight&remains-travel_time-delay<0.3*duration&(!artifact.fiery_demise.enabled|(max_charges-charges_fractional)*recharge_time<cooldown.fiery_brand.remains+5)&(cooldown.sigil_of_flame.remains>7|charges=2)
actions+=/spirit_bomb,if=debuff.frailty.down
actions+=/soul_carver,if=dot.fiery_brand.ticking
actions+=/immolation_aura,if=pain<=80
actions+=/felblade,if=pain<=70
actions+=/soul_barrier
actions+=/soul_cleave,if=soul_fragments=5
actions+=/metamorphosis,if=buff.demon_spikes.down&!dot.fiery_brand.ticking&buff.metamorphosis.down&incoming_damage_5s>health.max*0.70
actions+=/fel_devastation,if=incoming_damage_5s>health.max*0.70
actions+=/soul_cleave,if=incoming_damage_5s>=health.max*0.70
actions+=/fel_eruption
actions+=/sigil_of_flame,if=remains-delay<=0.3*duration
actions+=/fracture,if=pain>=80&soul_fragments<4&incoming_damage_4s<=health.max*0.20
actions+=/soul_cleave,if=pain>=80
actions+=/shear

head=helm_of_the_shattered_abyss,id=139718,bonus_id=3385/3381
neck=radiant_charm_of_elune,id=121641,bonus_id=664/1736
shoulders=amice_of_the_enlightened,id=133620,bonus_id=1795
back=cloak_of_the_everliving_keeper,id=121804,bonus_id=665
chest=shaladrassil_tunic,id=129993
wrists=sablehide_armbands,id=121605,bonus_id=768
hands=earthguard_grips,id=141008
waist=sablehide_waistcord,id=129999,bonus_id=664
legs=valorbound_legwraps,id=129997
feet=treads_of_the_receding_nightmare,id=141549,bonus_id=1793
finger1=band_of_sablehide,id=129168,bonus_id=664/1736
finger2=tranquil_azurewing_band,id=121481,bonus_id=767/1733
trinket1=lifegiving_berries,id=141618,bonus_id=767
trinket2=infallible_tracking_charm,id=133597
main_hand=aldrachi_warblades,id=128832,gem_id=133109/133137/0/0,relic_id=664:1521:1809/1793:1535:1809/0/0
off_hand=aldrachi_warblades,id=128831

# Gear Summary
# gear_ilvl=746.38
# gear_agility=6572
# gear_stamina=8819
# gear_crit_rating=2721
# gear_haste_rating=3107
# gear_mastery_rating=2047
# gear_versatility_rating=619
# gear_armor=1561

Kaptah

Kaptah : 126133 dps

  • Race: Night Elf
  • Class: Druid
  • Spec: Balance
  • Level: 110
  • Role: Spell
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
126133.5 126133.5 51.9 / 0.041% 10412.2 / 8.3% 19293.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
6.5 6.5 Astral Power 0.00% 43.9 100.0% 100%
Origin https://eu.api.battle.net/wow/character/hyjal/Kaptah/advanced
Talents
  • 15: Starlord (Balance Druid)
  • 30: Displacer Beast
  • 45: Guardian Affinity (Balance Druid)
  • 60: Typhoon
  • 75: Stellar Flare (Balance Druid)
  • 90: Shooting Stars (Balance Druid)
  • 100: Nature's Balance (Balance Druid)
  • Talent Calculator
Artifact
Professions
  • alchemy: 719
  • engineering: 713

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Kaptah 126133
Deadly Grace 4495 3.5% 21.9 10.80sec 90914 0 Direct 21.9 78909 157737 90911 15.2%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.91 21.91 0.00 0.00 0.0000 0.0000 1992249.89 1992249.89 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.58 84.77% 78909.29 66748 86772 78901.91 72209 84102 1465861 1465861 0.00
crit 3.34 15.23% 157736.72 133495 173544 152935.87 0 173544 526389 526389 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:5.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=47572 to 71358} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:47572.00
  • base_dd_max:71358.00
 
Full Moon 10795 8.6% 10.4 44.54sec 466130 176124 Direct 9.7 435103 870206 501151 15.2%  

Stats details: full_moon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.44 9.71 0.00 0.00 2.6466 0.0000 4864548.63 4864548.63 0.00 176124.14 176124.14
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.23 84.82% 435103.20 435103 435103 435103.20 435103 435103 3582084 3582084 0.00
crit 1.47 15.18% 870206.40 870206 870206 689620.51 0 870206 1282464 1282464 0.00
 
 

Action details: full_moon

Static Values
  • id:202771
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.9000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(charges=2&recharge_time<5)|charges=3|target.time_to_die<15
Spelldata
  • id:202771
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals $m1 Astral damage to the target and all enemies near the target, and resets Full Moon to become New Moon. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:18.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Half Moon 5998 4.8% 10.8 43.33sec 250596 145004 Direct 10.7 217552 435104 251310 15.5%  

Stats details: half_moon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.77 10.74 0.00 0.00 1.7283 0.0000 2699243.79 2699243.79 0.00 145003.70 145003.70
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.07 84.48% 217552.16 217552 217552 217552.16 217552 217552 1973939 1973939 0.00
crit 1.67 15.52% 435104.32 435104 435104 361259.73 0 435104 725304 725304 0.00
 
 

Action details: half_moon

Static Values
  • id:202768
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(charges=2&recharge_time<5)|charges=3|(target.time_to_die<15&charges=2)
Spelldata
  • id:202768
  • name:Half Moon
  • school:astral
  • tooltip:
  • description:Deals $m1 Astral damage to the target and empowers Half Moon to become Full Moon. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Lunar Strike 17211 13.7% 56.2 7.86sec 138024 79047 Direct 56.2 114753 229467 138023 20.3%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 56.17 56.17 0.00 0.00 1.7461 0.0000 7752853.91 7752853.91 0.00 79047.03 79047.03
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 44.78 79.71% 114753.39 110178 143231 114800.02 110867 118708 5138193 5138193 0.00
crit 11.39 20.29% 229467.34 220356 286463 229548.26 220356 264427 2614660 2614660 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.05
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.lunar_empowerment.stack=3
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 270.0%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Moonfire 9515 7.5% 21.1 21.94sec 203313 151661 Direct 21.1 24827 49638 28587 15.2%  
Periodic 256.4 12457 24913 14355 15.2% 99.8%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.07 21.07 256.42 256.42 1.3406 1.7531 4283059.16 4283059.16 0.00 8964.82 151661.03
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.87 84.85% 24827.40 24173 31425 24832.95 24173 25986 443771 443771 0.00
crit 3.19 15.15% 49637.78 48347 62851 48001.55 0 62851 158445 158445 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 217.3 84.76% 12456.83 107 15713 12458.70 12273 12636 2707398 2707398 0.00
crit 39.1 15.24% 24912.78 1053 31427 24917.31 23801 26506 973445 973445 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.natures_balance.enabled&remains<3)|(remains<6.6&!talent.natures_balance.enabled)
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=1 + 100.0%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}. Usable while in Bear Form.{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
New Moon 3078 2.4% 10.1 44.41sec 137432 103759 Direct 11.0 108777 217553 125397 15.3%  

Stats details: new_moon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.08 11.05 0.00 0.00 1.3246 0.0000 1385387.32 1385387.32 0.00 103758.79 103758.79
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.36 84.72% 108776.64 108777 108777 108776.64 108777 108777 1018186 1018186 0.00
crit 1.69 15.28% 217553.28 217553 217553 180522.01 0 217553 367201 367201 0.00
 
 

Action details: new_moon

Static Values
  • id:202767
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202767
  • name:New Moon
  • school:astral
  • tooltip:
  • description:Deals $m1 Astral damage to the target and empowers New Moon to become Half Moon. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Shooting Stars 1255 1.0% 51.1 8.67sec 11082 0 Direct 46.9 10474 20950 12065 15.2%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.06 46.90 0.00 0.00 0.0000 0.0000 565912.38 565912.38 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.78 84.81% 10473.84 10152 13198 10473.45 10152 11260 416629 416629 0.00
crit 7.13 15.19% 20950.40 20305 26396 20935.58 0 26396 149283 149283 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a {$s1=10}% chance to call down a falling star, dealing $202497m1 Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.420000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Solar Wrath 19367 15.4% 113.6 3.89sec 76703 64900 Direct 113.3 66750 133650 76946 15.2%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 113.65 113.29 0.00 0.00 1.1819 0.0000 8717202.79 8717202.79 0.00 64899.74 64899.74
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 96.02 84.76% 66750.33 48684 100795 66764.35 62644 71111 6409601 6409601 0.00
crit 17.27 15.24% 133649.65 97369 201590 133685.97 97369 168092 2307602 2307602 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack=3
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=1} Nature damage. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.900000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Starsurge 26787 21.2% 66.3 6.74sec 181912 138137 Direct 66.1 158167 316298 182342 15.3%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 66.28 66.12 0.00 0.00 1.3169 0.0000 12057122.54 12057122.54 0.00 138136.69 138136.69
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 56.02 84.71% 158166.72 151482 196927 158199.26 153502 162389 8859716 8859716 0.00
crit 10.11 15.29% 316298.40 302965 393854 316345.81 302965 375676 3197406 3197406 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.fury_of_elune_up.down&((astral_power>=92&cooldown.fury_of_elune.remains>gcd*3)|(cooldown.warrior_of_elune.remains<=5&cooldown.fury_of_elune.remains>=35&buff.lunar_empowerment.stack<2))
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=1} Astral damage. Also grants you Lunar and Solar Empowerments, which increase the damage of your next Lunar Strike and Solar Wrath by {$164547s1=20}%, respectively. You can accumulate up to {$164547u=3} of each Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Stellar Flare 18693 14.8% 19.4 23.76sec 434392 328187 Direct 19.4 71219 142767 82280 15.5%  
Periodic 254.9 23205 46379 26744 15.3% 99.3%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.36 19.36 254.87 254.87 1.3236 1.7546 8409140.72 8409140.72 0.00 17784.93 328187.20
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.36 84.54% 71218.90 48346 159410 71273.68 52269 98630 1165499 1165499 0.00
crit 2.99 15.46% 142767.15 96692 318820 137472.12 0 318820 427382 427382 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 215.9 84.73% 23205.35 345 51811 23227.70 17525 30561 5011219 5011219 0.00
crit 38.9 15.27% 46379.14 13503 103621 46401.54 32598 64810 1805040 1805040 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:15.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<7.2
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=1} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. Stellar Flare benefits from Starfall's Stellar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.650000
  • base_td:1.00
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Sunfire 8940 7.1% 12.9 36.05sec 311270 237957 Direct 12.9 24387 48767 28085 15.2%  
Periodic 255.1 12458 24918 14355 15.2% 99.3%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.93 12.93 255.11 255.11 1.3081 1.7528 4025277.67 4025277.67 0.00 8673.88 237956.83
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.97 84.83% 24387.36 24173 31425 24386.85 24173 26245 267539 267539 0.00
crit 1.96 15.17% 48766.62 48347 62851 42572.58 0 62851 95651 95651 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 216.3 84.78% 12458.00 47 15713 12459.91 12268 12619 2694345 2694345 0.00
crit 38.8 15.22% 24918.49 110 31427 24922.75 23558 26482 967742 967742 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.natures_balance.enabled&remains<3)|(remains<5.4&!talent.natures_balance.enabled)
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=1} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds} to the primary target and all enemies within $164815A2 yards.{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
Kaptah
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kaptah
  • harmful:false
  • if_expr:
 
Celestial Alignment 2.9 185.18sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.88 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Lunar and Solar spells damage increased by {$s1=30}%. Lunar Strike and Solar Wrath generate {$s3=50}% additional Astral Power.
  • description:Celestial bodies align, increasing the damage of all your spells by {$s1=30}%, and increasing the Astral Power generated by Lunar Strike and Solar Wrath by {$s3=50}%. Lasts {$d=15 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kaptah
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kaptah
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Arcane and Nature damage done increased by {$s8=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing your Arcane and Nature damage by {$s8=10}% and your armor by $m3%, and granting protection from Polymorph effects. While in this form, single-target attacks against you have a {$h=15}% chance make your next damaging spell instant. The act of shapeshifting frees you from movement impairing effects.
 
Nithramus 4.1 120.62sec

Stats details: nithramus

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.12 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: nithramus

Static Values
  • id:187625
  • school:arcane
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187625
  • name:Nithramus
  • school:arcane
  • tooltip:
  • description:{$@spelldesc187611=Awakens the powers of all the Savage Hallows worn by you and your allies, increasing damage dealt by ${$<WarlordsTrinketNerf>*$m1/100}% for {$187620d=15 seconds}. When this effect ends, each empowered player unleashes a blast of light that strikes all enemies within $187626A1 yards of the initiating player's location, inflicting damage equal to ${$m1/100}% of all damage they dealt while empowered. (2 min shared cooldown)}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:2098735.99
  • base_dd_max:2098735.99
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 11.14% 0.0(0.0) 1.0

Buff details

  • buff initial source:Kaptah
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 2.9 0.0 185.1sec 185.1sec 9.47% 9.54% 0.0(0.0) 2.8

Buff details

  • buff initial source:Kaptah
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30

Stack Uptimes

  • celestial_alignment_1:9.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Lunar and Solar spells damage increased by {$s1=30}%. Lunar Strike and Solar Wrath generate {$s3=50}% additional Astral Power.
  • description:Celestial bodies align, increasing the damage of all your spells by {$s1=30}%, and increasing the Astral Power generated by Lunar Strike and Solar Wrath by {$s3=50}%. Lasts {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Lightning Charged 7.0 1.4 60.3sec 48.6sec 20.27% 20.33% 1.4(1.4) 6.8

Buff details

  • buff initial source:Kaptah
  • cooldown name:buff_lightning_charged
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:1181.00

Stack Uptimes

  • lightning_charged_1:20.27%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202886
  • name:Lightning Charged
  • tooltip:Haste increased by {$s1=3964}.
  • description:{$@spelldesc202887=Your spells have a chance to increase your Haste by {$202886s1=3964} for {$202886d=12 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Lunar Empowerment 54.4 11.9 8.2sec 6.7sec 66.28% 50.41% 0.0(0.0) 0.0

Buff details

  • buff initial source:Kaptah
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • lunar_empowerment_1:54.60%
  • lunar_empowerment_2:11.51%
  • lunar_empowerment_3:0.17%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:The damage of your next Lunar Strike is increased by $w1%$?$w2>0[, and its cast time is reduced by $w2%][].
  • description:Increases the damage of your next Lunar Strike within {$d=40 seconds} by {$s1=20}%.
  • max_stacks:3
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Nithramus 4.3 0.0 120.6sec 120.7sec 14.10% 14.15% 0.0(0.0) 4.1

Buff details

  • buff initial source:Kaptah
  • cooldown name:buff_nithramus
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • nithramus_1:14.10%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187616
  • name:Nithramus
  • tooltip:$?$w1>0[Damage dealt increased by $w1%. When this effect ends, the triggering ally will explode for $w1% of all damage dealt while empowered.][Contributing toward the master's Savage Hollows.]
  • description:{$@spelldesc187611=Awakens the powers of all the Savage Hallows worn by you and your allies, increasing damage dealt by ${$<WarlordsTrinketNerf>*$m1/100}% for {$187620d=15 seconds}. When this effect ends, each empowered player unleashes a blast of light that strikes all enemies within $187626A1 yards of the initiating player's location, inflicting damage equal to ${$m1/100}% of all damage they dealt while empowered. (2 min shared cooldown)}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Potion of Deadly Grace 2.0 0.0 193.4sec 0.0sec 10.83% 10.89% 0.0(0.0) 2.0

Buff details

  • buff initial source:Kaptah
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:10.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Solar Empowerment 62.2 4.1 7.2sec 6.7sec 39.69% 33.75% 0.0(0.0) 0.0

Buff details

  • buff initial source:Kaptah
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • solar_empowerment_1:37.42%
  • solar_empowerment_2:2.27%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:The damage of your next Solar Wrath is increased by $w1%$?$w2>0[, and its cast time is reduced by $w2%][].
  • description:Increases the damage of your next Solar Wrath within {$d=40 seconds} by {$s1=20}%.
  • max_stacks:3
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Kaptah
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Kaptah
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Kaptah
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:Kaptah
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Arcane and Nature damage done increased by {$s8=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing your Arcane and Nature damage by {$s8=10}% and your armor by $m3%, and granting protection from Polymorph effects. While in this form, single-target attacks against you have a {$h=15}% chance make your next damaging spell instant. The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:15.00%

Resources

Resource Usage Type Count Total Average RPE APR
Kaptah
starsurge Astral Power 66.3 2651.2 40.0 40.0 4547.8
stellar_flare Astral Power 19.4 290.4 15.0 15.0 28959.9
Resource Gains Type Count Total Average Overflow
new_moon Astral Power 11.08 110.80 (3.74%) 10.00 0.00 0.00%
half_moon Astral Power 10.77 215.43 (7.27%) 20.00 0.00 0.00%
full_moon Astral Power 10.44 417.42 (14.08%) 40.00 0.01 0.00%
moonfire Astral Power 21.07 210.66 (7.11%) 10.00 0.00 0.00%
shooting_stars Astral Power 51.06 204.24 (6.89%) 4.00 0.02 0.01%
sunfire Astral Power 12.93 129.31 (4.36%) 10.00 0.01 0.01%
solar_wrath Astral Power 113.65 955.83 (32.24%) 8.41 0.00 0.00%
lunar_strike Astral Power 56.17 720.66 (24.31%) 12.83 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 6.58 6.53
Combat End Resource Mean Min Max
Mana 704000.00 704000.00 704000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 23.07 0.00 92.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Kaptah Fight Length
Count 9999
Mean 450.42
Minimum 350.15
Maximum 555.44
Spread ( max - min ) 205.29
Range [ ( max - min ) / 2 * 100% ] 22.79%
DPS
Sample Data Kaptah Damage Per Second
Count 9999
Mean 126133.47
Minimum 117917.36
Maximum 137458.70
Spread ( max - min ) 19541.34
Range [ ( max - min ) / 2 * 100% ] 7.75%
Standard Deviation 2646.3507
5th Percentile 121973.98
95th Percentile 130637.29
( 95th Percentile - 5th Percentile ) 8663.30
Mean Distribution
Standard Deviation 26.4648
95.00% Confidence Intervall ( 126081.60 - 126185.34 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 16
0.1% Error 1690
0.1 Scale Factor Error with Delta=300 59783
0.05 Scale Factor Error with Delta=300 239132
0.01 Scale Factor Error with Delta=300 5978310
Priority Target DPS
Sample Data Kaptah Priority Target Damage Per Second
Count 9999
Mean 126133.47
Minimum 117917.36
Maximum 137458.70
Spread ( max - min ) 19541.34
Range [ ( max - min ) / 2 * 100% ] 7.75%
Standard Deviation 2646.3507
5th Percentile 121973.98
95th Percentile 130637.29
( 95th Percentile - 5th Percentile ) 8663.30
Mean Distribution
Standard Deviation 26.4648
95.00% Confidence Intervall ( 126081.60 - 126185.34 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 16
0.1% Error 1690
0.1 Scale Factor Error with Delta=300 59783
0.05 Scale Factor Error with Delta=300 239132
0.01 Scale Factor Error with Delta=300 5978310
DPS(e)
Sample Data Kaptah Damage Per Second (Effective)
Count 9999
Mean 126133.47
Minimum 117917.36
Maximum 137458.70
Spread ( max - min ) 19541.34
Range [ ( max - min ) / 2 * 100% ] 7.75%
Damage
Sample Data Kaptah Damage
Count 9999
Mean 56751998.79
Minimum 43788658.28
Maximum 71902328.52
Spread ( max - min ) 28113670.24
Range [ ( max - min ) / 2 * 100% ] 24.77%
DTPS
Sample Data Kaptah Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Kaptah Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Kaptah Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Kaptah Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Kaptah Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Kaptah Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data KaptahTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Kaptah Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 augmentation,type=defiled
3 0.00 moonkin_form
4 0.00 blessing_of_elune
5 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
6 0.00 potion,name=deadly_grace
7 0.00 new_moon
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 potion,name=deadly_grace,if=buff.celestial_alignment.up|buff.incarnation.up
0.00 blood_fury,if=buff.celestial_alignment.up|buff.incarnation.up
0.00 berserking,if=buff.celestial_alignment.up|buff.incarnation.up
0.00 arcane_torrent,if=buff.celestial_alignment.up|buff.incarnation.up
9 4.31 use_item,slot=finger1
A 0.00 call_action_list,name=fury_of_elune,if=talent.fury_of_elune.enabled&cooldown.fury_of_elune.remains<target.time_to_die
0.00 new_moon,if=(charges=2&recharge_time<5)|charges=3
B 0.00 half_moon,if=(charges=2&recharge_time<5)|charges=3|(target.time_to_die<15&charges=2)
C 0.36 full_moon,if=(charges=2&recharge_time<5)|charges=3|target.time_to_die<15
D 19.41 stellar_flare,if=remains<7.2
E 21.07 moonfire,if=(talent.natures_balance.enabled&remains<3)|(remains<6.6&!talent.natures_balance.enabled)
F 12.93 sunfire,if=(talent.natures_balance.enabled&remains<3)|(remains<5.4&!talent.natures_balance.enabled)
0.00 astral_communion,if=astral_power.deficit>=75
0.00 incarnation,if=astral_power>=40
G 2.88 celestial_alignment,if=astral_power>=40
0.00 solar_wrath,if=buff.solar_empowerment.stack=3
H 0.24 lunar_strike,if=buff.lunar_empowerment.stack=3
I 0.00 call_action_list,name=celestial_alignment_phase,if=buff.celestial_alignment.up|buff.incarnation.up
J 0.00 call_action_list,name=single_target
actions.celestial_alignment_phase
# count action,conditions
K 9.74 starsurge
0.00 warrior_of_elune,if=buff.lunar_empowerment.stack>=2&((astral_power<=70&buff.blessing_of_elune.down)|(astral_power<=58&buff.blessing_of_elune.up))
0.00 lunar_strike,if=buff.warrior_of_elune.up
L 9.17 solar_wrath,if=buff.solar_empowerment.up
M 8.61 lunar_strike,if=buff.lunar_empowerment.up
0.00 solar_wrath,if=talent.natures_balance.enabled&dot.sunfire_dmg.remains<5&cast_time<dot.sunfire_dmg.remains
0.00 lunar_strike,if=talent.natures_balance.enabled&dot.moonfire_dmg.remains<5&cast_time<dot.moonfire_dmg.remains
N 3.04 solar_wrath
actions.single_target
# count action,conditions
O 10.10 new_moon,if=astral_power<=90
P 10.81 half_moon,if=astral_power<=80
Q 10.14 full_moon,if=astral_power<=60
R 56.54 starsurge
0.00 warrior_of_elune,if=buff.lunar_empowerment.stack>=2&((astral_power<=80&buff.blessing_of_elune.down)|(astral_power<=72&buff.blessing_of_elune.up))
0.00 lunar_strike,if=buff.warrior_of_elune.up
S 53.62 solar_wrath,if=buff.solar_empowerment.up
T 47.54 lunar_strike,if=buff.lunar_empowerment.up
0.00 solar_wrath,if=talent.natures_balance.enabled&dot.sunfire_dmg.remains<5&cast_time<dot.sunfire_dmg.remains
0.00 lunar_strike,if=talent.natures_balance.enabled&dot.moonfire_dmg.remains<5&cast_time<dot.moonfire_dmg.remains
U 48.11 solar_wrath

Sample Sequence

0123679EDFPQGKKLLMKLMMKLMDEKOSTURSTPFRSTURSTUERSQDRSTUUURSOTERSTDUUURPFSRSTTERSQDRSTURSTUOREFSTRSDUU9PRSTUUERSTQRSDUURSTUUEORSTFRSTDUPRSTUERSTUQRSRSTDFUUEG8KLMKLMNKLMDOPRESTRFSQRSRHSTDUE9ORSTURSTUURPSTDEFRSTURQRSSTTRSEDOUUUURSTUURPFSERDTUUUQRSRSTTRESODUURSTUURSTFPERSRSTDU9QRSTRSTEUROFSDUUGKLMNKLMEKLMPRSDQRSTFRSETROSTRSTDUUURPESRSTTUR

Sample Sequence Table

time name target resources buffs
Pre flask Kaptah 0.0/100: 0% astral_power | 0.0/100: 0% rage
Pre food Kaptah 0.0/100: 0% astral_power | 0.0/100: 0% rage
Pre augmentation Kaptah 0.0/100: 0% astral_power | 0.0/100: 0% rage
Pre moonkin_form Fluffy_Pillow 0.0/100: 0% astral_power | 0.0/100: 0% rage
Pre potion Fluffy_Pillow 0.0/100: 0% astral_power | 0.0/100: 0% rage potion_of_deadly_grace
0:00.000 new_moon Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage potion_of_deadly_grace
0:00.000 use_item_nithramus_the_allseer Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage potion_of_deadly_grace
0:00.000 moonfire Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage nithramus, potion_of_deadly_grace
0:01.279 stellar_flare Fluffy_Pillow 20.0/100: 20% astral_power | 0.0/100: 0% rage bloodlust, nithramus, potion_of_deadly_grace
0:02.331 sunfire Fluffy_Pillow 5.0/100: 5% astral_power | 0.0/100: 0% rage bloodlust, nithramus, potion_of_deadly_grace
0:03.380 half_moon Fluffy_Pillow 15.0/100: 15% astral_power | 0.0/100: 0% rage bloodlust, nithramus, potion_of_deadly_grace
0:04.780 full_moon Fluffy_Pillow 35.0/100: 35% astral_power | 0.0/100: 0% rage bloodlust, nithramus, potion_of_deadly_grace
0:06.876 celestial_alignment Fluffy_Pillow 79.0/100: 79% astral_power | 0.0/100: 0% rage bloodlust, nithramus, potion_of_deadly_grace
0:06.876 starsurge Fluffy_Pillow 79.0/100: 79% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, nithramus, potion_of_deadly_grace
0:07.926 starsurge Fluffy_Pillow 43.0/100: 43% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, nithramus, potion_of_deadly_grace
0:08.970 solar_wrath Fluffy_Pillow 3.0/100: 3% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), nithramus, lightning_charged, potion_of_deadly_grace
0:09.784 solar_wrath Fluffy_Pillow 19.0/100: 19% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, lunar_empowerment(2), solar_empowerment, nithramus, lightning_charged, potion_of_deadly_grace
0:10.597 lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, lunar_empowerment(2), nithramus, lightning_charged, potion_of_deadly_grace
0:11.952 starsurge Fluffy_Pillow 49.0/100: 49% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, lunar_empowerment, nithramus, lightning_charged, potion_of_deadly_grace
0:12.967 solar_wrath Fluffy_Pillow 9.0/100: 9% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, lunar_empowerment(2), solar_empowerment, nithramus, lightning_charged, potion_of_deadly_grace
0:13.780 lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, lunar_empowerment(2), nithramus, lightning_charged, potion_of_deadly_grace
0:15.134 lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, lunar_empowerment, lightning_charged, potion_of_deadly_grace
0:16.487 starsurge Fluffy_Pillow 57.0/100: 57% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, lightning_charged, potion_of_deadly_grace
0:17.504 solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, lightning_charged, potion_of_deadly_grace
0:18.316 lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, lunar_empowerment, lightning_charged, potion_of_deadly_grace
0:19.670 stellar_flare Fluffy_Pillow 47.0/100: 47% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, lightning_charged, potion_of_deadly_grace
0:20.685 moonfire Fluffy_Pillow 32.0/100: 32% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, lightning_charged, potion_of_deadly_grace
0:21.729 starsurge Fluffy_Pillow 46.0/100: 46% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, potion_of_deadly_grace
0:22.781 new_moon Fluffy_Pillow 6.0/100: 6% astral_power | 0.0/100: 0% rage bloodlust, lunar_empowerment, solar_empowerment, potion_of_deadly_grace
0:23.831 solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power | 0.0/100: 0% rage bloodlust, lunar_empowerment, solar_empowerment
0:24.671 lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power | 0.0/100: 0% rage bloodlust, lunar_empowerment
0:26.069 solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power | 0.0/100: 0% rage bloodlust
0:27.120 starsurge Fluffy_Pillow 44.0/100: 44% astral_power | 0.0/100: 0% rage bloodlust
0:28.170 solar_wrath Fluffy_Pillow 4.0/100: 4% astral_power | 0.0/100: 0% rage bloodlust, lunar_empowerment, solar_empowerment
0:29.011 lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power | 0.0/100: 0% rage bloodlust, lunar_empowerment
0:30.411 half_moon Fluffy_Pillow 24.0/100: 24% astral_power | 0.0/100: 0% rage bloodlust
0:31.811 sunfire Fluffy_Pillow 44.0/100: 44% astral_power | 0.0/100: 0% rage bloodlust
0:32.863 starsurge Fluffy_Pillow 54.0/100: 54% astral_power | 0.0/100: 0% rage bloodlust
0:33.913 solar_wrath Fluffy_Pillow 14.0/100: 14% astral_power | 0.0/100: 0% rage bloodlust, lunar_empowerment, solar_empowerment
0:34.754 lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power | 0.0/100: 0% rage bloodlust, lunar_empowerment
0:36.153 solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power | 0.0/100: 0% rage bloodlust
0:37.203 starsurge Fluffy_Pillow 42.0/100: 42% astral_power | 0.0/100: 0% rage bloodlust
0:38.254 solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power | 0.0/100: 0% rage bloodlust, lunar_empowerment, solar_empowerment
0:39.096 lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power | 0.0/100: 0% rage bloodlust, lunar_empowerment
0:40.495 solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power | 0.0/100: 0% rage bloodlust
0:41.706 moonfire Fluffy_Pillow 34.0/100: 34% astral_power | 0.0/100: 0% rage
0:43.070 starsurge Fluffy_Pillow 44.0/100: 44% astral_power | 0.0/100: 0% rage
0:44.434 solar_wrath Fluffy_Pillow 4.0/100: 4% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
0:45.526 full_moon Fluffy_Pillow 12.0/100: 12% astral_power | 0.0/100: 0% rage lunar_empowerment
0:48.250 stellar_flare Fluffy_Pillow 56.0/100: 56% astral_power | 0.0/100: 0% rage lunar_empowerment
0:49.613 starsurge Fluffy_Pillow 41.0/100: 41% astral_power | 0.0/100: 0% rage
0:50.978 solar_wrath Fluffy_Pillow 1.0/100: 1% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
0:52.071 lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power | 0.0/100: 0% rage lunar_empowerment
0:53.889 solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power | 0.0/100: 0% rage
0:55.253 solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power | 0.0/100: 0% rage
0:56.617 solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power | 0.0/100: 0% rage
0:57.980 starsurge Fluffy_Pillow 45.0/100: 45% astral_power | 0.0/100: 0% rage
0:59.342 solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
1:00.436 new_moon Fluffy_Pillow 13.0/100: 13% astral_power | 0.0/100: 0% rage lunar_empowerment
1:01.799 lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power | 0.0/100: 0% rage lunar_empowerment
1:03.615 moonfire Fluffy_Pillow 35.0/100: 35% astral_power | 0.0/100: 0% rage
1:04.981 starsurge Fluffy_Pillow 45.0/100: 45% astral_power | 0.0/100: 0% rage
1:06.345 solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
1:07.438 lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power | 0.0/100: 0% rage lunar_empowerment
1:09.257 stellar_flare Fluffy_Pillow 29.0/100: 29% astral_power | 0.0/100: 0% rage
1:10.621 solar_wrath Fluffy_Pillow 14.0/100: 14% astral_power | 0.0/100: 0% rage
1:11.984 solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power | 0.0/100: 0% rage
1:13.348 solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power | 0.0/100: 0% rage
1:14.712 starsurge Fluffy_Pillow 42.0/100: 42% astral_power | 0.0/100: 0% rage
1:16.077 half_moon Fluffy_Pillow 2.0/100: 2% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
1:17.895 sunfire Fluffy_Pillow 22.0/100: 22% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
1:19.261 solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
1:20.353 starsurge Fluffy_Pillow 44.0/100: 44% astral_power | 0.0/100: 0% rage lunar_empowerment
1:21.717 solar_wrath Fluffy_Pillow 4.0/100: 4% astral_power | 0.0/100: 0% rage lunar_empowerment(2), solar_empowerment
1:22.811 lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power | 0.0/100: 0% rage lunar_empowerment(2)
1:24.627 lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power | 0.0/100: 0% rage lunar_empowerment
1:26.444 moonfire Fluffy_Pillow 36.0/100: 36% astral_power | 0.0/100: 0% rage
1:27.810 starsurge Fluffy_Pillow 46.0/100: 46% astral_power | 0.0/100: 0% rage
1:29.174 solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
1:30.268 full_moon Fluffy_Pillow 18.0/100: 18% astral_power | 0.0/100: 0% rage lunar_empowerment
1:32.994 stellar_flare Fluffy_Pillow 62.0/100: 62% astral_power | 0.0/100: 0% rage lunar_empowerment
1:34.359 starsurge Fluffy_Pillow 47.0/100: 47% astral_power | 0.0/100: 0% rage
1:35.724 solar_wrath Fluffy_Pillow 15.0/100: 15% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
1:36.816 lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power | 0.0/100: 0% rage lunar_empowerment
1:38.632 solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power | 0.0/100: 0% rage
1:39.995 starsurge Fluffy_Pillow 43.0/100: 43% astral_power | 0.0/100: 0% rage
1:41.358 solar_wrath Fluffy_Pillow 3.0/100: 3% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
1:42.450 lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power | 0.0/100: 0% rage lunar_empowerment
1:44.268 solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power | 0.0/100: 0% rage
1:45.633 new_moon Fluffy_Pillow 35.0/100: 35% astral_power | 0.0/100: 0% rage
1:46.997 starsurge Fluffy_Pillow 45.0/100: 45% astral_power | 0.0/100: 0% rage
1:48.360 moonfire Fluffy_Pillow 9.0/100: 9% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
1:49.726 sunfire Fluffy_Pillow 19.0/100: 19% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
1:51.090 solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
1:52.183 lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power | 0.0/100: 0% rage lunar_empowerment
1:54.000 starsurge Fluffy_Pillow 49.0/100: 49% astral_power | 0.0/100: 0% rage
1:55.364 solar_wrath Fluffy_Pillow 9.0/100: 9% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
1:56.456 stellar_flare Fluffy_Pillow 17.0/100: 17% astral_power | 0.0/100: 0% rage lunar_empowerment
1:57.821 solar_wrath Fluffy_Pillow 2.0/100: 2% astral_power | 0.0/100: 0% rage
1:59.185 solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage
2:00.547 use_item_nithramus_the_allseer Fluffy_Pillow 22.0/100: 22% astral_power | 0.0/100: 0% rage
2:00.547 half_moon Fluffy_Pillow 22.0/100: 22% astral_power | 0.0/100: 0% rage nithramus
2:02.365 starsurge Fluffy_Pillow 42.0/100: 42% astral_power | 0.0/100: 0% rage nithramus
2:03.732 solar_wrath Fluffy_Pillow 2.0/100: 2% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment, nithramus
2:04.826 lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage lunar_empowerment, nithramus
2:06.645 solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power | 0.0/100: 0% rage nithramus
2:08.009 solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power | 0.0/100: 0% rage nithramus
2:09.374 moonfire Fluffy_Pillow 42.0/100: 42% astral_power | 0.0/100: 0% rage nithramus
2:10.740 starsurge Fluffy_Pillow 52.0/100: 52% astral_power | 0.0/100: 0% rage nithramus
2:12.103 solar_wrath Fluffy_Pillow 12.0/100: 12% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment, nithramus
2:13.195 lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power | 0.0/100: 0% rage lunar_empowerment, nithramus
2:15.013 full_moon Fluffy_Pillow 32.0/100: 32% astral_power | 0.0/100: 0% rage nithramus
2:17.739 starsurge Fluffy_Pillow 72.0/100: 72% astral_power | 0.0/100: 0% rage
2:19.104 solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
2:20.197 stellar_flare Fluffy_Pillow 40.0/100: 40% astral_power | 0.0/100: 0% rage lunar_empowerment
2:21.562 solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power | 0.0/100: 0% rage
2:22.926 solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power | 0.0/100: 0% rage lightning_charged
2:24.247 starsurge Fluffy_Pillow 45.0/100: 45% astral_power | 0.0/100: 0% rage lightning_charged
2:25.570 solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment, lightning_charged
2:26.626 lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power | 0.0/100: 0% rage lunar_empowerment, lightning_charged
2:28.386 solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power | 0.0/100: 0% rage lightning_charged
2:29.706 solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power | 0.0/100: 0% rage lightning_charged
2:31.026 moonfire Fluffy_Pillow 41.0/100: 41% astral_power | 0.0/100: 0% rage lightning_charged
2:32.346 new_moon Fluffy_Pillow 51.0/100: 51% astral_power | 0.0/100: 0% rage lightning_charged
2:33.666 starsurge Fluffy_Pillow 61.0/100: 61% astral_power | 0.0/100: 0% rage lightning_charged
2:35.016 solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
2:36.108 lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power | 0.0/100: 0% rage lunar_empowerment
2:37.926 sunfire Fluffy_Pillow 41.0/100: 41% astral_power | 0.0/100: 0% rage
2:39.290 starsurge Fluffy_Pillow 51.0/100: 51% astral_power | 0.0/100: 0% rage
2:40.655 solar_wrath Fluffy_Pillow 11.0/100: 11% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
2:41.749 lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power | 0.0/100: 0% rage lunar_empowerment
2:43.567 stellar_flare Fluffy_Pillow 31.0/100: 31% astral_power | 0.0/100: 0% rage
2:44.932 solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power | 0.0/100: 0% rage
2:46.296 half_moon Fluffy_Pillow 24.0/100: 24% astral_power | 0.0/100: 0% rage
2:48.113 starsurge Fluffy_Pillow 44.0/100: 44% astral_power | 0.0/100: 0% rage
2:49.477 solar_wrath Fluffy_Pillow 4.0/100: 4% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
2:50.570 lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power | 0.0/100: 0% rage lunar_empowerment
2:52.389 solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power | 0.0/100: 0% rage
2:53.753 moonfire Fluffy_Pillow 32.0/100: 32% astral_power | 0.0/100: 0% rage
2:55.117 starsurge Fluffy_Pillow 42.0/100: 42% astral_power | 0.0/100: 0% rage
2:56.480 solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
2:57.573 lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power | 0.0/100: 0% rage lunar_empowerment
2:59.390 solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power | 0.0/100: 0% rage
3:00.755 full_moon Fluffy_Pillow 38.0/100: 38% astral_power | 0.0/100: 0% rage
3:03.478 starsurge Fluffy_Pillow 78.0/100: 78% astral_power | 0.0/100: 0% rage
3:04.841 solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
3:05.932 starsurge Fluffy_Pillow 46.0/100: 46% astral_power | 0.0/100: 0% rage lunar_empowerment
3:07.297 solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power | 0.0/100: 0% rage lunar_empowerment(2), solar_empowerment
3:08.391 lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power | 0.0/100: 0% rage lunar_empowerment(2)
3:10.208 stellar_flare Fluffy_Pillow 26.0/100: 26% astral_power | 0.0/100: 0% rage lunar_empowerment
3:11.573 sunfire Fluffy_Pillow 11.0/100: 11% astral_power | 0.0/100: 0% rage
3:12.938 solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power | 0.0/100: 0% rage
3:14.303 solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power | 0.0/100: 0% rage
3:15.668 moonfire Fluffy_Pillow 41.0/100: 41% astral_power | 0.0/100: 0% rage
3:17.032 celestial_alignment Fluffy_Pillow 51.0/100: 51% astral_power | 0.0/100: 0% rage
3:17.032 potion Fluffy_Pillow 51.0/100: 51% astral_power | 0.0/100: 0% rage celestial_alignment
3:17.032 starsurge Fluffy_Pillow 51.0/100: 51% astral_power | 0.0/100: 0% rage celestial_alignment, potion_of_deadly_grace
3:18.396 solar_wrath Fluffy_Pillow 11.0/100: 11% astral_power | 0.0/100: 0% rage celestial_alignment, lunar_empowerment, solar_empowerment, potion_of_deadly_grace
3:19.487 lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power | 0.0/100: 0% rage celestial_alignment, lunar_empowerment, potion_of_deadly_grace
3:21.305 starsurge Fluffy_Pillow 41.0/100: 41% astral_power | 0.0/100: 0% rage celestial_alignment, potion_of_deadly_grace
3:22.671 solar_wrath Fluffy_Pillow 1.0/100: 1% astral_power | 0.0/100: 0% rage celestial_alignment, lunar_empowerment, solar_empowerment, potion_of_deadly_grace
3:23.765 lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power | 0.0/100: 0% rage celestial_alignment, lunar_empowerment, potion_of_deadly_grace
3:25.584 solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power | 0.0/100: 0% rage celestial_alignment, potion_of_deadly_grace
3:26.949 starsurge Fluffy_Pillow 47.0/100: 47% astral_power | 0.0/100: 0% rage celestial_alignment, potion_of_deadly_grace
3:28.313 solar_wrath Fluffy_Pillow 11.0/100: 11% astral_power | 0.0/100: 0% rage celestial_alignment, lunar_empowerment, solar_empowerment, potion_of_deadly_grace
3:29.406 lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power | 0.0/100: 0% rage celestial_alignment, lunar_empowerment, potion_of_deadly_grace
3:31.223 stellar_flare Fluffy_Pillow 41.0/100: 41% astral_power | 0.0/100: 0% rage celestial_alignment, potion_of_deadly_grace
3:32.586 new_moon Fluffy_Pillow 26.0/100: 26% astral_power | 0.0/100: 0% rage potion_of_deadly_grace
3:33.952 half_moon Fluffy_Pillow 36.0/100: 36% astral_power | 0.0/100: 0% rage potion_of_deadly_grace
3:35.768 starsurge Fluffy_Pillow 60.0/100: 60% astral_power | 0.0/100: 0% rage potion_of_deadly_grace
3:37.132 moonfire Fluffy_Pillow 20.0/100: 20% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment, potion_of_deadly_grace
3:38.495 solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment, potion_of_deadly_grace
3:39.590 lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power | 0.0/100: 0% rage lunar_empowerment, potion_of_deadly_grace
3:41.409 starsurge Fluffy_Pillow 50.0/100: 50% astral_power | 0.0/100: 0% rage potion_of_deadly_grace
3:42.772 sunfire Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
3:44.137 solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
3:45.231 full_moon Fluffy_Pillow 32.0/100: 32% astral_power | 0.0/100: 0% rage lunar_empowerment
3:47.956 starsurge Fluffy_Pillow 72.0/100: 72% astral_power | 0.0/100: 0% rage lunar_empowerment
3:49.321 solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power | 0.0/100: 0% rage lunar_empowerment(2), solar_empowerment
3:50.413 starsurge Fluffy_Pillow 40.0/100: 40% astral_power | 0.0/100: 0% rage lunar_empowerment(2)
3:51.777 lunar_strike Fluffy_Pillow 0.0/100: 0% astral_power | 0.0/100: 0% rage lunar_empowerment(3), solar_empowerment
3:53.595 solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power | 0.0/100: 0% rage lunar_empowerment(2), solar_empowerment
3:54.686 lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power | 0.0/100: 0% rage lunar_empowerment(2)
3:56.502 stellar_flare Fluffy_Pillow 40.0/100: 40% astral_power | 0.0/100: 0% rage lunar_empowerment, lightning_charged
3:57.823 solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power | 0.0/100: 0% rage lightning_charged
3:59.144 moonfire Fluffy_Pillow 33.0/100: 33% astral_power | 0.0/100: 0% rage lightning_charged
4:00.464 use_item_nithramus_the_allseer Fluffy_Pillow 43.0/100: 43% astral_power | 0.0/100: 0% rage lightning_charged
4:00.547 new_moon Fluffy_Pillow 43.0/100: 43% astral_power | 0.0/100: 0% rage nithramus, lightning_charged
4:01.867 starsurge Fluffy_Pillow 53.0/100: 53% astral_power | 0.0/100: 0% rage nithramus, lightning_charged
4:03.187 solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment, nithramus, lightning_charged
4:04.243 lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power | 0.0/100: 0% rage lunar_empowerment, nithramus, lightning_charged
4:06.002 solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power | 0.0/100: 0% rage nithramus, lightning_charged
4:07.321 starsurge Fluffy_Pillow 41.0/100: 41% astral_power | 0.0/100: 0% rage nithramus, lightning_charged
4:08.663 solar_wrath Fluffy_Pillow 1.0/100: 1% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment, nithramus
4:09.755 lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power | 0.0/100: 0% rage lunar_empowerment, nithramus
4:11.571 solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power | 0.0/100: 0% rage nithramus
4:12.935 solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power | 0.0/100: 0% rage nithramus
4:14.300 starsurge Fluffy_Pillow 45.0/100: 45% astral_power | 0.0/100: 0% rage nithramus
4:15.665 half_moon Fluffy_Pillow 5.0/100: 5% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
4:17.480 solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment, lightning_charged
4:18.536 lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power | 0.0/100: 0% rage lunar_empowerment, lightning_charged
4:20.296 stellar_flare Fluffy_Pillow 49.0/100: 49% astral_power | 0.0/100: 0% rage lightning_charged
4:21.617 moonfire Fluffy_Pillow 34.0/100: 34% astral_power | 0.0/100: 0% rage lightning_charged
4:22.936 sunfire Fluffy_Pillow 44.0/100: 44% astral_power | 0.0/100: 0% rage lightning_charged
4:24.254 starsurge Fluffy_Pillow 54.0/100: 54% astral_power | 0.0/100: 0% rage lightning_charged
4:25.574 solar_wrath Fluffy_Pillow 14.0/100: 14% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment, lightning_charged
4:26.628 lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power | 0.0/100: 0% rage lunar_empowerment, lightning_charged
4:28.388 solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power | 0.0/100: 0% rage lightning_charged
4:29.738 starsurge Fluffy_Pillow 42.0/100: 42% astral_power | 0.0/100: 0% rage
4:31.076 full_moon Fluffy_Pillow 2.0/100: 2% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment, lightning_charged
4:33.713 starsurge Fluffy_Pillow 42.0/100: 42% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment, lightning_charged
4:35.033 solar_wrath Fluffy_Pillow 2.0/100: 2% astral_power | 0.0/100: 0% rage lunar_empowerment(2), solar_empowerment(2), lightning_charged
4:36.090 solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage lunar_empowerment(2), solar_empowerment, lightning_charged
4:37.147 lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power | 0.0/100: 0% rage lunar_empowerment(2), lightning_charged
4:38.907 lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power | 0.0/100: 0% rage lunar_empowerment, lightning_charged
4:40.667 starsurge Fluffy_Pillow 42.0/100: 42% astral_power | 0.0/100: 0% rage lightning_charged
4:41.988 solar_wrath Fluffy_Pillow 2.0/100: 2% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment, lightning_charged
4:43.070 moonfire Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage lunar_empowerment
4:44.435 stellar_flare Fluffy_Pillow 20.0/100: 20% astral_power | 0.0/100: 0% rage lunar_empowerment
4:45.799 new_moon Fluffy_Pillow 5.0/100: 5% astral_power | 0.0/100: 0% rage
4:47.163 solar_wrath Fluffy_Pillow 15.0/100: 15% astral_power | 0.0/100: 0% rage
4:48.527 solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power | 0.0/100: 0% rage
4:49.893 solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power | 0.0/100: 0% rage
4:51.258 solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power | 0.0/100: 0% rage
4:52.621 starsurge Fluffy_Pillow 47.0/100: 47% astral_power | 0.0/100: 0% rage
4:53.986 solar_wrath Fluffy_Pillow 7.0/100: 7% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
4:55.080 lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power | 0.0/100: 0% rage lunar_empowerment
4:56.897 solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power | 0.0/100: 0% rage
4:58.261 solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power | 0.0/100: 0% rage
4:59.626 starsurge Fluffy_Pillow 47.0/100: 47% astral_power | 0.0/100: 0% rage
5:00.992 half_moon Fluffy_Pillow 7.0/100: 7% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
5:02.810 sunfire Fluffy_Pillow 27.0/100: 27% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
5:04.175 solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
5:05.268 moonfire Fluffy_Pillow 45.0/100: 45% astral_power | 0.0/100: 0% rage lunar_empowerment
5:06.632 starsurge Fluffy_Pillow 55.0/100: 55% astral_power | 0.0/100: 0% rage lunar_empowerment
5:07.997 stellar_flare Fluffy_Pillow 15.0/100: 15% astral_power | 0.0/100: 0% rage lunar_empowerment(2), solar_empowerment
5:09.360 lunar_strike Fluffy_Pillow 0.0/100: 0% astral_power | 0.0/100: 0% rage lunar_empowerment
5:11.177 solar_wrath Fluffy_Pillow 12.0/100: 12% astral_power | 0.0/100: 0% rage
5:12.542 solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power | 0.0/100: 0% rage
5:13.907 solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power | 0.0/100: 0% rage
5:15.271 full_moon Fluffy_Pillow 36.0/100: 36% astral_power | 0.0/100: 0% rage
5:17.996 starsurge Fluffy_Pillow 76.0/100: 76% astral_power | 0.0/100: 0% rage
5:19.361 solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
5:20.456 starsurge Fluffy_Pillow 48.0/100: 48% astral_power | 0.0/100: 0% rage lunar_empowerment
5:21.820 solar_wrath Fluffy_Pillow 8.0/100: 8% astral_power | 0.0/100: 0% rage lunar_empowerment(2), solar_empowerment
5:22.913 lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power | 0.0/100: 0% rage lunar_empowerment(2), lightning_charged
5:24.675 lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power | 0.0/100: 0% rage lunar_empowerment, lightning_charged
5:26.435 starsurge Fluffy_Pillow 44.0/100: 44% astral_power | 0.0/100: 0% rage lightning_charged
5:27.756 moonfire Fluffy_Pillow 4.0/100: 4% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment, lightning_charged
5:29.075 solar_wrath Fluffy_Pillow 14.0/100: 14% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment, lightning_charged
5:30.133 new_moon Fluffy_Pillow 26.0/100: 26% astral_power | 0.0/100: 0% rage lunar_empowerment, lightning_charged
5:31.452 stellar_flare Fluffy_Pillow 36.0/100: 36% astral_power | 0.0/100: 0% rage lunar_empowerment, lightning_charged
5:32.771 solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power | 0.0/100: 0% rage lightning_charged
5:34.100 solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power | 0.0/100: 0% rage
5:35.463 starsurge Fluffy_Pillow 41.0/100: 41% astral_power | 0.0/100: 0% rage
5:36.828 solar_wrath Fluffy_Pillow 1.0/100: 1% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
5:37.920 lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power | 0.0/100: 0% rage lunar_empowerment
5:39.738 solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power | 0.0/100: 0% rage
5:41.103 solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power | 0.0/100: 0% rage
5:42.468 starsurge Fluffy_Pillow 45.0/100: 45% astral_power | 0.0/100: 0% rage
5:43.834 solar_wrath Fluffy_Pillow 9.0/100: 9% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
5:44.927 lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power | 0.0/100: 0% rage lunar_empowerment
5:46.746 sunfire Fluffy_Pillow 29.0/100: 29% astral_power | 0.0/100: 0% rage
5:48.110 half_moon Fluffy_Pillow 43.0/100: 43% astral_power | 0.0/100: 0% rage
5:49.929 moonfire Fluffy_Pillow 63.0/100: 63% astral_power | 0.0/100: 0% rage
5:51.295 starsurge Fluffy_Pillow 73.0/100: 73% astral_power | 0.0/100: 0% rage
5:52.660 solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
5:53.752 starsurge Fluffy_Pillow 41.0/100: 41% astral_power | 0.0/100: 0% rage lunar_empowerment
5:55.116 solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power | 0.0/100: 0% rage lunar_empowerment(2), solar_empowerment
5:56.208 lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power | 0.0/100: 0% rage lunar_empowerment(2)
5:58.026 stellar_flare Fluffy_Pillow 25.0/100: 25% astral_power | 0.0/100: 0% rage lunar_empowerment
5:59.389 solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage
6:00.754 use_item_nithramus_the_allseer Fluffy_Pillow 18.0/100: 18% astral_power | 0.0/100: 0% rage
6:00.754 full_moon Fluffy_Pillow 18.0/100: 18% astral_power | 0.0/100: 0% rage nithramus
6:03.479 starsurge Fluffy_Pillow 62.0/100: 62% astral_power | 0.0/100: 0% rage nithramus
6:04.844 solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment, nithramus
6:05.936 lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power | 0.0/100: 0% rage lunar_empowerment, nithramus
6:07.753 starsurge Fluffy_Pillow 46.0/100: 46% astral_power | 0.0/100: 0% rage nithramus
6:09.119 solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment, nithramus
6:10.212 lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power | 0.0/100: 0% rage lunar_empowerment, nithramus
6:12.030 moonfire Fluffy_Pillow 26.0/100: 26% astral_power | 0.0/100: 0% rage nithramus
6:13.396 solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power | 0.0/100: 0% rage nithramus
6:14.760 starsurge Fluffy_Pillow 44.0/100: 44% astral_power | 0.0/100: 0% rage nithramus
6:16.123 new_moon Fluffy_Pillow 4.0/100: 4% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
6:17.488 sunfire Fluffy_Pillow 18.0/100: 18% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
6:18.853 solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
6:19.946 stellar_flare Fluffy_Pillow 36.0/100: 36% astral_power | 0.0/100: 0% rage lunar_empowerment
6:21.311 solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power | 0.0/100: 0% rage
6:22.674 solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power | 0.0/100: 0% rage
6:24.039 celestial_alignment Fluffy_Pillow 41.0/100: 41% astral_power | 0.0/100: 0% rage
6:24.039 starsurge Fluffy_Pillow 41.0/100: 41% astral_power | 0.0/100: 0% rage celestial_alignment
6:25.403 solar_wrath Fluffy_Pillow 1.0/100: 1% astral_power | 0.0/100: 0% rage celestial_alignment, lunar_empowerment, solar_empowerment
6:26.496 lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power | 0.0/100: 0% rage celestial_alignment, lunar_empowerment
6:28.313 solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power | 0.0/100: 0% rage celestial_alignment
6:29.678 starsurge Fluffy_Pillow 47.0/100: 47% astral_power | 0.0/100: 0% rage celestial_alignment
6:31.044 solar_wrath Fluffy_Pillow 11.0/100: 11% astral_power | 0.0/100: 0% rage celestial_alignment, lunar_empowerment, solar_empowerment
6:32.137 lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power | 0.0/100: 0% rage celestial_alignment, lunar_empowerment
6:33.953 moonfire Fluffy_Pillow 41.0/100: 41% astral_power | 0.0/100: 0% rage celestial_alignment
6:35.317 starsurge Fluffy_Pillow 51.0/100: 51% astral_power | 0.0/100: 0% rage celestial_alignment
6:36.680 solar_wrath Fluffy_Pillow 11.0/100: 11% astral_power | 0.0/100: 0% rage celestial_alignment, lunar_empowerment, solar_empowerment
6:37.774 lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power | 0.0/100: 0% rage celestial_alignment, lunar_empowerment
6:39.590 half_moon Fluffy_Pillow 39.0/100: 39% astral_power | 0.0/100: 0% rage
6:41.407 starsurge Fluffy_Pillow 59.0/100: 59% astral_power | 0.0/100: 0% rage
6:42.770 solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
6:43.861 stellar_flare Fluffy_Pillow 35.0/100: 35% astral_power | 0.0/100: 0% rage lunar_empowerment
6:45.226 full_moon Fluffy_Pillow 20.0/100: 20% astral_power | 0.0/100: 0% rage
6:47.951 starsurge Fluffy_Pillow 60.0/100: 60% astral_power | 0.0/100: 0% rage
6:49.314 solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
6:50.407 lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power | 0.0/100: 0% rage lunar_empowerment
6:52.227 sunfire Fluffy_Pillow 44.0/100: 44% astral_power | 0.0/100: 0% rage
6:53.591 starsurge Fluffy_Pillow 54.0/100: 54% astral_power | 0.0/100: 0% rage
6:54.957 solar_wrath Fluffy_Pillow 14.0/100: 14% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
6:56.048 moonfire Fluffy_Pillow 26.0/100: 26% astral_power | 0.0/100: 0% rage lunar_empowerment
6:57.413 lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power | 0.0/100: 0% rage lunar_empowerment
6:59.230 starsurge Fluffy_Pillow 48.0/100: 48% astral_power | 0.0/100: 0% rage lightning_charged
7:00.551 new_moon Fluffy_Pillow 8.0/100: 8% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment, lightning_charged
7:01.871 solar_wrath Fluffy_Pillow 18.0/100: 18% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment, lightning_charged
7:02.926 lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power | 0.0/100: 0% rage lunar_empowerment, lightning_charged
7:04.685 starsurge Fluffy_Pillow 42.0/100: 42% astral_power | 0.0/100: 0% rage lightning_charged
7:06.006 solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment, lightning_charged
7:07.063 lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power | 0.0/100: 0% rage lunar_empowerment, lightning_charged
7:08.822 stellar_flare Fluffy_Pillow 34.0/100: 34% astral_power | 0.0/100: 0% rage lightning_charged
7:10.142 solar_wrath Fluffy_Pillow 19.0/100: 19% astral_power | 0.0/100: 0% rage lightning_charged
7:11.504 solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power | 0.0/100: 0% rage
7:12.869 solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power | 0.0/100: 0% rage
7:14.236 starsurge Fluffy_Pillow 43.0/100: 43% astral_power | 0.0/100: 0% rage
7:15.601 half_moon Fluffy_Pillow 3.0/100: 3% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
7:17.420 moonfire Fluffy_Pillow 23.0/100: 23% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
7:18.785 solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
7:19.878 starsurge Fluffy_Pillow 41.0/100: 41% astral_power | 0.0/100: 0% rage lunar_empowerment
7:21.244 solar_wrath Fluffy_Pillow 1.0/100: 1% astral_power | 0.0/100: 0% rage lunar_empowerment(2), solar_empowerment
7:22.335 lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power | 0.0/100: 0% rage lunar_empowerment(2)
7:24.152 lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power | 0.0/100: 0% rage lunar_empowerment
7:25.970 solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power | 0.0/100: 0% rage
7:27.334 starsurge Fluffy_Pillow 41.0/100: 41% astral_power | 0.0/100: 0% rage

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4723 4398 0
Agility 9359 9034 0
Stamina 18410 18410 11233
Intellect 21535 19828 11557 (5359)
Spirit 0 0 0
Health 1104600 1104600 0
Mana 704000 704000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 21535 19828 0
Crit 15.25% 15.25% 3239
Haste 10.28% 9.12% 2965
Damage / Heal Versatility 2.04% 2.04% 817
Attack Power 9359 9034 0
Mastery 39.26% 39.26% 4070
Armor 5236 1611 1611
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 767.00
Local Head Hood of the Dreamgrove
ilevel: 810, stats: { 234 Armor, +1340 Sta, +894 AgiInt, +779 Haste, +345 Mastery }
Local Neck Watcher's Pendant of Courage
ilevel: 680, stats: { +225 Sta, +314 Haste, +185 Crit }
Local Shoulders Spaulders of Unstable Experiments
ilevel: 825, stats: { 227 Armor, +771 AgiInt, +1157 Sta, +561 Mastery, +331 Haste }
Local Shirt Darnassus Doublet
ilevel: 1
Local Chest Shaladrassil Tunic
ilevel: 800, stats: { 279 Armor, +814 AgiInt, +1221 Sta, +774 Haste, +310 Mastery }
Local Waist Bitterbrine Binding
ilevel: 800, stats: { 157 Armor, +611 AgiInt, +916 Sta, +250 Mastery, +563 Crit }
Local Legs Valor-Bound Legwraps
ilevel: 800, stats: { 244 Armor, +814 AgiInt, +1221 Sta, +635 Crit, +449 Haste }
Local Feet Stormborn Treads
ilevel: 680, stats: { 119 Armor, +200 AgiInt, +300 Sta, +156 Haste, +110 Mastery }
Local Wrists Bracers of the Dreamgrove
ilevel: 810, stats: { 126 Armor, +754 Sta, +503 AgiInt, +370 Crit, +261 Vers }
Local Hands Reaping Gloves of Aleifir
ilevel: 680, stats: { 108 Armor, +200 AgiInt, +300 Sta, +162 Haste, +105 Mastery }
Local Finger1 Nithramus, the All-Seer
ilevel: 795, stats: { +437 Int, +656 Sta, +328 Mastery, +228 Vers }, enchant: { +50 Mastery }
Local Finger2 Signet of the Highborne Magi
ilevel: 850, stats: { +1094 Sta, +1154 Mastery, +682 Crit }
Local Trinket1 Lodestone of the Mystic
ilevel: 680, stats: { +253 Int }
Local Trinket2 Bane of the Darklady
ilevel: 680, stats: { +253 Int, +253 Crit }
Local Back Cape of Valarjar Courage
ilevel: 820, stats: { 117 Armor, +552 StrAgiInt, +828 Sta, +328 Mastery, +328 Vers }
Local Main Hand Scythe of Elune
ilevel: 800, weapon: { 2106 - 3160, 3.6 }, stats: { +814 Int, +1221 Sta, +551 Crit, +529 Mastery, +4441 Int }, relics: { +28 ilevels, +22 ilevels }

Talents

Level
15 Force of Nature (Balance Druid) Warrior of Elune (Balance Druid) Starlord (Balance Druid)
30 Renewal Displacer Beast Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Incarnation: Chosen of Elune Stellar Flare (Balance Druid)
90 Shooting Stars (Balance Druid) Astral Communion (Balance Druid) Blessing of the Ancients (Balance Druid)
100 Fury of Elune (Balance Druid) Stellar Drift (Balance Druid) Nature's Balance (Balance Druid)

Profile

druid="Kaptah"
origin="https://eu.api.battle.net/wow/character/hyjal/Kaptah/advanced"
thumbnail="http://eu.battle.net/static-render/eu/hyjal/204/115079884-avatar.jpg"
level=110
race=night_elf
timeofday=day
role=spell
position=back
professions=engineering=713/alchemy=719
talents=http://eu.battle.net/wow/en/tool/talent-calculator#Ua!2112202
artifact=59:0:0:0:0:1049:1:1294:1
spec=balance

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/moonkin_form
actions.precombat+=/blessing_of_elune
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/new_moon

# Executed every time the actor is available.
actions=potion,name=deadly_grace,if=buff.celestial_alignment.up|buff.incarnation.up
actions+=/blood_fury,if=buff.celestial_alignment.up|buff.incarnation.up
actions+=/berserking,if=buff.celestial_alignment.up|buff.incarnation.up
actions+=/arcane_torrent,if=buff.celestial_alignment.up|buff.incarnation.up
actions+=/use_item,slot=finger1
actions+=/call_action_list,name=fury_of_elune,if=talent.fury_of_elune.enabled&cooldown.fury_of_elune.remains<target.time_to_die
actions+=/new_moon,if=(charges=2&recharge_time<5)|charges=3
actions+=/half_moon,if=(charges=2&recharge_time<5)|charges=3|(target.time_to_die<15&charges=2)
actions+=/full_moon,if=(charges=2&recharge_time<5)|charges=3|target.time_to_die<15
actions+=/stellar_flare,if=remains<7.2
actions+=/moonfire,if=(talent.natures_balance.enabled&remains<3)|(remains<6.6&!talent.natures_balance.enabled)
actions+=/sunfire,if=(talent.natures_balance.enabled&remains<3)|(remains<5.4&!talent.natures_balance.enabled)
actions+=/astral_communion,if=astral_power.deficit>=75
actions+=/incarnation,if=astral_power>=40
actions+=/celestial_alignment,if=astral_power>=40
actions+=/solar_wrath,if=buff.solar_empowerment.stack=3
actions+=/lunar_strike,if=buff.lunar_empowerment.stack=3
actions+=/call_action_list,name=celestial_alignment_phase,if=buff.celestial_alignment.up|buff.incarnation.up
actions+=/call_action_list,name=single_target

actions.fury_of_elune=incarnation,if=astral_power>=95&cooldown.fury_of_elune.remains<=gcd
actions.fury_of_elune+=/fury_of_elune,if=astral_power>=95
actions.fury_of_elune+=/new_moon,if=((charges=2&recharge_time<5)|charges=3)&&(buff.fury_of_elune_up.up|(cooldown.fury_of_elune.remains>gcd*3&astral_power<=90))
actions.fury_of_elune+=/half_moon,if=((charges=2&recharge_time<5)|charges=3)&&(buff.fury_of_elune_up.up|(cooldown.fury_of_elune.remains>gcd*3&astral_power<=80))
actions.fury_of_elune+=/full_moon,if=((charges=2&recharge_time<5)|charges=3)&&(buff.fury_of_elune_up.up|(cooldown.fury_of_elune.remains>gcd*3&astral_power<=60))
actions.fury_of_elune+=/astral_communion,if=buff.fury_of_elune_up.up&astral_power<=25
actions.fury_of_elune+=/warrior_of_elune,if=buff.fury_of_elune_up.up|(cooldown.fury_of_elune.remains>=35&buff.lunar_empowerment.up)
actions.fury_of_elune+=/lunar_strike,if=buff.warrior_of_elune.up&(astral_power<=90|(astral_power<=85&buff.incarnation.up))
actions.fury_of_elune+=/new_moon,if=astral_power<=90&buff.fury_of_elune_up.up
actions.fury_of_elune+=/half_moon,if=astral_power<=80&buff.fury_of_elune_up.up&astral_power>cast_time*12
actions.fury_of_elune+=/full_moon,if=astral_power<=60&buff.fury_of_elune_up.up&astral_power>cast_time*12
actions.fury_of_elune+=/moonfire,if=buff.fury_of_elune_up.down&remains<=6.6
actions.fury_of_elune+=/sunfire,if=buff.fury_of_elune_up.down&remains<=5.4
actions.fury_of_elune+=/stellar_flare,if=remains<7.2
actions.fury_of_elune+=/starsurge,if=buff.fury_of_elune_up.down&((astral_power>=92&cooldown.fury_of_elune.remains>gcd*3)|(cooldown.warrior_of_elune.remains<=5&cooldown.fury_of_elune.remains>=35&buff.lunar_empowerment.stack<2))
actions.fury_of_elune+=/solar_wrath,if=buff.solar_empowerment.up
actions.fury_of_elune+=/lunar_strike,if=buff.lunar_empowerment.stack=3|(buff.lunar_empowerment.remains<5&buff.lunar_empowerment.up)
actions.fury_of_elune+=/solar_wrath

actions.celestial_alignment_phase=starsurge
actions.celestial_alignment_phase+=/warrior_of_elune,if=buff.lunar_empowerment.stack>=2&((astral_power<=70&buff.blessing_of_elune.down)|(astral_power<=58&buff.blessing_of_elune.up))
actions.celestial_alignment_phase+=/lunar_strike,if=buff.warrior_of_elune.up
actions.celestial_alignment_phase+=/solar_wrath,if=buff.solar_empowerment.up
actions.celestial_alignment_phase+=/lunar_strike,if=buff.lunar_empowerment.up
actions.celestial_alignment_phase+=/solar_wrath,if=talent.natures_balance.enabled&dot.sunfire_dmg.remains<5&cast_time<dot.sunfire_dmg.remains
actions.celestial_alignment_phase+=/lunar_strike,if=talent.natures_balance.enabled&dot.moonfire_dmg.remains<5&cast_time<dot.moonfire_dmg.remains
actions.celestial_alignment_phase+=/solar_wrath

actions.single_target=new_moon,if=astral_power<=90
actions.single_target+=/half_moon,if=astral_power<=80
actions.single_target+=/full_moon,if=astral_power<=60
actions.single_target+=/starsurge
actions.single_target+=/warrior_of_elune,if=buff.lunar_empowerment.stack>=2&((astral_power<=80&buff.blessing_of_elune.down)|(astral_power<=72&buff.blessing_of_elune.up))
actions.single_target+=/lunar_strike,if=buff.warrior_of_elune.up
actions.single_target+=/solar_wrath,if=buff.solar_empowerment.up
actions.single_target+=/lunar_strike,if=buff.lunar_empowerment.up
actions.single_target+=/solar_wrath,if=talent.natures_balance.enabled&dot.sunfire_dmg.remains<5&cast_time<dot.sunfire_dmg.remains
actions.single_target+=/lunar_strike,if=talent.natures_balance.enabled&dot.moonfire_dmg.remains<5&cast_time<dot.moonfire_dmg.remains
actions.single_target+=/solar_wrath

head=hood_of_the_dreamgrove,id=139726,bonus_id=3386/3381
neck=watchers_pendant_of_courage,id=129316,bonus_id=767/1733
shoulders=spaulders_of_unstable_experiments,id=134454,bonus_id=1726/1477
back=cape_of_valarjar_courage,id=133765,bonus_id=1795
chest=shaladrassil_tunic,id=129993
shirt=darnassus_doublet,id=45670
wrists=bracers_of_the_dreamgrove,id=139730,bonus_id=3386/3381
hands=reaping_gloves_of_aleifir,id=129325,bonus_id=1792
waist=bitterbrine_binding,id=140624,addon=nitro_boosts
legs=valorbound_legwraps,id=129997
feet=stormborn_treads,id=129231,bonus_id=664/1736
finger1=nithramus_the_allseer,id=124635,bonus_id=649/641,enchant=50mastery
finger2=signet_of_the_highborne_magi,id=134537,bonus_id=1727/1502/3336
trinket1=lodestone_of_the_mystic,id=129317,bonus_id=664/1737
trinket2=bane_of_the_darklady,id=129259,bonus_id=1793
main_hand=scythe_of_elune,id=128858,gem_id=132825/136973/0/0,relic_id=1793:1615:1809/1795:1422:1809/0/0

# Gear Summary
# gear_ilvl=767.33
# gear_stamina=11233
# gear_intellect=11557
# gear_crit_rating=3239
# gear_haste_rating=2965
# gear_mastery_rating=4070
# gear_versatility_rating=817
# gear_armor=1611
# set_bonus=tier19oh_2pc=1

Beckîe

Beckîe : 188109 dps

  • Race: Night Elf
  • Class: Hunter
  • Spec: Beast Mastery
  • Level: 110
  • Role: Attack
  • Position: ranged_back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
188109.5 188109.5 80.9 / 0.043% 16033.6 / 8.5% 4781.7
RPS Out RPS In Primary Resource Waiting APM Active Skill
13.9 13.9 Focus 37.92% 33.2 100.0% 100%
Origin https://eu.api.battle.net/wow/character/hyjal/Beckîe/advanced
Talents
  • 15: Way of the Cobra (Beast Mastery Hunter)
  • 30: Stomp (Beast Mastery Hunter)
  • 45: Posthaste
  • 60: Bestial Fury (Beast Mastery Hunter)
  • 75: Binding Shot
  • 90: A Murder of Crows
  • 100: Stampede (Beast Mastery Hunter)
  • Talent Calculator
Artifact
Professions
  • jewelcrafting: 700
  • enchanting: 716

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Beckîe 188109
A Murder of Crows 0 (18511) 0.0% (9.8%) 8.0 60.24sec 1039658 786131

Stats details: a_murder_of_crows

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.01 0.00 125.64 0.00 1.3225 0.9363 0.00 0.00 0.00 64908.57 786131.30
 
 

Action details: a_murder_of_crows

Static Values
  • id:131894
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:131894
  • name:A Murder of Crows
  • school:physical
  • tooltip:Under attack by a flock of crows.
  • description:Summons a flock of crows to attack your target, dealing ${{$131900s1=1}*16} Physical damage over {$d=15 seconds}. When a target dies while affected by this ability, its cooldown will reset.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:15.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    A Murder of Crows (crow_peck) 18511 9.8% 0.0 0.00sec 0 0 Direct 125.6 50983 102992 66241 29.3%  

Stats details: crow_peck

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 125.64 0.00 0.00 0.0000 0.0000 8322772.07 12235263.29 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 88.78 70.66% 50983.19 41793 61867 51004.42 46749 54697 4526236 6653996 31.98
crit 36.86 29.34% 102991.68 83586 123735 103026.88 91511 114267 3796536 5581267 31.98
 
 

Action details: crow_peck

Static Values
  • id:131900
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:131900
  • name:A Murder of Crows
  • school:physical
  • tooltip:
  • description:Deals {$s1=1} physical damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.620000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
auto_shot 10454 5.6% 176.5 2.56sec 26660 10440 Direct 176.5 20601 41540 26661 28.9%  

Stats details: auto_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 176.49 176.49 0.00 0.00 2.5536 0.0000 4705148.87 6917014.53 31.98 10440.11 10440.11
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 125.42 71.06% 20600.98 17623 25566 20605.00 19945 21529 2583725 3798321 31.98
crit 51.07 28.94% 41539.80 35246 51132 41542.74 38659 44646 2121424 3118694 31.98
 
 

Action details: auto_shot

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Cobra Shot 24886 13.2% 101.3 4.43sec 110606 86391 Direct 101.0 84655 171730 110847 30.1%  

Stats details: cobra_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 101.26 101.04 0.00 0.00 1.2803 0.0000 11199905.34 16464921.73 31.98 86391.03 86391.03
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 70.65 69.92% 84655.21 65927 121889 84672.34 80018 89292 5980805 8792350 31.98
crit 30.39 30.08% 171730.05 131854 243779 171809.49 153214 190010 5219100 7672571 31.98
 
 

Action details: cobra_shot

Static Values
  • id:193455
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.killer_cobra.enabled&(cooldown.bestial_wrath.remains>=4&(buff.bestial_wrath.up&cooldown.kill_command.remains>=2)|focus>119)|!talent.killer_cobra.enabled&focus>90
Spelldata
  • id:193455
  • name:Cobra Shot
  • school:physical
  • tooltip:
  • description:A quick shot causing $sw2 Physical damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.40
 
Deadly Grace 4990 2.6% 22.3 3.88sec 99082 0 Direct 22.3 75488 153106 99084 30.4%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.32 22.32 0.00 0.00 0.0000 0.0000 2211513.40 2211513.40 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.54 69.60% 75488.23 62632 84553 75436.06 62632 84553 1172702 1172702 0.00
crit 6.78 30.40% 153105.87 125263 169105 153118.15 0 169105 1038811 1038811 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:5.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=47572 to 71358} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:47572.00
  • base_dd_max:71358.00
 
Dire Beast 0 (32497) 0.0% (17.3%) 47.9 9.46sec 305567 274411

Stats details: dire_beast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.86 0.00 0.00 0.00 1.1136 0.0000 0.00 0.00 0.00 274411.50 274411.50
 
 

Action details: dire_beast

Static Values
  • id:120679
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown.bestial_wrath.remains>2
Spelldata
  • id:120679
  • name:Dire Beast
  • school:nature
  • tooltip:
  • description:Summons a powerful wild beast to attack your target for {$d=8 seconds}. |cFFFFFFFFGenerates ${$120694m1*4} Focus over its duration.|r
 
    dire_beast_melee (dire_beast) 20543 8.5% 243.0 1.85sec 29596 17364 Direct 243.0 22915 45938 29596 29.0%  

Stats details: dire_beast_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 243.00 243.00 0.00 0.00 1.7044 0.0000 7192010.68 10572936.95 31.98 17364.37 17364.37
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 172.48 70.98% 22914.63 22288 24440 22915.49 22696 23192 3952378 5810370 31.98
crit 70.52 29.02% 45937.92 44576 48879 45940.56 45033 46876 3239632 4762567 31.98
 
 

Action details: dire_beast_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
    Stomp (dire_beast) 21227 8.8% 47.9 9.46sec 155307 0 Direct 47.9 120326 240993 155307 29.0%  

Stats details: stomp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.86 47.86 0.00 0.00 0.0000 0.0000 7433573.44 10928057.09 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.99 71.01% 120325.91 117018 128316 120330.66 117703 123180 4089653 6012177 31.98
crit 13.88 28.99% 240992.52 234036 256631 241019.92 234036 253403 3343921 4915880 31.98
 
 

Action details: stomp

Static Values
  • id:201754
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:201754
  • name:Stomp
  • school:physical
  • tooltip:
  • description:{$@spelldesc199530=When your Dire Beasts charge in, they will stomp the ground, dealing ${($76657m1/100+1)*({$201754s1=1}*1.15)} Physical damage to all nearby enemies.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:3.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
Kill Command 0 (45294) 0.0% (24.1%) 66.4 6.80sec 307021 275761

Stats details: kill_command

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 66.40 0.00 0.00 0.00 1.1134 0.0000 0.00 0.00 0.00 275760.65 275760.65
 
 

Action details: kill_command

Static Values
  • id:34026
  • school:physical
  • resource:focus
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:7.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:34026
  • name:Kill Command
  • school:physical
  • tooltip:
  • description:Give the command to kill, causing your pet to savagely deal $<damage> Physical damage to its target. 25 yard range.
 
    Kill Command (cat) 30130 16.0% 66.4 6.80sec 204226 0 Direct 66.4 144742 293983 204232 39.9%  

Stats details: kill_command

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 66.40 66.40 0.00 0.00 0.0000 0.0000 13560230.76 19934823.68 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.93 60.14% 144742.22 121892 180442 144756.34 134429 155392 5780027 8497188 31.98
crit 26.46 39.86% 293983.41 243785 360884 294089.91 262725 326788 7780203 11437636 31.98
 
 

Action details: kill_command

Static Values
  • id:83381
  • school:physical
  • resource:none
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:83381
  • name:Kill Command
  • school:physical
  • tooltip:
  • description:{$@spelldesc34026=Give the command to kill, causing your pet to savagely deal $<damage> Physical damage to its target. 25 yard range.}
 
    Jaws of Thunder (cat) 4515 2.4% 19.9 21.87sec 102067 0 Direct 19.9 102067 0 102067 0.0%  

Stats details: jaws_of_thunder

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.91 19.91 0.00 0.00 0.0000 0.0000 2032281.32 2032281.32 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.91 100.00% 102067.30 60946 180442 102099.95 68485 140380 2032281 2032281 0.00
 
 

Action details: jaws_of_thunder

Static Values
  • id:197162
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:197162
  • name:Jaws of Thunder
  • school:physical
  • tooltip:
  • description:Kill Command has a {$s1=10}% chance to deal an additional {$197163s2=50}% of its damage as Nature damage.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:164554.87
  • base_dd_max:164554.87
 
    Kill Command (hati) 9259 4.9% 66.4 6.80sec 62765 0 Direct 66.4 48421 97705 62764 29.1%  

Stats details: kill_command

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 66.40 66.40 0.00 0.00 0.0000 0.0000 4167469.35 6126574.70 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 47.07 70.89% 48420.59 40631 60147 48428.41 45502 52544 2279283 3350762 31.98
crit 19.33 29.11% 97705.04 81262 120295 97743.31 85294 111300 1888186 2775812 31.98
 
 

Action details: kill_command

Static Values
  • id:83381
  • school:physical
  • resource:none
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:83381
  • name:Kill Command
  • school:physical
  • tooltip:
  • description:{$@spelldesc34026=Give the command to kill, causing your pet to savagely deal $<damage> Physical damage to its target. 25 yard range.}
 
    Jaws of Thunder (hati) 1390 0.7% 19.9 22.07sec 31400 0 Direct 19.9 31400 0 31400 0.0%  

Stats details: jaws_of_thunder

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.92 19.92 0.00 0.00 0.0000 0.0000 625624.49 625624.49 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.92 100.00% 31399.60 20315 60147 31409.52 22130 45060 625624 625624 0.00
 
 

Action details: jaws_of_thunder

Static Values
  • id:197162
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:197162
  • name:Jaws of Thunder
  • school:physical
  • tooltip:
  • description:Kill Command has a {$s1=10}% chance to deal an additional {$197163s2=50}% of its damage as Nature damage.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:54851.62
  • base_dd_max:54851.62
 
Stampede 8059 4.3% 3.0 186.36sec 1219033 0 Periodic 52.3 53806 107579 68922 28.1% 7.7%

Stats details: stampede

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.95 0.00 52.26 52.26 0.0000 0.6667 3601871.72 5295092.61 31.98 103383.23 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.6 71.89% 53806.31 38348 57283 53792.87 45045 56404 2021419 2971678 31.98
crit 14.7 28.11% 107578.67 76696 114566 107557.75 84200 114566 1580452 2323415 31.98
 
 

Action details: stampede

Static Values
  • id:201430
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.bloodlust.up|buff.bestial_wrath.up|cooldown.bestial_wrath.remains<=2|target.time_to_die<=14
Spelldata
  • id:201430
  • name:Stampede
  • school:physical
  • tooltip:
  • description:Summon a herd of stampeding animals from the wilds around you that deal damage to your enemies for {$d=12 seconds}.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:12.00
  • base_tick_time:0.67
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: stampede_tick

Static Values
  • id:201594
  • school:physical
  • resource:none
  • range:150.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:201594
  • name:Stampede
  • school:physical
  • tooltip:
  • description:{$@spelldesc201430=Summon a herd of stampeding animals from the wilds around you that deal damage to your enemies for {$d=12 seconds}.}
 
pet - cat 62963 / 62963
Claw 14251 7.6% 150.6 3.00sec 42593 42403 Direct 150.6 30021 61555 42593 39.9%  

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 150.65 150.65 0.00 0.00 1.0045 0.0000 6416581.73 9432982.95 31.98 42402.65 42402.65
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 90.59 60.13% 30020.73 14189 42008 30028.45 27641 32127 2719424 3997811 31.98
crit 60.06 39.87% 61555.14 28377 84015 61583.63 55196 68651 3697158 5435172 31.98
 
 

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:3.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, causing ${$<damage>} damage. Deals {$62762s2=100}% more damage and costs {$62762s1=100}% more Focus when your pet has 50 or more Focus.
 
melee 14067 7.5% 289.0 1.56sec 21913 14084 Direct 289.0 15528 31535 21913 39.9%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 288.98 288.98 0.00 0.00 1.5559 0.0000 6332419.75 9309256.85 31.98 14083.94 14083.94
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 173.72 60.11% 15528.30 13267 19640 15530.45 15035 16128 2697563 3965673 31.98
crit 115.27 39.89% 31534.72 26534 39280 31542.98 29963 33197 3634857 5343584 31.98
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - hati 25750 / 25750
hati_melee 15101 8.0% 262.6 1.71sec 25881 15121 Direct 263.6 19909 40175 25783 29.0%  

Stats details: hati_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 262.65 263.65 0.00 0.00 1.7116 0.0000 6797662.79 9993208.20 31.98 15120.87 15120.87
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 187.23 71.01% 19909.14 16691 25094 19912.47 19296 20576 3727581 5479896 31.98
crit 76.42 28.99% 40174.68 33382 50188 40183.74 37755 43000 3070082 4513312 31.98
 
 

Action details: hati_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
Simple Action Stats Execute Interval
Beckîe
Aspect of the Wild 4.0 127.51sec

Stats details: aspect_of_the_wild

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.02 0.00 50.51 0.00 0.0000 0.7843 0.00 0.00 0.00 0.00 0.00
 
 

Action details: aspect_of_the_wild

Static Values
  • id:193530
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.bestial_wrath.up
Spelldata
  • id:193530
  • name:Aspect of the Wild
  • school:physical
  • tooltip:Critical Strike chance for you and your pet increased by {$s1=10}%.
  • description:Grants you and your pet {$s2=10} Focus per $t2 sec and {$s1=10}% increased critical strike chance on all attacks for {$d=10 seconds}.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Beckîe
  • harmful:false
  • if_expr:
 
Bestial Wrath 12.5 37.22sec

Stats details: bestial_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.52 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: bestial_wrath

Static Values
  • id:19574
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:19574
  • name:Bestial Wrath
  • school:physical
  • tooltip:Damage dealt increased by {$s1=20}%.
  • description:Sends you and your pet into a rage, increasing all damage you both deal by {$s1=20}% for {$d=10 seconds}. Bestial Wrath's remaining cooldown is reduced by {$s3=15} sec each time you use {$?s217200=false}[Dire Frenzy][Dire Beast].
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Beckîe
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Beckîe
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
summon_pet 1.0 0.00sec

Stats details: summon_pet

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_pet

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Aspect of the Wild 4.0 0.0 127.5sec 127.5sec 8.80% 6.37% 39.6(39.6) 3.9

Buff details

  • buff initial source:Beckîe
  • cooldown name:buff_aspect_of_the_wild
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • aspect_of_the_wild_1:8.80%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193530
  • name:Aspect of the Wild
  • tooltip:Critical Strike chance for you and your pet increased by {$s1=10}%.
  • description:Grants you and your pet {$s2=10} Focus per $t2 sec and {$s1=10}% increased critical strike chance on all attacks for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Bestial Wrath 12.5 0.0 37.3sec 37.3sec 41.08% 50.46% 0.0(0.0) 12.1

Buff details

  • buff initial source:Beckîe
  • cooldown name:buff_bestial_wrath
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35

Stack Uptimes

  • bestial_wrath_1:41.08%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:19574
  • name:Bestial Wrath
  • tooltip:Damage dealt increased by {$s1=20}%.
  • description:Sends you and your pet into a rage, increasing all damage you both deal by {$s1=20}% for {$d=10 seconds}. Bestial Wrath's remaining cooldown is reduced by {$s3=15} sec each time you use {$?s217200=false}[Dire Frenzy][Dire Beast].
  • max_stacks:0
  • duration:10.00
  • cooldown:90.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 10.29% 0.0(0.0) 1.0

Buff details

  • buff initial source:Beckîe
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Dire Beast 47.9 0.0 10.3sec 9.5sec 78.43% 75.23% 0.0(0.0) 39.7

Buff details

  • buff initial source:Beckîe
  • cooldown name:buff_dire_beast
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.50

Stack Uptimes

  • dire_beast_1:72.72%
  • dire_beast_2:5.55%
  • dire_beast_3:0.16%
  • dire_beast_4:0.00%

Trigger Attempt Success

  • trigger_pct:99.98%

Spelldata details

  • id:120694
  • name:Dire Beast
  • tooltip:Your Dire Beast is granting you {$s1=3} Focus every $t1 sec.
  • description:{$@spelldesc120679=Summons a powerful wild beast to attack your target for {$d=8 seconds}. |cFFFFFFFFGenerates ${$120694m1*4} Focus over its duration.|r}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deadly Grace 2.0 0.0 58.2sec 0.0sec 10.83% 10.89% 0.0(0.0) 2.0

Buff details

  • buff initial source:Beckîe
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:10.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Valarjar's Path 4.3 0.0 120.3sec 120.3sec 27.66% 27.71% 0.0(0.0) 4.0

Buff details

  • buff initial source:Beckîe
  • cooldown name:buff_valarjars_path
  • max_stacks:1
  • duration:30.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:2038.80

Stack Uptimes

  • valarjars_path_1:27.66%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:215956
  • name:Valarjar's Path
  • tooltip:Primary stat increased by {$s4=2039}.
  • description:Sound the horn, increasing your primary stat by {$215956s1=2039} for {$215956d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:120.00
  • default_chance:0.00%
cat: Aspect of the Wild 4.0 0.0 127.5sec 127.5sec 8.80% 9.23% 39.6(39.6) 3.9

Buff details

  • buff initial source:Beckîe_cat
  • cooldown name:buff_aspect_of_the_wild
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • aspect_of_the_wild_1:8.80%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193530
  • name:Aspect of the Wild
  • tooltip:Critical Strike chance for you and your pet increased by {$s1=10}%.
  • description:Grants you and your pet {$s2=10} Focus per $t2 sec and {$s1=10}% increased critical strike chance on all attacks for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
cat: Bestial Wrath 12.5 0.0 37.3sec 37.3sec 41.08% 40.68% 0.0(0.0) 12.1

Buff details

  • buff initial source:Beckîe_cat
  • cooldown name:buff_bestial_wrath
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35

Stack Uptimes

  • bestial_wrath_1:41.08%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:19574
  • name:Bestial Wrath
  • tooltip:Damage dealt increased by {$s1=20}%.
  • description:Sends you and your pet into a rage, increasing all damage you both deal by {$s1=20}% for {$d=10 seconds}. Bestial Wrath's remaining cooldown is reduced by {$s3=15} sec each time you use {$?s217200=false}[Dire Frenzy][Dire Beast].
  • max_stacks:0
  • duration:10.00
  • cooldown:90.00
  • default_chance:0.00%
hati: Bestial Wrath 12.5 0.0 37.3sec 37.3sec 41.08% 40.57% 0.0(0.0) 12.1

Buff details

  • buff initial source:Beckîe_hati
  • cooldown name:buff_bestial_wrath
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35

Stack Uptimes

  • bestial_wrath_1:41.08%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:19574
  • name:Bestial Wrath
  • tooltip:Damage dealt increased by {$s1=20}%.
  • description:Sends you and your pet into a rage, increasing all damage you both deal by {$s1=20}% for {$d=10 seconds}. Bestial Wrath's remaining cooldown is reduced by {$s3=15} sec each time you use {$?s217200=false}[Dire Frenzy][Dire Beast].
  • max_stacks:0
  • duration:10.00
  • cooldown:90.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Beckîe
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Beckîe
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (nightborne_delicacy_platter)

Buff details

  • buff initial source:Beckîe
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:375.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Beckîe
a_murder_of_crows Focus 8.0 240.2 30.0 30.0 34655.3
cobra_shot Focus 101.3 4050.4 40.0 40.0 2765.2
kill_command Focus 66.4 1991.9 30.0 30.0 10234.0
pet - cat
claw Focus 150.6 6848.2 45.5 45.5 937.0
Resource Gains Type Count Total Average Overflow
dire_beast Focus 1789.56 553.07 (8.91%) 0.31 0.23 0.04%
aspect_of_the_wild Focus 148.84 396.54 (6.39%) 2.66 0.08 0.02%
focus_regen Focus 2342.04 5258.12 (84.70%) 2.25 1.33 0.03%
pet - cat
focus_regen Focus 811.33 6440.46 (95.15%) 7.94 133.22 2.03%
aspect_of_the_wild Focus 74.90 328.08 (4.85%) 4.38 68.54 17.28%
Resource RPS-Gain RPS-Loss
Focus 13.78 13.95
Combat End Resource Mean Min Max
Focus 65.61 20.20 125.54

Benefits & Uptimes

Benefits %
cat-wild_hunt 81.9%
Uptimes %
Focus Cap 0.0%
cat-Focus Cap 0.9%

Procs

Count Interval
wild_call 10.2 40.5sec

Statistics & Data Analysis

Fight Length
Sample Data Beckîe Fight Length
Count 9999
Mean 450.42
Minimum 350.15
Maximum 555.44
Spread ( max - min ) 205.29
Range [ ( max - min ) / 2 * 100% ] 22.79%
DPS
Sample Data Beckîe Damage Per Second
Count 9999
Mean 188109.47
Minimum 175166.98
Maximum 203497.55
Spread ( max - min ) 28330.56
Range [ ( max - min ) / 2 * 100% ] 7.53%
Standard Deviation 4127.1503
5th Percentile 181648.52
95th Percentile 195132.89
( 95th Percentile - 5th Percentile ) 13484.37
Mean Distribution
Standard Deviation 41.2736
95.00% Confidence Intervall ( 188028.57 - 188190.36 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 18
0.1% Error 1849
0.1 Scale Factor Error with Delta=300 145406
0.05 Scale Factor Error with Delta=300 581626
0.01 Scale Factor Error with Delta=300 14540664
Priority Target DPS
Sample Data Beckîe Priority Target Damage Per Second
Count 9999
Mean 188109.47
Minimum 175166.98
Maximum 203497.55
Spread ( max - min ) 28330.56
Range [ ( max - min ) / 2 * 100% ] 7.53%
Standard Deviation 4127.1503
5th Percentile 181648.52
95th Percentile 195132.89
( 95th Percentile - 5th Percentile ) 13484.37
Mean Distribution
Standard Deviation 41.2736
95.00% Confidence Intervall ( 188028.57 - 188190.36 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 18
0.1% Error 1849
0.1 Scale Factor Error with Delta=300 145406
0.05 Scale Factor Error with Delta=300 581626
0.01 Scale Factor Error with Delta=300 14540664
DPS(e)
Sample Data Beckîe Damage Per Second (Effective)
Count 9999
Mean 188109.47
Minimum 175166.98
Maximum 203497.55
Spread ( max - min ) 28330.56
Range [ ( max - min ) / 2 * 100% ] 7.53%
Damage
Sample Data Beckîe Damage
Count 9999
Mean 30041211.40
Minimum 22285263.06
Maximum 37431595.95
Spread ( max - min ) 15146332.89
Range [ ( max - min ) / 2 * 100% ] 25.21%
DTPS
Sample Data Beckîe Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Beckîe Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Beckîe Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Beckîe Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Beckîe Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Beckîe Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data BeckîeTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Beckîe Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=nightborne_delicacy_platter
2 0.00 summon_pet
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=deadly_grace
5 0.00 augmentation,type=defiled
Default action list Executed every time the actor is available.
# count action,conditions
6 1.00 auto_shot
7 4.33 use_item,name=horn_of_valor
0.00 arcane_torrent,if=focus.deficit>=30
0.00 blood_fury
0.00 berserking
8 1.00 potion,name=deadly_grace
9 8.01 a_murder_of_crows
A 2.96 stampede,if=buff.bloodlust.up|buff.bestial_wrath.up|cooldown.bestial_wrath.remains<=2|target.time_to_die<=14
B 47.87 dire_beast,if=cooldown.bestial_wrath.remains>2
0.00 dire_frenzy,if=cooldown.bestial_wrath.remains>2
C 4.02 aspect_of_the_wild,if=buff.bestial_wrath.up
0.00 barrage,if=spell_targets.barrage>1|(spell_targets.barrage=1&focus>90)
0.00 titans_thunder,if=cooldown.dire_beast.remains>=3|buff.bestial_wrath.up&pet.dire_beast.active
D 12.52 bestial_wrath
0.00 multi_shot,if=spell_targets.multi_shot>4&(pet.buff.beast_cleave.remains<gcd.max|pet.buff.beast_cleave.down)
E 66.41 kill_command
0.00 multi_shot,if=spell_targets.multi_shot>1&(pet.buff.beast_cleave.remains<gcd.max*2|pet.buff.beast_cleave.down)
0.00 chimaera_shot,if=focus<90
F 101.26 cobra_shot,if=talent.killer_cobra.enabled&(cooldown.bestial_wrath.remains>=4&(buff.bestial_wrath.up&cooldown.kill_command.remains>=2)|focus>119)|!talent.killer_cobra.enabled&focus>90

Sample Sequence

01245679ADBCEFFFFEFBFFEFBEFFEBFEDFEBFFEFBEFFEBF8E9BDEFFEBFEFFBEFFEBFEFBDEFFEBF79CEFFBEFFFEBFBDEFFEBFEFEBFFEFBEF9EBADFEFEBFFEBFEFFEBFEFBDEFFBE79CFFEBFFFEFBEFFEBDFEFBEFFEBFEFE9BFEFEDBBFFEFBEFFEBFEFDEBFFEB7F9EFEBFFEBADCFEFFFEBFFEBFFEFBEFFEB9DEFFBEBFFEF

Sample Sequence Table

time name target resources buffs
Pre flask Beckîe 140.0/140: 100% focus
Pre food Beckîe 140.0/140: 100% focus
Pre summon_pet Fluffy_Pillow 140.0/140: 100% focus
Pre potion Fluffy_Pillow 140.0/140: 100% focus potion_of_deadly_grace
Pre augmentation Beckîe 140.0/140: 100% focus potion_of_deadly_grace
0:00.000 start_auto_shot Fluffy_Pillow 140.0/140: 100% focus potion_of_deadly_grace
0:00.000 use_item_horn_of_valor Fluffy_Pillow 140.0/140: 100% focus potion_of_deadly_grace
0:00.000 a_murder_of_crows Fluffy_Pillow 140.0/140: 100% focus valarjars_path, potion_of_deadly_grace
0:01.324 stampede Fluffy_Pillow 129.2/140: 92% focus bloodlust, valarjars_path, potion_of_deadly_grace
0:01.324 bestial_wrath Fluffy_Pillow 129.2/140: 92% focus bloodlust, valarjars_path, potion_of_deadly_grace
0:01.324 dire_beast Fluffy_Pillow 129.2/140: 92% focus bloodlust, bestial_wrath, valarjars_path, potion_of_deadly_grace
0:02.079 aspect_of_the_wild Fluffy_Pillow 140.0/140: 100% focus bloodlust, bestial_wrath, dire_beast, valarjars_path, potion_of_deadly_grace
0:02.079 kill_command Fluffy_Pillow 140.0/140: 100% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, valarjars_path, potion_of_deadly_grace
0:02.834 cobra_shot Fluffy_Pillow 129.8/140: 93% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, valarjars_path, potion_of_deadly_grace
0:03.853 cobra_shot Fluffy_Pillow 116.6/140: 83% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, valarjars_path, potion_of_deadly_grace
0:04.872 cobra_shot Fluffy_Pillow 103.4/140: 74% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, valarjars_path, potion_of_deadly_grace
0:05.890 cobra_shot Fluffy_Pillow 90.2/140: 64% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, valarjars_path, potion_of_deadly_grace
0:06.909 kill_command Fluffy_Pillow 77.0/140: 55% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, valarjars_path, potion_of_deadly_grace
0:07.905 Waiting 0.700 sec 73.1/140: 52% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, valarjars_path, potion_of_deadly_grace
0:08.605 cobra_shot Fluffy_Pillow 91.5/140: 65% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, valarjars_path, potion_of_deadly_grace
0:09.624 dire_beast Fluffy_Pillow 77.9/140: 56% focus bloodlust, aspect_of_the_wild, bestial_wrath, valarjars_path, potion_of_deadly_grace
0:10.378 cobra_shot Fluffy_Pillow 97.7/140: 70% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, valarjars_path, potion_of_deadly_grace
0:11.395 Waiting 0.300 sec 84.4/140: 60% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, valarjars_path, potion_of_deadly_grace
0:11.695 cobra_shot Fluffy_Pillow 92.3/140: 66% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, valarjars_path, potion_of_deadly_grace
0:12.713 kill_command Fluffy_Pillow 72.7/140: 52% focus bloodlust, bestial_wrath, dire_beast, valarjars_path, potion_of_deadly_grace
0:13.467 Waiting 2.200 sec 55.0/140: 39% focus bloodlust, bestial_wrath, dire_beast, valarjars_path, potion_of_deadly_grace
0:15.667 cobra_shot Fluffy_Pillow 90.9/140: 65% focus bloodlust, bestial_wrath, dire_beast, valarjars_path, potion_of_deadly_grace
0:16.687 Waiting 0.900 sec 67.5/140: 48% focus bloodlust, dire_beast, valarjars_path, potion_of_deadly_grace
0:17.587 dire_beast Fluffy_Pillow 82.1/140: 59% focus bloodlust, dire_beast, valarjars_path, potion_of_deadly_grace
0:18.493 kill_command Fluffy_Pillow 96.6/140: 69% focus bloodlust, dire_beast, valarjars_path, potion_of_deadly_grace
0:19.248 Waiting 0.700 sec 78.9/140: 56% focus bloodlust, dire_beast, valarjars_path, potion_of_deadly_grace
0:19.948 cobra_shot Fluffy_Pillow 90.3/140: 65% focus bloodlust, dire_beast, valarjars_path, potion_of_deadly_grace
0:20.966 Waiting 1.500 sec 66.9/140: 48% focus bloodlust, dire_beast, valarjars_path, potion_of_deadly_grace
0:22.466 cobra_shot Fluffy_Pillow 91.4/140: 65% focus bloodlust, dire_beast, valarjars_path, potion_of_deadly_grace
0:23.485 kill_command Fluffy_Pillow 67.9/140: 49% focus bloodlust, dire_beast, valarjars_path
0:24.320 Waiting 1.300 sec 51.5/140: 37% focus bloodlust, dire_beast, valarjars_path
0:25.620 dire_beast Fluffy_Pillow 72.7/140: 52% focus bloodlust, dire_beast, valarjars_path
0:26.609 Waiting 0.100 sec 88.5/140: 63% focus bloodlust, dire_beast, valarjars_path
0:26.709 cobra_shot Fluffy_Pillow 90.1/140: 64% focus bloodlust, dire_beast, valarjars_path
0:27.729 Waiting 0.700 sec 66.7/140: 48% focus bloodlust, dire_beast, valarjars_path
0:28.429 kill_command Fluffy_Pillow 78.1/140: 56% focus bloodlust, dire_beast, valarjars_path
0:29.392 Waiting 1.700 sec 63.8/140: 46% focus bloodlust, dire_beast, valarjars_path
0:31.092 bestial_wrath Fluffy_Pillow 91.5/140: 65% focus bloodlust, dire_beast
0:31.324 cobra_shot Fluffy_Pillow 95.3/140: 68% focus bloodlust, bestial_wrath, dire_beast
0:32.342 Waiting 1.200 sec 71.8/140: 51% focus bloodlust, bestial_wrath, dire_beast
0:33.542 kill_command Fluffy_Pillow 91.4/140: 65% focus bloodlust, bestial_wrath, dire_beast
0:34.464 dire_beast Fluffy_Pillow 75.3/140: 54% focus bloodlust, bestial_wrath
0:35.218 Waiting 0.200 sec 87.5/140: 63% focus bloodlust, bestial_wrath, dire_beast
0:35.418 cobra_shot Fluffy_Pillow 90.8/140: 65% focus bloodlust, bestial_wrath, dire_beast
0:36.439 Waiting 1.400 sec 67.4/140: 48% focus bloodlust, bestial_wrath, dire_beast
0:37.839 cobra_shot Fluffy_Pillow 90.2/140: 64% focus bloodlust, bestial_wrath, dire_beast
0:38.858 kill_command Fluffy_Pillow 66.8/140: 48% focus bloodlust, bestial_wrath, dire_beast
0:39.613 Waiting 2.900 sec 49.1/140: 35% focus bloodlust, bestial_wrath, dire_beast
0:42.513 cobra_shot Fluffy_Pillow 90.7/140: 65% focus bestial_wrath
0:43.836 dire_beast Fluffy_Pillow 65.8/140: 47% focus bestial_wrath
0:44.999 kill_command Fluffy_Pillow 80.8/140: 58% focus bestial_wrath, dire_beast
0:46.160 Waiting 1.900 sec 65.7/140: 47% focus bestial_wrath, dire_beast
0:48.060 cobra_shot Fluffy_Pillow 90.2/140: 64% focus dire_beast
0:49.380 Waiting 1.800 sec 67.2/140: 48% focus dire_beast
0:51.180 cobra_shot Fluffy_Pillow 90.3/140: 65% focus dire_beast
0:52.502 kill_command Fluffy_Pillow 65.4/140: 47% focus
0:53.664 Waiting 0.500 sec 48.6/140: 35% focus
0:54.164 dire_beast Fluffy_Pillow 54.3/140: 39% focus
0:55.547 Waiting 1.500 sec 71.7/140: 51% focus dire_beast
0:57.047 cobra_shot Fluffy_Pillow 91.1/140: 65% focus dire_beast
0:58.370 potion Fluffy_Pillow 68.1/140: 49% focus dire_beast
0:58.370 Waiting 0.500 sec 68.1/140: 49% focus dire_beast, potion_of_deadly_grace
0:58.870 kill_command Fluffy_Pillow 74.5/140: 53% focus dire_beast, potion_of_deadly_grace
1:00.260 a_murder_of_crows Fluffy_Pillow 62.4/140: 45% focus dire_beast, potion_of_deadly_grace
1:01.583 Waiting 3.200 sec 49.5/140: 35% focus dire_beast, potion_of_deadly_grace
1:04.783 dire_beast Fluffy_Pillow 87.1/140: 62% focus potion_of_deadly_grace
1:06.098 bestial_wrath Fluffy_Pillow 103.7/140: 74% focus dire_beast, potion_of_deadly_grace
1:06.098 kill_command Fluffy_Pillow 103.7/140: 74% focus bestial_wrath, dire_beast, potion_of_deadly_grace
1:07.260 Waiting 0.200 sec 88.7/140: 63% focus bestial_wrath, dire_beast, potion_of_deadly_grace
1:07.460 cobra_shot Fluffy_Pillow 91.3/140: 65% focus bestial_wrath, dire_beast, potion_of_deadly_grace
1:08.782 Waiting 1.700 sec 68.3/140: 49% focus bestial_wrath, dire_beast, potion_of_deadly_grace
1:10.482 cobra_shot Fluffy_Pillow 90.2/140: 64% focus bestial_wrath, dire_beast, potion_of_deadly_grace
1:11.805 Waiting 0.700 sec 67.2/140: 48% focus bestial_wrath, dire_beast, potion_of_deadly_grace
1:12.505 kill_command Fluffy_Pillow 76.2/140: 54% focus bestial_wrath, dire_beast, potion_of_deadly_grace
1:13.854 Waiting 1.400 sec 61.9/140: 44% focus bestial_wrath, potion_of_deadly_grace
1:15.254 dire_beast Fluffy_Pillow 77.8/140: 56% focus bestial_wrath, potion_of_deadly_grace
1:16.648 cobra_shot Fluffy_Pillow 95.4/140: 68% focus bestial_wrath, dire_beast, potion_of_deadly_grace
1:17.970 Waiting 1.100 sec 72.4/140: 52% focus bestial_wrath, dire_beast, potion_of_deadly_grace
1:19.070 kill_command Fluffy_Pillow 86.6/140: 62% focus bestial_wrath, dire_beast, potion_of_deadly_grace
1:20.450 Waiting 1.300 sec 74.3/140: 53% focus bestial_wrath, dire_beast, potion_of_deadly_grace
1:21.750 cobra_shot Fluffy_Pillow 91.1/140: 65% focus dire_beast, potion_of_deadly_grace
1:23.074 Waiting 1.900 sec 68.1/140: 49% focus dire_beast, potion_of_deadly_grace
1:24.974 cobra_shot Fluffy_Pillow 90.3/140: 65% focus
1:26.296 dire_beast Fluffy_Pillow 65.4/140: 47% focus
1:27.460 kill_command Fluffy_Pillow 80.3/140: 57% focus dire_beast
1:28.624 Waiting 2.000 sec 65.3/140: 47% focus dire_beast
1:30.624 cobra_shot Fluffy_Pillow 91.1/140: 65% focus dire_beast
1:31.947 Waiting 1.800 sec 68.1/140: 49% focus dire_beast
1:33.747 cobra_shot Fluffy_Pillow 91.3/140: 65% focus dire_beast
1:35.070 kill_command Fluffy_Pillow 66.3/140: 47% focus
1:36.233 Waiting 0.400 sec 49.6/140: 35% focus
1:36.633 dire_beast Fluffy_Pillow 54.1/140: 39% focus
1:38.009 Waiting 1.500 sec 71.5/140: 51% focus dire_beast
1:39.509 cobra_shot Fluffy_Pillow 90.8/140: 65% focus dire_beast
1:40.832 Waiting 0.600 sec 67.8/140: 48% focus dire_beast
1:41.432 kill_command Fluffy_Pillow 75.6/140: 54% focus dire_beast
1:42.827 Waiting 2.100 sec 63.5/140: 45% focus dire_beast
1:44.927 cobra_shot Fluffy_Pillow 90.4/140: 65% focus
1:46.249 Waiting 0.900 sec 65.4/140: 47% focus
1:47.149 dire_beast Fluffy_Pillow 75.7/140: 54% focus
1:48.559 bestial_wrath Fluffy_Pillow 93.5/140: 67% focus dire_beast
1:48.559 kill_command Fluffy_Pillow 93.5/140: 67% focus bestial_wrath, dire_beast
1:49.721 Waiting 0.900 sec 78.4/140: 56% focus bestial_wrath, dire_beast
1:50.621 cobra_shot Fluffy_Pillow 90.0/140: 64% focus bestial_wrath, dire_beast
1:51.943 Waiting 1.800 sec 67.0/140: 48% focus bestial_wrath, dire_beast
1:53.743 cobra_shot Fluffy_Pillow 90.2/140: 64% focus bestial_wrath, dire_beast
1:55.065 kill_command Fluffy_Pillow 67.2/140: 48% focus bestial_wrath, dire_beast
1:56.315 Waiting 1.400 sec 51.6/140: 37% focus bestial_wrath
1:57.715 dire_beast Fluffy_Pillow 67.5/140: 48% focus bestial_wrath
1:59.109 Waiting 0.400 sec 85.1/140: 61% focus bestial_wrath, dire_beast
1:59.509 cobra_shot Fluffy_Pillow 90.2/140: 64% focus bestial_wrath, dire_beast
2:00.831 use_item_horn_of_valor Fluffy_Pillow 67.3/140: 48% focus bestial_wrath, dire_beast
2:00.831 a_murder_of_crows Fluffy_Pillow 67.3/140: 48% focus bestial_wrath, dire_beast, valarjars_path
2:02.155 aspect_of_the_wild Fluffy_Pillow 54.3/140: 39% focus bestial_wrath, dire_beast, valarjars_path
2:02.155 kill_command Fluffy_Pillow 54.3/140: 39% focus aspect_of_the_wild, bestial_wrath, dire_beast, valarjars_path
2:03.318 Waiting 1.800 sec 50.9/140: 36% focus aspect_of_the_wild, bestial_wrath, dire_beast, valarjars_path
2:05.118 cobra_shot Fluffy_Pillow 92.1/140: 66% focus aspect_of_the_wild, dire_beast, valarjars_path
2:06.441 Waiting 0.500 sec 81.4/140: 58% focus aspect_of_the_wild, valarjars_path
2:06.941 cobra_shot Fluffy_Pillow 92.1/140: 66% focus aspect_of_the_wild, valarjars_path
2:08.262 dire_beast Fluffy_Pillow 80.3/140: 57% focus aspect_of_the_wild, valarjars_path
2:09.659 kill_command Fluffy_Pillow 112.0/140: 80% focus aspect_of_the_wild, dire_beast, valarjars_path
2:10.822 cobra_shot Fluffy_Pillow 108.6/140: 78% focus aspect_of_the_wild, dire_beast, valarjars_path
2:12.144 cobra_shot Fluffy_Pillow 98.8/140: 71% focus aspect_of_the_wild, dire_beast, valarjars_path
2:13.467 Waiting 1.100 sec 75.9/140: 54% focus dire_beast, valarjars_path
2:14.567 cobra_shot Fluffy_Pillow 90.1/140: 64% focus dire_beast, valarjars_path
2:15.890 Waiting 0.200 sec 67.1/140: 48% focus dire_beast, valarjars_path
2:16.090 kill_command Fluffy_Pillow 69.7/140: 50% focus dire_beast, valarjars_path
2:17.415 Waiting 1.400 sec 55.0/140: 39% focus valarjars_path
2:18.815 dire_beast Fluffy_Pillow 70.9/140: 51% focus valarjars_path
2:20.208 Waiting 0.200 sec 88.5/140: 63% focus dire_beast, valarjars_path
2:20.408 cobra_shot Fluffy_Pillow 91.1/140: 65% focus dire_beast, valarjars_path
2:21.730 Waiting 0.300 sec 68.1/140: 49% focus dire_beast, valarjars_path
2:22.030 dire_beast Fluffy_Pillow 72.0/140: 51% focus dire_beast, valarjars_path
2:23.192 bestial_wrath Fluffy_Pillow 88.7/140: 63% focus dire_beast(2), valarjars_path
2:23.192 kill_command Fluffy_Pillow 88.7/140: 63% focus bestial_wrath, dire_beast(2), valarjars_path
2:24.353 Waiting 1.100 sec 75.4/140: 54% focus bestial_wrath, dire_beast(2), valarjars_path
2:25.453 cobra_shot Fluffy_Pillow 91.2/140: 65% focus bestial_wrath, dire_beast(2), valarjars_path
2:26.775 Waiting 1.600 sec 70.2/140: 50% focus bestial_wrath, dire_beast(2), valarjars_path
2:28.375 cobra_shot Fluffy_Pillow 91.2/140: 65% focus bestial_wrath, dire_beast, valarjars_path
2:29.697 kill_command Fluffy_Pillow 68.3/140: 49% focus bestial_wrath, dire_beast, valarjars_path
2:30.948 Waiting 1.400 sec 52.7/140: 38% focus bestial_wrath
2:32.348 dire_beast Fluffy_Pillow 68.6/140: 49% focus bestial_wrath
2:33.743 Waiting 0.300 sec 86.2/140: 62% focus bestial_wrath, dire_beast
2:34.043 cobra_shot Fluffy_Pillow 90.1/140: 64% focus bestial_wrath, dire_beast
2:35.364 Waiting 0.800 sec 67.1/140: 48% focus bestial_wrath, dire_beast
2:36.164 kill_command Fluffy_Pillow 77.4/140: 55% focus bestial_wrath, dire_beast
2:37.541 Waiting 2.000 sec 65.1/140: 47% focus bestial_wrath, dire_beast
2:39.541 cobra_shot Fluffy_Pillow 90.9/140: 65% focus dire_beast
2:40.866 Waiting 1.900 sec 67.2/140: 48% focus
2:42.766 kill_command Fluffy_Pillow 88.8/140: 63% focus
2:44.137 dire_beast Fluffy_Pillow 74.4/140: 53% focus
2:45.301 Waiting 0.100 sec 89.4/140: 64% focus dire_beast
2:45.401 cobra_shot Fluffy_Pillow 90.7/140: 65% focus dire_beast
2:46.721 Waiting 1.800 sec 67.7/140: 48% focus dire_beast
2:48.521 cobra_shot Fluffy_Pillow 90.9/140: 65% focus dire_beast
2:49.844 kill_command Fluffy_Pillow 67.9/140: 49% focus dire_beast
2:51.007 Waiting 3.200 sec 52.9/140: 38% focus dire_beast
2:54.207 cobra_shot Fluffy_Pillow 90.9/140: 65% focus
2:55.530 dire_beast Fluffy_Pillow 66.0/140: 47% focus
2:56.693 kill_command Fluffy_Pillow 80.9/140: 58% focus dire_beast
2:57.856 Waiting 1.900 sec 65.9/140: 47% focus dire_beast
2:59.756 cobra_shot Fluffy_Pillow 90.4/140: 65% focus dire_beast
3:01.079 a_murder_of_crows Fluffy_Pillow 67.4/140: 48% focus dire_beast
3:02.401 Waiting 0.700 sec 54.4/140: 39% focus dire_beast
3:03.101 kill_command Fluffy_Pillow 63.4/140: 45% focus dire_beast
3:04.449 Waiting 1.400 sec 49.0/140: 35% focus
3:05.849 dire_beast Fluffy_Pillow 65.0/140: 46% focus
3:07.242 stampede Fluffy_Pillow 82.6/140: 59% focus dire_beast
3:07.242 bestial_wrath Fluffy_Pillow 82.6/140: 59% focus dire_beast
3:07.242 Waiting 0.600 sec 82.6/140: 59% focus bestial_wrath, dire_beast
3:07.842 cobra_shot Fluffy_Pillow 90.3/140: 64% focus bestial_wrath, dire_beast
3:09.163 Waiting 0.500 sec 67.3/140: 48% focus bestial_wrath, dire_beast
3:09.663 kill_command Fluffy_Pillow 73.7/140: 53% focus bestial_wrath, dire_beast
3:11.044 Waiting 2.300 sec 61.5/140: 44% focus bestial_wrath, dire_beast
3:13.344 cobra_shot Fluffy_Pillow 91.1/140: 65% focus bestial_wrath, dire_beast
3:14.667 Waiting 1.600 sec 67.3/140: 48% focus bestial_wrath
3:16.267 kill_command Fluffy_Pillow 85.5/140: 61% focus bestial_wrath
3:17.637 dire_beast Fluffy_Pillow 71.0/140: 51% focus bestial_wrath
3:18.799 Waiting 0.400 sec 86.0/140: 61% focus bestial_wrath, dire_beast
3:19.199 cobra_shot Fluffy_Pillow 91.2/140: 65% focus bestial_wrath, dire_beast
3:20.521 Waiting 1.700 sec 68.2/140: 49% focus bestial_wrath, dire_beast
3:22.221 cobra_shot Fluffy_Pillow 90.1/140: 64% focus bestial_wrath, dire_beast
3:23.544 kill_command Fluffy_Pillow 67.1/140: 48% focus dire_beast
3:24.706 Waiting 3.300 sec 52.1/140: 37% focus dire_beast
3:28.006 dire_beast Fluffy_Pillow 90.9/140: 65% focus
3:29.350 cobra_shot Fluffy_Pillow 108.0/140: 77% focus dire_beast
3:30.674 kill_command Fluffy_Pillow 85.0/140: 61% focus dire_beast
3:31.836 Waiting 1.600 sec 70.0/140: 50% focus dire_beast
3:33.436 cobra_shot Fluffy_Pillow 90.6/140: 65% focus dire_beast
3:34.758 Waiting 1.800 sec 67.6/140: 48% focus dire_beast
3:36.558 cobra_shot Fluffy_Pillow 90.2/140: 64% focus
3:37.880 kill_command Fluffy_Pillow 65.2/140: 47% focus
3:39.045 dire_beast Fluffy_Pillow 48.4/140: 35% focus
3:40.207 Waiting 2.100 sec 63.4/140: 45% focus dire_beast
3:42.307 cobra_shot Fluffy_Pillow 90.4/140: 65% focus dire_beast
3:43.629 Waiting 0.600 sec 67.5/140: 48% focus dire_beast
3:44.229 kill_command Fluffy_Pillow 75.2/140: 54% focus dire_beast
3:45.636 Waiting 2.200 sec 63.3/140: 45% focus dire_beast
3:47.836 cobra_shot Fluffy_Pillow 90.4/140: 65% focus
3:49.158 Waiting 0.200 sec 65.5/140: 47% focus
3:49.358 dire_beast Fluffy_Pillow 67.7/140: 48% focus
3:50.758 bestial_wrath Fluffy_Pillow 85.4/140: 61% focus dire_beast
3:50.758 Waiting 0.100 sec 85.4/140: 61% focus bestial_wrath, dire_beast
3:50.858 kill_command Fluffy_Pillow 86.7/140: 62% focus bestial_wrath, dire_beast
3:52.232 Waiting 1.300 sec 74.4/140: 53% focus bestial_wrath, dire_beast
3:53.532 cobra_shot Fluffy_Pillow 91.1/140: 65% focus bestial_wrath, dire_beast
3:54.854 Waiting 1.700 sec 68.1/140: 49% focus bestial_wrath, dire_beast
3:56.554 cobra_shot Fluffy_Pillow 90.0/140: 64% focus bestial_wrath, dire_beast
3:57.878 dire_beast Fluffy_Pillow 65.5/140: 47% focus bestial_wrath
3:59.040 kill_command Fluffy_Pillow 80.5/140: 58% focus bestial_wrath, dire_beast
4:00.201 Waiting 0.400 sec 65.4/140: 47% focus bestial_wrath, dire_beast
4:00.601 use_item_horn_of_valor Fluffy_Pillow 70.6/140: 50% focus bestial_wrath, dire_beast
4:00.831 a_murder_of_crows Fluffy_Pillow 73.6/140: 53% focus bestial_wrath, dire_beast, valarjars_path
4:02.402 aspect_of_the_wild Fluffy_Pillow 63.8/140: 46% focus bestial_wrath, dire_beast, valarjars_path
4:02.402 Waiting 1.200 sec 63.8/140: 46% focus aspect_of_the_wild, bestial_wrath, dire_beast, valarjars_path
4:03.602 cobra_shot Fluffy_Pillow 91.2/140: 65% focus aspect_of_the_wild, bestial_wrath, dire_beast, valarjars_path
4:04.924 Waiting 0.400 sec 81.5/140: 58% focus aspect_of_the_wild, bestial_wrath, dire_beast, valarjars_path
4:05.324 cobra_shot Fluffy_Pillow 90.6/140: 65% focus aspect_of_the_wild, bestial_wrath, dire_beast, valarjars_path
4:06.647 kill_command Fluffy_Pillow 78.9/140: 56% focus aspect_of_the_wild, valarjars_path
4:07.810 Waiting 0.400 sec 73.8/140: 53% focus aspect_of_the_wild, valarjars_path
4:08.210 dire_beast Fluffy_Pillow 82.3/140: 59% focus aspect_of_the_wild, valarjars_path
4:09.590 cobra_shot Fluffy_Pillow 113.5/140: 81% focus aspect_of_the_wild, dire_beast, valarjars_path
4:10.912 cobra_shot Fluffy_Pillow 103.8/140: 74% focus aspect_of_the_wild, dire_beast, valarjars_path
4:12.235 cobra_shot Fluffy_Pillow 94.0/140: 67% focus aspect_of_the_wild, dire_beast, valarjars_path
4:13.557 kill_command Fluffy_Pillow 72.7/140: 52% focus dire_beast, valarjars_path
4:14.721 Waiting 2.700 sec 57.7/140: 41% focus dire_beast, valarjars_path
4:17.421 cobra_shot Fluffy_Pillow 91.0/140: 65% focus valarjars_path
4:18.744 dire_beast Fluffy_Pillow 66.0/140: 47% focus valarjars_path
4:20.141 kill_command Fluffy_Pillow 83.7/140: 60% focus dire_beast, valarjars_path
4:21.313 Waiting 1.700 sec 68.7/140: 49% focus dire_beast, valarjars_path
4:23.013 cobra_shot Fluffy_Pillow 90.6/140: 65% focus dire_beast, valarjars_path
4:24.337 Waiting 1.800 sec 67.7/140: 48% focus dire_beast, valarjars_path
4:26.137 cobra_shot Fluffy_Pillow 90.9/140: 65% focus dire_beast, valarjars_path
4:27.460 kill_command Fluffy_Pillow 65.9/140: 47% focus valarjars_path
4:28.621 Waiting 0.700 sec 49.1/140: 35% focus valarjars_path
4:29.321 dire_beast Fluffy_Pillow 57.1/140: 41% focus valarjars_path
4:30.690 bestial_wrath Fluffy_Pillow 74.4/140: 53% focus dire_beast, valarjars_path
4:30.690 Waiting 1.300 sec 74.4/140: 53% focus bestial_wrath, dire_beast, valarjars_path
4:31.990 cobra_shot Fluffy_Pillow 91.1/140: 65% focus bestial_wrath, dire_beast
4:33.312 Waiting 0.500 sec 68.1/140: 49% focus bestial_wrath, dire_beast
4:33.812 kill_command Fluffy_Pillow 74.6/140: 53% focus bestial_wrath, dire_beast
4:35.215 Waiting 2.200 sec 62.6/140: 45% focus bestial_wrath, dire_beast
4:37.415 cobra_shot Fluffy_Pillow 91.0/140: 65% focus bestial_wrath, dire_beast
4:38.736 Waiting 1.100 sec 66.0/140: 47% focus bestial_wrath
4:39.836 dire_beast Fluffy_Pillow 78.5/140: 56% focus bestial_wrath
4:41.241 kill_command Fluffy_Pillow 96.2/140: 69% focus bestial_wrath, dire_beast
4:42.403 Waiting 0.700 sec 81.2/140: 58% focus bestial_wrath, dire_beast
4:43.103 cobra_shot Fluffy_Pillow 90.2/140: 64% focus bestial_wrath, dire_beast
4:44.426 Waiting 1.800 sec 67.2/140: 48% focus bestial_wrath, dire_beast
4:46.226 cobra_shot Fluffy_Pillow 90.4/140: 65% focus dire_beast
4:47.549 Waiting 0.100 sec 67.4/140: 48% focus dire_beast
4:47.649 kill_command Fluffy_Pillow 68.7/140: 49% focus dire_beast
4:48.998 Waiting 1.400 sec 54.3/140: 39% focus
4:50.398 dire_beast Fluffy_Pillow 70.3/140: 50% focus
4:51.792 Waiting 0.200 sec 87.9/140: 63% focus dire_beast
4:51.992 cobra_shot Fluffy_Pillow 90.4/140: 65% focus dire_beast
4:53.315 Waiting 0.900 sec 67.5/140: 48% focus dire_beast
4:54.215 kill_command Fluffy_Pillow 79.1/140: 56% focus dire_beast
4:55.592 Waiting 1.900 sec 66.8/140: 48% focus dire_beast
4:57.492 cobra_shot Fluffy_Pillow 91.2/140: 65% focus dire_beast
4:58.813 Waiting 2.000 sec 66.3/140: 47% focus
5:00.813 kill_command Fluffy_Pillow 89.0/140: 64% focus
5:02.185 a_murder_of_crows Fluffy_Pillow 74.7/140: 53% focus
5:03.507 dire_beast Fluffy_Pillow 59.7/140: 43% focus
5:04.670 Waiting 1.200 sec 74.7/140: 53% focus dire_beast
5:05.870 cobra_shot Fluffy_Pillow 90.1/140: 64% focus dire_beast
5:07.194 Waiting 0.200 sec 67.2/140: 48% focus dire_beast
5:07.394 kill_command Fluffy_Pillow 69.7/140: 50% focus dire_beast
5:08.779 Waiting 2.600 sec 57.6/140: 41% focus dire_beast
5:11.379 cobra_shot Fluffy_Pillow 91.0/140: 65% focus dire_beast
5:12.702 Waiting 1.300 sec 66.1/140: 47% focus
5:14.002 kill_command Fluffy_Pillow 80.9/140: 58% focus
5:15.376 Waiting 0.100 sec 66.5/140: 47% focus
5:15.476 bestial_wrath Fluffy_Pillow 67.6/140: 48% focus
5:15.690 dire_beast Fluffy_Pillow 70.1/140: 50% focus bestial_wrath
5:16.853 dire_beast Fluffy_Pillow 85.0/140: 61% focus bestial_wrath, dire_beast
5:18.015 cobra_shot Fluffy_Pillow 101.7/140: 73% focus bestial_wrath, dire_beast(2)
5:19.339 Waiting 0.700 sec 80.8/140: 58% focus bestial_wrath, dire_beast(2)
5:20.039 cobra_shot Fluffy_Pillow 90.8/140: 65% focus bestial_wrath, dire_beast(2)
5:21.361 kill_command Fluffy_Pillow 69.8/140: 50% focus bestial_wrath, dire_beast(2)
5:22.521 Waiting 2.500 sec 56.5/140: 40% focus bestial_wrath, dire_beast(2)
5:25.021 cobra_shot Fluffy_Pillow 90.0/140: 64% focus bestial_wrath
5:26.343 Waiting 0.900 sec 65.1/140: 46% focus bestial_wrath
5:27.243 dire_beast Fluffy_Pillow 75.3/140: 54% focus bestial_wrath
5:28.567 kill_command Fluffy_Pillow 92.1/140: 66% focus bestial_wrath, dire_beast
5:29.730 Waiting 1.100 sec 77.1/140: 55% focus bestial_wrath, dire_beast
5:30.830 cobra_shot Fluffy_Pillow 91.3/140: 65% focus dire_beast
5:32.153 Waiting 1.700 sec 68.3/140: 49% focus dire_beast
5:33.853 cobra_shot Fluffy_Pillow 90.2/140: 64% focus dire_beast
5:35.176 kill_command Fluffy_Pillow 67.2/140: 48% focus dire_beast
5:36.339 Waiting 1.400 sec 50.4/140: 36% focus
5:37.739 dire_beast Fluffy_Pillow 66.4/140: 47% focus
5:39.115 Waiting 0.500 sec 83.7/140: 60% focus dire_beast
5:39.615 cobra_shot Fluffy_Pillow 90.2/140: 64% focus dire_beast
5:40.938 Waiting 0.600 sec 67.2/140: 48% focus dire_beast
5:41.538 kill_command Fluffy_Pillow 74.9/140: 54% focus dire_beast
5:42.933 Waiting 2.200 sec 62.9/140: 45% focus dire_beast
5:45.133 cobra_shot Fluffy_Pillow 91.2/140: 65% focus dire_beast
5:46.454 bestial_wrath Fluffy_Pillow 66.2/140: 47% focus
5:46.454 Waiting 1.700 sec 66.2/140: 47% focus bestial_wrath
5:48.154 kill_command Fluffy_Pillow 85.6/140: 61% focus bestial_wrath
5:49.528 dire_beast Fluffy_Pillow 71.2/140: 51% focus bestial_wrath
5:50.690 Waiting 0.300 sec 86.2/140: 62% focus bestial_wrath, dire_beast
5:50.990 cobra_shot Fluffy_Pillow 90.0/140: 64% focus bestial_wrath, dire_beast
5:52.314 Waiting 1.800 sec 67.1/140: 48% focus bestial_wrath, dire_beast
5:54.114 cobra_shot Fluffy_Pillow 90.3/140: 64% focus bestial_wrath, dire_beast
5:55.436 kill_command Fluffy_Pillow 67.3/140: 48% focus bestial_wrath, dire_beast
5:56.597 Waiting 3.300 sec 52.2/140: 37% focus bestial_wrath, dire_beast
5:59.897 dire_beast Fluffy_Pillow 91.1/140: 65% focus bestial_wrath
6:01.241 use_item_horn_of_valor Fluffy_Pillow 108.1/140: 77% focus bestial_wrath, dire_beast
6:01.241 cobra_shot Fluffy_Pillow 108.1/140: 77% focus bestial_wrath, dire_beast, valarjars_path
6:02.564 a_murder_of_crows Fluffy_Pillow 85.2/140: 61% focus dire_beast, valarjars_path
6:03.888 kill_command Fluffy_Pillow 72.2/140: 52% focus dire_beast, valarjars_path
6:05.052 Waiting 2.600 sec 57.2/140: 41% focus dire_beast, valarjars_path
6:07.652 cobra_shot Fluffy_Pillow 90.7/140: 65% focus dire_beast, valarjars_path
6:08.974 Waiting 1.300 sec 65.7/140: 47% focus valarjars_path
6:10.274 kill_command Fluffy_Pillow 80.5/140: 57% focus valarjars_path
6:11.645 dire_beast Fluffy_Pillow 66.1/140: 47% focus valarjars_path
6:12.809 Waiting 0.700 sec 81.1/140: 58% focus dire_beast, valarjars_path
6:13.509 cobra_shot Fluffy_Pillow 90.1/140: 64% focus dire_beast, valarjars_path
6:14.832 Waiting 1.800 sec 67.1/140: 48% focus dire_beast, valarjars_path
6:16.632 cobra_shot Fluffy_Pillow 90.3/140: 64% focus dire_beast, valarjars_path
6:17.954 kill_command Fluffy_Pillow 67.3/140: 48% focus dire_beast, valarjars_path
6:19.117 Waiting 2.900 sec 52.3/140: 37% focus dire_beast, valarjars_path
6:22.017 dire_beast Fluffy_Pillow 86.0/140: 61% focus valarjars_path
6:23.357 stampede Fluffy_Pillow 103.0/140: 74% focus dire_beast, valarjars_path
6:23.357 bestial_wrath Fluffy_Pillow 103.0/140: 74% focus dire_beast, valarjars_path
6:23.357 aspect_of_the_wild Fluffy_Pillow 103.0/140: 74% focus bestial_wrath, dire_beast, valarjars_path
6:23.357 cobra_shot Fluffy_Pillow 103.0/140: 74% focus aspect_of_the_wild, bestial_wrath, dire_beast, valarjars_path
6:24.680 kill_command Fluffy_Pillow 93.3/140: 67% focus aspect_of_the_wild, bestial_wrath, dire_beast, valarjars_path
6:25.843 Waiting 0.100 sec 89.9/140: 64% focus aspect_of_the_wild, bestial_wrath, dire_beast, valarjars_path
6:25.943 cobra_shot Fluffy_Pillow 92.1/140: 66% focus aspect_of_the_wild, bestial_wrath, dire_beast, valarjars_path
6:27.266 Waiting 0.400 sec 82.4/140: 59% focus aspect_of_the_wild, bestial_wrath, dire_beast, valarjars_path
6:27.666 cobra_shot Fluffy_Pillow 91.6/140: 65% focus aspect_of_the_wild, bestial_wrath, dire_beast, valarjars_path
6:28.990 Waiting 0.400 sec 81.8/140: 58% focus aspect_of_the_wild, bestial_wrath, dire_beast, valarjars_path
6:29.390 cobra_shot Fluffy_Pillow 91.0/140: 65% focus aspect_of_the_wild, bestial_wrath, dire_beast, valarjars_path
6:30.713 Waiting 0.400 sec 80.2/140: 57% focus aspect_of_the_wild, bestial_wrath, valarjars_path
6:31.113 kill_command Fluffy_Pillow 88.8/140: 63% focus aspect_of_the_wild, bestial_wrath, valarjars_path
6:32.437 Waiting 0.100 sec 87.1/140: 62% focus aspect_of_the_wild, bestial_wrath
6:32.537 dire_beast Fluffy_Pillow 89.2/140: 64% focus aspect_of_the_wild, bestial_wrath
6:33.907 cobra_shot Fluffy_Pillow 114.7/140: 82% focus bestial_wrath, dire_beast
6:35.230 cobra_shot Fluffy_Pillow 91.8/140: 66% focus bestial_wrath, dire_beast
6:36.553 Waiting 1.100 sec 68.8/140: 49% focus bestial_wrath, dire_beast
6:37.653 kill_command Fluffy_Pillow 83.0/140: 59% focus bestial_wrath, dire_beast
6:39.031 Waiting 1.400 sec 70.7/140: 51% focus dire_beast
6:40.431 dire_beast Fluffy_Pillow 88.7/140: 63% focus dire_beast
6:41.592 cobra_shot Fluffy_Pillow 103.7/140: 74% focus dire_beast
6:42.914 Waiting 0.800 sec 80.7/140: 58% focus dire_beast
6:43.714 cobra_shot Fluffy_Pillow 91.0/140: 65% focus dire_beast
6:45.036 kill_command Fluffy_Pillow 68.0/140: 49% focus dire_beast
6:46.199 Waiting 3.000 sec 53.0/140: 38% focus dire_beast
6:49.199 cobra_shot Fluffy_Pillow 90.4/140: 65% focus
6:50.522 Waiting 0.300 sec 65.5/140: 47% focus
6:50.822 dire_beast Fluffy_Pillow 68.9/140: 49% focus
6:52.144 kill_command Fluffy_Pillow 85.6/140: 61% focus dire_beast
6:53.306 Waiting 1.600 sec 70.6/140: 50% focus dire_beast
6:54.906 cobra_shot Fluffy_Pillow 91.2/140: 65% focus dire_beast
6:56.228 Waiting 1.700 sec 68.2/140: 49% focus dire_beast
6:57.928 cobra_shot Fluffy_Pillow 90.1/140: 64% focus dire_beast
6:59.249 kill_command Fluffy_Pillow 66.5/140: 47% focus
7:00.412 Waiting 0.900 sec 49.7/140: 35% focus
7:01.312 dire_beast Fluffy_Pillow 59.9/140: 43% focus
7:02.694 a_murder_of_crows Fluffy_Pillow 77.4/140: 55% focus dire_beast
7:04.016 bestial_wrath Fluffy_Pillow 64.4/140: 46% focus dire_beast
7:04.016 Waiting 1.600 sec 64.4/140: 46% focus bestial_wrath, dire_beast
7:05.616 kill_command Fluffy_Pillow 85.0/140: 61% focus bestial_wrath, dire_beast
7:07.004 Waiting 1.400 sec 72.9/140: 52% focus bestial_wrath, dire_beast
7:08.404 cobra_shot Fluffy_Pillow 90.9/140: 65% focus bestial_wrath, dire_beast
7:09.726 Waiting 2.000 sec 67.4/140: 48% focus bestial_wrath
7:11.726 cobra_shot Fluffy_Pillow 90.1/140: 64% focus bestial_wrath
7:13.048 dire_beast Fluffy_Pillow 65.2/140: 47% focus bestial_wrath
7:14.212 kill_command Fluffy_Pillow 80.2/140: 57% focus bestial_wrath, dire_beast
7:15.375 Waiting 2.000 sec 65.1/140: 47% focus bestial_wrath, dire_beast
7:17.375 dire_beast Fluffy_Pillow 90.9/140: 65% focus bestial_wrath, dire_beast
7:18.537 cobra_shot Fluffy_Pillow 107.6/140: 77% focus bestial_wrath, dire_beast(2)
7:19.859 Waiting 0.300 sec 86.6/140: 62% focus dire_beast(2)
7:20.159 cobra_shot Fluffy_Pillow 90.9/140: 65% focus dire_beast(2)
7:21.482 kill_command Fluffy_Pillow 67.9/140: 49% focus dire_beast
7:22.644 Waiting 3.000 sec 52.9/140: 38% focus dire_beast
7:25.644 cobra_shot Fluffy_Pillow 91.1/140: 65% focus
7:26.967 Waiting 0.600 sec 66.1/140: 47% focus

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 6227 6227 0
Agility 21835 20470 10462 (6098)
Stamina 26668 26668 16931
Intellect 6006 6006 0
Spirit 0 0 0
Health 1600080 1600080 0
Focus 140 140 0
Crit 28.04% 28.04% 4215
Haste 13.74% 13.74% 4465
Damage / Heal Versatility 5.33% 5.33% 2130
Attack Power 21835 20470 0
Mastery 62.37% 59.96% 6528
Armor 2409 2409 2409
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 836.00
Local Head Mask of the Unseen Path
ilevel: 830, stats: { 316 Armor, +1614 Sta, +1077 Agi, +866 Mastery, +345 Crit }
Local Neck Chain of the Underking
ilevel: 850, stats: { +1094 Sta, +1101 Crit, +734 Mastery }
Local Shoulders Burning Sky Pauldrons
ilevel: 840, stats: { 301 Armor, +886 AgiInt, +1329 Sta, +653 Haste, +289 Mastery, +506 unknown }
Local Shirt Precious' Ribbon
ilevel: 1
Local Chest Hillstride Vest of the Fireflash
ilevel: 825, stats: { 383 Armor, +1028 AgiInt, +1542 Sta, +764 Crit, +425 Haste }
Local Waist Gravenscale Girdle of the Fireflash
ilevel: 850, stats: { 233 Armor, +1459 Sta, +973 AgiInt, +279 Crit, +699 Haste }
Local Legs Leggings of the Unseen Path
ilevel: 830, stats: { 340 Armor, +1614 Sta, +1077 Agi, +735 Mastery, +476 Haste }
Local Feet Sea Stalker's Boots
ilevel: 835, stats: { 271 Armor, +846 AgiInt, +1269 Sta, +621 Mastery, +304 Vers }
Local Wrists Crestrider Conduit Bracers
ilevel: 845, stats: { 178 Armor, +696 AgiInt, +1045 Sta, +437 Haste, +283 Mastery }
Local Hands Lavabreaker Gauntlets
ilevel: 850, stats: { 259 Armor, +1459 Sta, +973 AgiInt, +574 Mastery, +406 Haste }
Local Finger1 Braided Silver Ring
ilevel: 840, stats: { +997 Sta, +960 Mastery, +808 Vers }, enchant: { +150 Mastery }
Local Finger2 Rough-Hammered Silver Ring
ilevel: 830, stats: { +908 Sta, +291 Avoidance, +1119 Crit, +584 Mastery }, enchant: { +150 Mastery }
Local Trinket1 Horn of Valor
ilevel: 810, stats: { +802 Vers }
Local Trinket2 An'she's Token of Guile
ilevel: 830, stats: { +1023 Agi, +865 Haste }
Local Back Shadowfeather Shawl
ilevel: 845, stats: { 128 Armor, +696 StrAgiInt, +1045 Sta, +216 Vers, +504 Haste }, enchant: { +150 Agi }
Local Main Hand Titanstrike
ilevel: 826, weapon: { 5589 - 5590, 3 }, stats: { +1037 Agi, +1556 Sta, +607 Crit, +582 Mastery }, relics: { +40 ilevels, +36 ilevels }
Local Tabard Stormwind Tabard
ilevel: 600

Talents

Level
15 Big Game Hunter (Beast Mastery Hunter) Way of the Cobra (Beast Mastery Hunter) Dire Stable (Beast Mastery Hunter)
30 Stomp (Beast Mastery Hunter) Dire Frenzy (Beast Mastery Hunter) Chimaera Shot (Beast Mastery Hunter)
45 Posthaste Farstrider Dash
60 One with the Pack (Beast Mastery Hunter) Bestial Fury (Beast Mastery Hunter) Blink Strikes (Beast Mastery Hunter)
75 Binding Shot Wyvern Sting Intimidation (Beast Mastery Hunter)
90 A Murder of Crows Barrage Volley
100 Stampede (Beast Mastery Hunter) Killer Cobra (Beast Mastery Hunter) Aspect of the Beast

Profile

hunter="Beckîe"
origin="https://eu.api.battle.net/wow/character/hyjal/Beckîe/advanced"
thumbnail="http://eu.battle.net/static-render/eu/hyjal/34/115107874-avatar.jpg"
level=110
race=night_elf
timeofday=day
role=attack
position=ranged_back
professions=jewelcrafting=700/enchanting=716
talents=http://eu.battle.net/wow/en/tool/talent-calculator#Ya!1001000
artifact=56:0:0:0:0:869:3:872:3:874:3:875:3:878:1:881:1:1336:1
spec=beast_mastery

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=nightborne_delicacy_platter
actions.precombat+=/summon_pet
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/augmentation,type=defiled

# Executed every time the actor is available.
actions=auto_shot
actions+=/use_item,name=horn_of_valor
actions+=/arcane_torrent,if=focus.deficit>=30
actions+=/blood_fury
actions+=/berserking
actions+=/potion,name=deadly_grace
actions+=/a_murder_of_crows
actions+=/stampede,if=buff.bloodlust.up|buff.bestial_wrath.up|cooldown.bestial_wrath.remains<=2|target.time_to_die<=14
actions+=/dire_beast,if=cooldown.bestial_wrath.remains>2
actions+=/dire_frenzy,if=cooldown.bestial_wrath.remains>2
actions+=/aspect_of_the_wild,if=buff.bestial_wrath.up
actions+=/barrage,if=spell_targets.barrage>1|(spell_targets.barrage=1&focus>90)
actions+=/titans_thunder,if=cooldown.dire_beast.remains>=3|buff.bestial_wrath.up&pet.dire_beast.active
actions+=/bestial_wrath
actions+=/multi_shot,if=spell_targets.multi_shot>4&(pet.buff.beast_cleave.remains<gcd.max|pet.buff.beast_cleave.down)
actions+=/kill_command
actions+=/multi_shot,if=spell_targets.multi_shot>1&(pet.buff.beast_cleave.remains<gcd.max*2|pet.buff.beast_cleave.down)
actions+=/chimaera_shot,if=focus<90
actions+=/cobra_shot,if=talent.killer_cobra.enabled&(cooldown.bestial_wrath.remains>=4&(buff.bestial_wrath.up&cooldown.kill_command.remains>=2)|focus>119)|!talent.killer_cobra.enabled&focus>90

head=mask_of_the_unseen_path,id=139710,bonus_id=3386/3383
neck=chain_of_the_underking,id=134495,bonus_id=1727/1502/3336
shoulders=burning_sky_pauldrons,id=137321,bonus_id=1727/43/1492/1813
back=shadowfeather_shawl,id=136977,bonus_id=1727/1497/3336,enchant=150agi
chest=hillstride_vest,id=121102,bonus_id=3396/1691/1617/1675
shirt=precious_ribbon,id=52019
tabard=stormwind_tabard,id=118365
wrists=crestrider_conduit_bracers,id=134484,bonus_id=1726/1808/1497/3337
hands=lavabreaker_gauntlets,id=137519,bonus_id=1727/1502/3336
waist=gravenscale_girdle,id=128906,bonus_id=689/1696/3408/600/669
legs=leggings_of_the_unseen_path,id=139711,bonus_id=3386/3383
feet=sea_stalkers_boots,id=134254,bonus_id=3432/1497/1674
finger1=braided_silver_ring,id=134539,bonus_id=1727/1492/1813,enchant=150mastery
finger2=roughhammered_silver_ring,id=134191,bonus_id=3397/40/1492/1675,enchant=150mastery
trinket1=horn_of_valor,id=133642,bonus_id=1826/1462/3339
trinket2=anshes_token_of_guile,id=139113,bonus_id=3397/604/1492/1675
main_hand=titanstrike,id=128861,gem_id=137365/137379/0/0,relic_id=1727:1492:1813/1726:1477/0/0

# Gear Summary
# gear_ilvl=835.73
# gear_agility=10462
# gear_stamina=16931
# gear_crit_rating=4215
# gear_haste_rating=4465
# gear_mastery_rating=6528
# gear_versatility_rating=2130
# gear_avoidance_rating=291
# gear_armor=2409
# set_bonus=tier19oh_2pc=1
summon_pet=cat

Rinotor

Rinotor : 144985 dps

  • Race: Worgen
  • Class: Hunter
  • Spec: Beast Mastery
  • Level: 110
  • Role: Attack
  • Position: ranged_back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
144984.9 144984.9 61.0 / 0.042% 12355.8 / 8.5% 3751.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
14.6 14.6 Focus 24.09% 39.0 100.0% 100%
Origin https://eu.api.battle.net/wow/character/hyjal/Rinotor/advanced
Talents
  • 15: Way of the Cobra (Beast Mastery Hunter)
  • 30: Chimaera Shot (Beast Mastery Hunter)
  • 45: Posthaste
  • 60: Blink Strikes (Beast Mastery Hunter)
  • 75: Intimidation (Beast Mastery Hunter)
  • 90: A Murder of Crows
  • 100: Killer Cobra (Beast Mastery Hunter)
  • Talent Calculator
Artifact
Professions
  • blacksmithing: 700
  • jewelcrafting: 700

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Rinotor 144985
A Murder of Crows 0 (14676) 0.0% (10.1%) 8.0 60.45sec 827607 620192

Stats details: a_murder_of_crows

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.97 0.00 125.21 0.00 1.3345 0.9363 0.00 0.00 0.00 51610.71 620191.71
 
 

Action details: a_murder_of_crows

Static Values
  • id:131894
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:131894
  • name:A Murder of Crows
  • school:physical
  • tooltip:Under attack by a flock of crows.
  • description:Summons a flock of crows to attack your target, dealing ${{$131900s1=1}*16} Physical damage over {$d=15 seconds}. When a target dies while affected by this ability, its cooldown will reset.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:15.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    A Murder of Crows (crow_peck) 14676 10.1% 0.0 0.00sec 0 0 Direct 125.2 41619 83592 52709 26.4%  

Stats details: crow_peck

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 125.21 0.00 0.00 0.0000 0.0000 6600080.21 9702743.08 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 92.13 73.58% 41618.92 38126 45752 41628.15 39942 43417 3834219 5636665 31.98
crit 33.09 26.42% 83591.87 76253 91503 83607.77 78693 89423 2765861 4066078 31.98
 
 

Action details: crow_peck

Static Values
  • id:131900
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:131900
  • name:A Murder of Crows
  • school:physical
  • tooltip:
  • description:Deals {$s1=1} physical damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.620000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
auto_shot 8010 5.5% 174.9 2.58sec 20614 8002 Direct 174.9 16347 32828 20613 25.9%  

Stats details: auto_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 174.90 174.90 0.00 0.00 2.5761 0.0000 3605375.80 5300243.94 31.98 8001.69 8001.69
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 129.63 74.11% 16347.09 15118 18141 16348.72 16061 16722 2119007 3115141 31.98
crit 45.28 25.89% 32827.99 30236 36283 32827.47 30613 34435 1486368 2185102 31.98
 
 

Action details: auto_shot

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Chimaera Shot 0 (4573) 0.0% (3.2%) 38.9 11.52sec 52970 40983

Stats details: chimaera_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.85 0.00 0.00 0.00 1.2925 0.0000 0.00 0.00 0.00 40983.28 40983.28
 
 

Action details: chimaera_shot

Static Values
  • id:53209
  • school:froststrike
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:focus<90
Spelldata
  • id:53209
  • name:Chimaera Shot
  • school:nature
  • tooltip:
  • description:A two-headed shot that hits your primary target and another nearby target, dealing $171457sw2 Nature damage to one and $171454sw2 Frost damage to the other. Generates {$204304s1=10} Focus for every target hit.
 
    Chimaera Shot (_frost) 2286 1.6% 0.0 0.00sec 0 0 Direct 19.4 42148 84519 53141 25.9%  

Stats details: chimaera_shot_frost

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 19.36 0.00 0.00 0.0000 0.0000 1028689.50 1028689.50 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.34 74.06% 42147.51 37894 45473 42163.73 38526 45473 604291 604291 0.00
crit 5.02 25.94% 84519.44 75788 90946 84031.02 0 90946 424399 424399 0.00
 
 

Action details: chimaera_shot_frost

Static Values
  • id:171454
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:171454
  • name:Chimaera Shot
  • school:frost
  • tooltip:
  • description:{$@spelldesc53209=A two-headed shot that hits your primary target and another nearby target, dealing $171457sw2 Nature damage to one and $171454sw2 Frost damage to the other. Generates {$204304s1=10} Focus for every target hit.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.80
 
    Chimaera Shot (_nature) 2287 1.6% 0.0 0.00sec 0 0 Direct 19.4 42148 84566 53018 25.6%  

Stats details: chimaera_shot_nature

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 19.41 0.00 0.00 0.0000 0.0000 1029326.95 1029326.95 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.44 74.38% 42148.07 37894 45473 42161.76 37894 45473 608609 608609 0.00
crit 4.97 25.62% 84566.43 75788 90946 84075.45 0 90946 420718 420718 0.00
 
 

Action details: chimaera_shot_nature

Static Values
  • id:171457
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:171457
  • name:Chimaera Shot
  • school:nature
  • tooltip:
  • description:{$@spelldesc53209=A two-headed shot that hits your primary target and another nearby target, dealing $171457sw2 Nature damage to one and $171454sw2 Frost damage to the other. Generates {$204304s1=10} Focus for every target hit.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.80
 
Cobra Shot 18897 13.0% 90.6 4.96sec 93933 72687 Direct 90.4 74270 149146 94138 26.5%  

Stats details: cobra_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 90.57 90.37 0.00 0.00 1.2923 0.0000 8507681.75 12507098.04 31.98 72686.65 72686.65
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 66.39 73.47% 74269.65 62130 95124 74283.06 71546 77994 4931097 7249180 31.98
crit 23.98 26.53% 149145.54 124261 190248 149186.07 138772 159397 3576585 5257918 31.98
 
 

Action details: cobra_shot

Static Values
  • id:193455
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.killer_cobra.enabled&(cooldown.bestial_wrath.remains>=4&(buff.bestial_wrath.up&cooldown.kill_command.remains>=2)|focus>119)|!talent.killer_cobra.enabled&focus>90
Spelldata
  • id:193455
  • name:Cobra Shot
  • school:physical
  • tooltip:
  • description:A quick shot causing $sw2 Physical damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.40
 
Dark Blast 4335 3.0% 8.3 50.28sec 236497 0 Direct 8.3 187476 376520 236488 25.9%  

Stats details: dark_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.25 8.25 0.00 0.00 0.0000 0.0000 1952168.33 1952168.33 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.11 74.07% 187475.84 173433 208120 187294.34 0 208120 1146302 1146302 0.00
crit 2.14 25.93% 376520.24 346867 416240 334464.43 0 416240 805866 805866 0.00
 
 

Action details: dark_blast

Static Values
  • id:215407
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215407
  • name:Dark Blast
  • school:shadow
  • tooltip:
  • description:{$@spelldesc215444=Your ranged attacks and spells have a chance to unleash a Dark Blast in the direction of your target, dealing {$s1=127515} Shadow damage to all enemies in the line.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:168644.39
  • base_dd_max:168644.39
 
Deadly Grace 4522 3.1% 23.0 3.79sec 87153 0 Direct 23.0 68272 137695 87150 27.2%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.00 23.00 0.00 0.00 0.0000 0.0000 2004641.21 2004641.21 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.75 72.80% 68272.19 61154 73385 68241.41 63378 72365 1143262 1143262 0.00
crit 6.26 27.20% 137694.94 122308 146769 137567.26 0 146769 861379 861379 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:5.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=47572 to 71358} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:47572.00
  • base_dd_max:71358.00
 
Dire Beast 0 (13383) 0.0% (9.2%) 46.3 9.80sec 130078 114860

Stats details: dire_beast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.30 0.00 0.00 0.00 1.1325 0.0000 0.00 0.00 0.00 114860.46 114860.46
 
 

Action details: dire_beast

Static Values
  • id:120679
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown.bestial_wrath.remains>2
Spelldata
  • id:120679
  • name:Dire Beast
  • school:nature
  • tooltip:
  • description:Summons a powerful wild beast to attack your target for {$d=8 seconds}. |cFFFFFFFFGenerates ${$120694m1*4} Focus over its duration.|r
 
    dire_beast_melee (dire_beast) 17365 9.2% 235.1 1.91sec 25615 14894 Direct 235.1 20332 40665 25614 26.0%  

Stats details: dire_beast_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 235.11 235.11 0.00 0.00 1.7198 0.0000 6022363.55 8853444.87 31.98 14893.94 14893.94
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 174.03 74.02% 20332.37 20332 20332 20332.37 20332 20332 3538508 5201942 31.98
crit 61.08 25.98% 40664.74 40665 40665 40664.74 40665 40665 2483856 3651503 31.98
 
 

Action details: dire_beast_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
Kill Command 0 (36534) 0.0% (25.2%) 91.0 4.95sec 180720 160910

Stats details: kill_command

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 90.95 0.00 0.00 0.00 1.1231 0.0000 0.00 0.00 0.00 160910.38 160910.38
 
 

Action details: kill_command

Static Values
  • id:34026
  • school:physical
  • resource:focus
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:7.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:34026
  • name:Kill Command
  • school:physical
  • tooltip:
  • description:Give the command to kill, causing your pet to savagely deal $<damage> Physical damage to its target. 25 yard range.
 
    Kill Command (cat) 34793 24.0% 91.0 4.95sec 172114 0 Direct 91.0 124204 250245 172116 38.0%  

Stats details: kill_command

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 90.95 90.95 0.00 0.00 0.0000 0.0000 15654371.54 23013408.99 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 56.38 61.99% 124204.34 111198 133438 124211.73 119791 127760 7002779 10294748 31.98
crit 34.57 38.01% 250244.52 222396 266876 250276.61 237686 261136 8651593 12718661 31.98
 
 

Action details: kill_command

Static Values
  • id:83381
  • school:physical
  • resource:none
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:83381
  • name:Kill Command
  • school:physical
  • tooltip:
  • description:{$@spelldesc34026=Give the command to kill, causing your pet to savagely deal $<damage> Physical damage to its target. 25 yard range.}
 
    Jaws of Thunder (cat) 1741 1.2% 9.1 45.51sec 85906 0 Direct 9.1 85908 0 85908 0.0%  

Stats details: jaws_of_thunder

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.11 9.11 0.00 0.00 0.0000 0.0000 782784.73 782784.73 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.11 100.00% 85908.04 55599 133438 85857.69 0 133438 782785 782785 0.00
 
 

Action details: jaws_of_thunder

Static Values
  • id:197162
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:197162
  • name:Jaws of Thunder
  • school:physical
  • tooltip:
  • description:Kill Command has a {$s1=10}% chance to deal an additional {$197163s2=50}% of its damage as Nature damage.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:66718.93
  • base_dd_max:66718.93
 
pet - cat 65301 / 65301
Claw 17363 12.0% 150.6 3.00sec 51895 51663 Direct 150.6 37625 76402 51895 36.8%  

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 150.65 150.65 0.00 0.00 1.0045 0.0000 7817902.53 11493057.25 31.98 51662.99 51662.99
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 95.21 63.20% 37624.73 19416 46597 37632.50 35428 40300 3582115 5266049 31.98
crit 55.44 36.80% 76401.55 38831 93195 76422.99 69472 84504 4235787 6227008 31.98
 
 

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:3.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, causing ${$<damage>} damage. Deals {$62762s2=100}% more damage and costs {$62762s1=100}% more Focus when your pet has 50 or more Focus.
 
melee 11404 7.9% 286.1 1.57sec 17943 11419 Direct 286.1 13072 26306 17943 36.8%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 286.14 286.14 0.00 0.00 1.5713 0.0000 5134203.60 7547765.62 31.98 11419.11 11419.11
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 180.83 63.19% 13071.76 12103 14524 13072.79 12828 13338 2363757 3474946 31.98
crit 105.32 36.81% 26306.19 24206 29048 26309.02 25649 27135 2770447 4072820 31.98
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - hati 11288 / 11288
hati_melee 11288 7.8% 260.1 1.73sec 19537 11304 Direct 261.1 15463 30927 19462 25.9%  

Stats details: hati_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 260.11 261.11 0.00 0.00 1.7283 0.0000 5081826.49 7470766.31 31.98 11304.33 11304.33
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 193.59 74.14% 15463.41 15200 15464 15463.39 15463 15464 2993526 4400767 31.98
crit 67.52 25.86% 30926.94 30400 30929 30926.92 30915 30929 2088300 3069999 31.98
 
 

Action details: hati_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
Simple Action Stats Execute Interval
Rinotor
Aspect of the Wild 4.0 127.70sec

Stats details: aspect_of_the_wild

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.02 0.00 50.47 0.00 0.0000 0.7843 0.00 0.00 0.00 0.00 0.00
 
 

Action details: aspect_of_the_wild

Static Values
  • id:193530
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.bestial_wrath.up
Spelldata
  • id:193530
  • name:Aspect of the Wild
  • school:physical
  • tooltip:Critical Strike chance for you and your pet increased by {$s1=10}%.
  • description:Grants you and your pet {$s2=10} Focus per $t2 sec and {$s1=10}% increased critical strike chance on all attacks for {$d=10 seconds}.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rinotor
  • harmful:false
  • if_expr:
 
Bestial Wrath 12.4 37.76sec

Stats details: bestial_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.37 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: bestial_wrath

Static Values
  • id:19574
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:19574
  • name:Bestial Wrath
  • school:physical
  • tooltip:Damage dealt increased by {$s1=20}%.
  • description:Sends you and your pet into a rage, increasing all damage you both deal by {$s1=20}% for {$d=10 seconds}. Bestial Wrath's remaining cooldown is reduced by {$s3=15} sec each time you use {$?s217200=false}[Dire Frenzy][Dire Beast].
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rinotor
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rinotor
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
summon_pet 1.0 0.00sec

Stats details: summon_pet

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_pet

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Aspect of the Wild 4.0 0.0 127.7sec 127.7sec 8.80% 5.36% 39.6(39.6) 3.9

Buff details

  • buff initial source:Rinotor
  • cooldown name:buff_aspect_of_the_wild
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • aspect_of_the_wild_1:8.80%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193530
  • name:Aspect of the Wild
  • tooltip:Critical Strike chance for you and your pet increased by {$s1=10}%.
  • description:Grants you and your pet {$s2=10} Focus per $t2 sec and {$s1=10}% increased critical strike chance on all attacks for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Bestial Wrath 12.4 0.0 37.8sec 37.8sec 40.60% 50.19% 0.0(0.0) 12.0

Buff details

  • buff initial source:Rinotor
  • cooldown name:buff_bestial_wrath
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • bestial_wrath_1:40.60%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:19574
  • name:Bestial Wrath
  • tooltip:Damage dealt increased by {$s1=20}%.
  • description:Sends you and your pet into a rage, increasing all damage you both deal by {$s1=20}% for {$d=10 seconds}. Bestial Wrath's remaining cooldown is reduced by {$s3=15} sec each time you use {$?s217200=false}[Dire Frenzy][Dire Beast].
  • max_stacks:0
  • duration:10.00
  • cooldown:90.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 9.78% 0.0(0.0) 1.0

Buff details

  • buff initial source:Rinotor
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Dire Beast 46.3 0.0 10.5sec 9.8sec 76.40% 70.46% 0.0(0.0) 39.0

Buff details

  • buff initial source:Rinotor
  • cooldown name:buff_dire_beast
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.50

Stack Uptimes

  • dire_beast_1:71.39%
  • dire_beast_2:4.87%
  • dire_beast_3:0.14%
  • dire_beast_4:0.00%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:120694
  • name:Dire Beast
  • tooltip:Your Dire Beast is granting you {$s1=3} Focus every $t1 sec.
  • description:{$@spelldesc120679=Summons a powerful wild beast to attack your target for {$d=8 seconds}. |cFFFFFFFFGenerates ${$120694m1*4} Focus over its duration.|r}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deadly Grace 2.0 0.0 58.2sec 0.0sec 10.83% 10.89% 0.0(0.0) 2.0

Buff details

  • buff initial source:Rinotor
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:10.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
cat: Aspect of the Wild 4.0 0.0 127.7sec 127.7sec 8.80% 9.82% 39.6(39.6) 3.9

Buff details

  • buff initial source:Rinotor_cat
  • cooldown name:buff_aspect_of_the_wild
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • aspect_of_the_wild_1:8.80%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193530
  • name:Aspect of the Wild
  • tooltip:Critical Strike chance for you and your pet increased by {$s1=10}%.
  • description:Grants you and your pet {$s2=10} Focus per $t2 sec and {$s1=10}% increased critical strike chance on all attacks for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
cat: Bestial Wrath 12.4 0.0 37.8sec 37.8sec 40.60% 43.00% 0.0(0.0) 12.0

Buff details

  • buff initial source:Rinotor_cat
  • cooldown name:buff_bestial_wrath
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • bestial_wrath_1:40.60%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:19574
  • name:Bestial Wrath
  • tooltip:Damage dealt increased by {$s1=20}%.
  • description:Sends you and your pet into a rage, increasing all damage you both deal by {$s1=20}% for {$d=10 seconds}. Bestial Wrath's remaining cooldown is reduced by {$s3=15} sec each time you use {$?s217200=false}[Dire Frenzy][Dire Beast].
  • max_stacks:0
  • duration:10.00
  • cooldown:90.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Rinotor
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Rinotor
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (nightborne_delicacy_platter)

Buff details

  • buff initial source:Rinotor
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:375.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Rinotor
a_murder_of_crows Focus 8.0 239.2 30.0 30.0 27586.8
cobra_shot Focus 90.6 3622.9 40.0 40.0 2348.3
kill_command Focus 91.0 2728.6 30.0 30.0 6024.0
pet - cat
claw Focus 150.6 6788.9 45.1 45.1 1151.6
Resource Gains Type Count Total Average Overflow
dire_beast Focus 1227.32 533.41 (8.18%) 0.43 0.75 0.14%
aspect_of_the_wild Focus 91.18 393.82 (6.04%) 4.32 2.49 0.63%
chimaera_shot_frost Focus 19.40 194.00 (2.97%) 10.00 0.00 0.00%
chimaera_shot_nature Focus 19.45 194.52 (2.98%) 10.00 0.00 0.00%
focus_regen Focus 1705.76 5208.31 (79.83%) 3.05 2.15 0.04%
pet - cat
focus_regen Focus 832.69 6383.09 (95.14%) 7.67 127.67 1.96%
aspect_of_the_wild Focus 81.73 325.96 (4.86%) 3.99 70.35 17.75%
Resource RPS-Gain RPS-Loss
Focus 14.48 14.63
Combat End Resource Mean Min Max
Focus 72.55 0.12 129.39

Benefits & Uptimes

Benefits %
cat-wild_hunt 80.3%
Uptimes %
Focus Cap 0.0%
cat-Focus Cap 1.0%

Procs

Count Interval
starved: a_murder_of_crows 3.1 13.2sec
wild_call 9.0 45.1sec

Statistics & Data Analysis

Fight Length
Sample Data Rinotor Fight Length
Count 9999
Mean 450.42
Minimum 350.15
Maximum 555.44
Spread ( max - min ) 205.29
Range [ ( max - min ) / 2 * 100% ] 22.79%
DPS
Sample Data Rinotor Damage Per Second
Count 9999
Mean 144984.89
Minimum 134278.67
Maximum 156929.50
Spread ( max - min ) 22650.83
Range [ ( max - min ) / 2 * 100% ] 7.81%
Standard Deviation 3112.8865
5th Percentile 140111.37
95th Percentile 150294.63
( 95th Percentile - 5th Percentile ) 10183.26
Mean Distribution
Standard Deviation 31.1304
95.00% Confidence Intervall ( 144923.88 - 145045.91 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 17
0.1% Error 1770
0.1 Scale Factor Error with Delta=300 82719
0.05 Scale Factor Error with Delta=300 330879
0.01 Scale Factor Error with Delta=300 8271994
Priority Target DPS
Sample Data Rinotor Priority Target Damage Per Second
Count 9999
Mean 144984.89
Minimum 134278.67
Maximum 156929.50
Spread ( max - min ) 22650.83
Range [ ( max - min ) / 2 * 100% ] 7.81%
Standard Deviation 3112.8865
5th Percentile 140111.37
95th Percentile 150294.63
( 95th Percentile - 5th Percentile ) 10183.26
Mean Distribution
Standard Deviation 31.1304
95.00% Confidence Intervall ( 144923.88 - 145045.91 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 17
0.1% Error 1770
0.1 Scale Factor Error with Delta=300 82719
0.05 Scale Factor Error with Delta=300 330879
0.01 Scale Factor Error with Delta=300 8271994
DPS(e)
Sample Data Rinotor Damage Per Second (Effective)
Count 9999
Mean 144984.89
Minimum 134278.67
Maximum 156929.50
Spread ( max - min ) 22650.83
Range [ ( max - min ) / 2 * 100% ] 7.81%
Damage
Sample Data Rinotor Damage
Count 9999
Mean 24727963.74
Minimum 18250031.63
Maximum 31885057.72
Spread ( max - min ) 13635026.09
Range [ ( max - min ) / 2 * 100% ] 27.57%
DTPS
Sample Data Rinotor Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Rinotor Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Rinotor Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Rinotor Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Rinotor Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Rinotor Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data RinotorTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Rinotor Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=nightborne_delicacy_platter
2 0.00 summon_pet
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=deadly_grace
5 0.00 augmentation,type=defiled
Default action list Executed every time the actor is available.
# count action,conditions
6 1.00 auto_shot
0.00 arcane_torrent,if=focus.deficit>=30
0.00 blood_fury
0.00 berserking
7 1.00 potion,name=deadly_grace
8 7.98 a_murder_of_crows
0.00 stampede,if=buff.bloodlust.up|buff.bestial_wrath.up|cooldown.bestial_wrath.remains<=2|target.time_to_die<=14
9 46.31 dire_beast,if=cooldown.bestial_wrath.remains>2
0.00 dire_frenzy,if=cooldown.bestial_wrath.remains>2
A 4.02 aspect_of_the_wild,if=buff.bestial_wrath.up
0.00 barrage,if=spell_targets.barrage>1|(spell_targets.barrage=1&focus>90)
0.00 titans_thunder,if=cooldown.dire_beast.remains>=3|buff.bestial_wrath.up&pet.dire_beast.active
B 12.37 bestial_wrath
0.00 multi_shot,if=spell_targets.multi_shot>4&(pet.buff.beast_cleave.remains<gcd.max|pet.buff.beast_cleave.down)
C 90.96 kill_command
0.00 multi_shot,if=spell_targets.multi_shot>1&(pet.buff.beast_cleave.remains<gcd.max*2|pet.buff.beast_cleave.down)
D 38.86 chimaera_shot,if=focus<90
E 90.57 cobra_shot,if=talent.killer_cobra.enabled&(cooldown.bestial_wrath.remains>=4&(buff.bestial_wrath.up&cooldown.kill_command.remains>=2)|focus>119)|!talent.killer_cobra.enabled&focus>90

Sample Sequence

0124568B9ACECECDECE9CECDEC9DCEE9CEBCEC9DECECDE9CDE9CE78CD9BECECEDC9ECDC9ECE9CEECD9BECECEDC9E8DC9CEC9EECDE9BACECECDEC9ECECD9CEEC8D9EC9BECDECEC9DECD9CEECD9ECEE9B9CECDEC8E9CDC9ECE9BCECDEACEC9ECDEEC99ECEEC9BE8CDECE9CDECD99CEECD9BECE9CDECECD9CEC98DECE9BCECDECE9CDECD9CE9CEEC9BAECECDECE89CDEC9EECDE9C

Sample Sequence Table

time name target resources buffs
Pre flask Rinotor 140.0/140: 100% focus
Pre food Rinotor 140.0/140: 100% focus
Pre summon_pet Fluffy_Pillow 140.0/140: 100% focus
Pre potion Fluffy_Pillow 140.0/140: 100% focus potion_of_deadly_grace
Pre augmentation Rinotor 140.0/140: 100% focus potion_of_deadly_grace
0:00.000 start_auto_shot Fluffy_Pillow 140.0/140: 100% focus potion_of_deadly_grace
0:00.000 a_murder_of_crows Fluffy_Pillow 140.0/140: 100% focus potion_of_deadly_grace
0:01.335 bestial_wrath Fluffy_Pillow 129.2/140: 92% focus bloodlust, potion_of_deadly_grace
0:01.335 dire_beast Fluffy_Pillow 129.2/140: 92% focus bloodlust, bestial_wrath, potion_of_deadly_grace
0:02.090 aspect_of_the_wild Fluffy_Pillow 140.0/140: 100% focus bloodlust, bestial_wrath, dire_beast, potion_of_deadly_grace
0:02.090 kill_command Fluffy_Pillow 140.0/140: 100% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, potion_of_deadly_grace
0:02.844 cobra_shot Fluffy_Pillow 129.7/140: 93% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, potion_of_deadly_grace
0:03.872 kill_command Fluffy_Pillow 116.6/140: 83% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, potion_of_deadly_grace
0:04.627 cobra_shot Fluffy_Pillow 106.3/140: 76% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, potion_of_deadly_grace
0:05.655 kill_command Fluffy_Pillow 93.2/140: 67% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, potion_of_deadly_grace
0:06.408 chimaera_shot Fluffy_Pillow 82.9/140: 59% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, potion_of_deadly_grace
0:07.437 cobra_shot Fluffy_Pillow 119.8/140: 86% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, potion_of_deadly_grace
0:08.462 kill_command Fluffy_Pillow 106.6/140: 76% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, potion_of_deadly_grace
0:09.216 cobra_shot Fluffy_Pillow 96.4/140: 69% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, potion_of_deadly_grace
0:10.243 dire_beast Fluffy_Pillow 81.7/140: 58% focus bloodlust, aspect_of_the_wild, bestial_wrath, potion_of_deadly_grace
0:10.998 kill_command Fluffy_Pillow 101.4/140: 72% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, potion_of_deadly_grace
0:11.752 cobra_shot Fluffy_Pillow 91.1/140: 65% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, potion_of_deadly_grace
0:12.779 kill_command Fluffy_Pillow 71.1/140: 51% focus bloodlust, bestial_wrath, dire_beast, potion_of_deadly_grace
0:13.532 chimaera_shot Fluffy_Pillow 53.3/140: 38% focus bloodlust, bestial_wrath, dire_beast, potion_of_deadly_grace
0:14.559 cobra_shot Fluffy_Pillow 79.9/140: 57% focus bloodlust, bestial_wrath, dire_beast, potion_of_deadly_grace
0:15.587 kill_command Fluffy_Pillow 56.5/140: 40% focus bloodlust, bestial_wrath, dire_beast, potion_of_deadly_grace
0:16.341 Waiting 1.900 sec 38.6/140: 28% focus bloodlust, dire_beast, potion_of_deadly_grace
0:18.241 dire_beast Fluffy_Pillow 69.3/140: 50% focus bloodlust, dire_beast, potion_of_deadly_grace
0:19.186 Waiting 0.300 sec 84.3/140: 60% focus bloodlust, dire_beast, potion_of_deadly_grace
0:19.486 chimaera_shot Fluffy_Pillow 89.2/140: 64% focus bloodlust, dire_beast, potion_of_deadly_grace
0:20.702 kill_command Fluffy_Pillow 118.8/140: 85% focus bloodlust, dire_beast, potion_of_deadly_grace
0:21.460 Waiting 1.200 sec 101.0/140: 72% focus bloodlust, dire_beast, potion_of_deadly_grace
0:22.660 cobra_shot Fluffy_Pillow 120.4/140: 86% focus bloodlust, dire_beast, potion_of_deadly_grace
0:23.686 Waiting 1.400 sec 97.0/140: 69% focus bloodlust, dire_beast
0:25.086 cobra_shot Fluffy_Pillow 119.6/140: 85% focus bloodlust, dire_beast
0:26.113 dire_beast Fluffy_Pillow 96.2/140: 69% focus bloodlust, dire_beast
0:26.867 kill_command Fluffy_Pillow 108.4/140: 77% focus bloodlust, dire_beast
0:27.621 Waiting 1.800 sec 90.6/140: 65% focus bloodlust, dire_beast
0:29.421 cobra_shot Fluffy_Pillow 119.6/140: 85% focus bloodlust, dire_beast
0:30.450 Waiting 0.700 sec 96.3/140: 69% focus bloodlust, dire_beast
0:31.150 bestial_wrath Fluffy_Pillow 107.6/140: 77% focus bloodlust, dire_beast
0:31.335 Waiting 0.400 sec 110.5/140: 79% focus bloodlust, bestial_wrath, dire_beast
0:31.735 kill_command Fluffy_Pillow 117.0/140: 84% focus bloodlust, bestial_wrath, dire_beast
0:32.740 cobra_shot Fluffy_Pillow 103.2/140: 74% focus bloodlust, bestial_wrath, dire_beast
0:33.768 kill_command Fluffy_Pillow 79.8/140: 57% focus bloodlust, bestial_wrath, dire_beast
0:34.523 dire_beast Fluffy_Pillow 60.9/140: 44% focus bloodlust, bestial_wrath
0:35.278 chimaera_shot Fluffy_Pillow 73.1/140: 52% focus bloodlust, bestial_wrath, dire_beast
0:36.305 cobra_shot Fluffy_Pillow 99.7/140: 71% focus bloodlust, bestial_wrath, dire_beast
0:37.334 kill_command Fluffy_Pillow 76.3/140: 55% focus bloodlust, bestial_wrath, dire_beast
0:38.089 cobra_shot Fluffy_Pillow 58.5/140: 42% focus bloodlust, bestial_wrath, dire_beast
0:39.118 kill_command Fluffy_Pillow 35.1/140: 25% focus bloodlust, bestial_wrath, dire_beast
0:39.874 Waiting 1.500 sec 17.3/140: 12% focus bloodlust, bestial_wrath, dire_beast
0:41.374 chimaera_shot Fluffy_Pillow 40.2/140: 29% focus bestial_wrath, dire_beast
0:42.880 cobra_shot Fluffy_Pillow 68.5/140: 49% focus bestial_wrath
0:44.216 dire_beast Fluffy_Pillow 43.5/140: 31% focus bestial_wrath
0:45.401 kill_command Fluffy_Pillow 58.7/140: 42% focus bestial_wrath, dire_beast
0:46.585 Waiting 2.700 sec 43.8/140: 31% focus dire_beast
0:49.285 chimaera_shot Fluffy_Pillow 78.3/140: 56% focus dire_beast
0:50.864 Waiting 0.900 sec 108.4/140: 77% focus dire_beast
0:51.764 cobra_shot Fluffy_Pillow 119.9/140: 86% focus dire_beast
0:53.096 dire_beast Fluffy_Pillow 94.9/140: 68% focus
0:54.282 kill_command Fluffy_Pillow 110.1/140: 79% focus dire_beast
0:55.467 Waiting 1.900 sec 95.2/140: 68% focus dire_beast
0:57.367 cobra_shot Fluffy_Pillow 119.5/140: 85% focus dire_beast
0:58.702 potion Fluffy_Pillow 96.5/140: 69% focus dire_beast
0:58.702 Waiting 1.100 sec 96.5/140: 69% focus dire_beast, potion_of_deadly_grace
0:59.802 a_murder_of_crows Fluffy_Pillow 110.6/140: 79% focus dire_beast, potion_of_deadly_grace
1:01.335 kill_command Fluffy_Pillow 99.6/140: 71% focus potion_of_deadly_grace
1:02.520 chimaera_shot Fluffy_Pillow 83.0/140: 59% focus potion_of_deadly_grace
1:03.855 dire_beast Fluffy_Pillow 108.1/140: 77% focus potion_of_deadly_grace
1:05.040 bestial_wrath Fluffy_Pillow 123.2/140: 88% focus dire_beast, potion_of_deadly_grace
1:05.040 cobra_shot Fluffy_Pillow 123.2/140: 88% focus bestial_wrath, dire_beast, potion_of_deadly_grace
1:06.375 kill_command Fluffy_Pillow 100.2/140: 72% focus bestial_wrath, dire_beast, potion_of_deadly_grace
1:07.559 cobra_shot Fluffy_Pillow 85.4/140: 61% focus bestial_wrath, dire_beast, potion_of_deadly_grace
1:08.894 kill_command Fluffy_Pillow 62.4/140: 45% focus bestial_wrath, dire_beast, potion_of_deadly_grace
1:10.080 cobra_shot Fluffy_Pillow 47.6/140: 34% focus bestial_wrath, dire_beast, potion_of_deadly_grace
1:11.413 chimaera_shot Fluffy_Pillow 24.6/140: 18% focus bestial_wrath, dire_beast, potion_of_deadly_grace
1:12.748 kill_command Fluffy_Pillow 49.7/140: 36% focus bestial_wrath, potion_of_deadly_grace
1:13.932 Waiting 0.400 sec 33.1/140: 24% focus bestial_wrath, potion_of_deadly_grace
1:14.332 dire_beast Fluffy_Pillow 37.6/140: 27% focus bestial_wrath, potion_of_deadly_grace
1:15.685 cobra_shot Fluffy_Pillow 54.6/140: 39% focus bestial_wrath, dire_beast, potion_of_deadly_grace
1:17.019 kill_command Fluffy_Pillow 31.7/140: 23% focus bestial_wrath, dire_beast, potion_of_deadly_grace
1:18.203 Waiting 1.000 sec 16.8/140: 12% focus bestial_wrath, dire_beast, potion_of_deadly_grace
1:19.203 chimaera_shot Fluffy_Pillow 29.5/140: 21% focus bestial_wrath, dire_beast, potion_of_deadly_grace
1:20.734 Waiting 2.700 sec 59.1/140: 42% focus dire_beast, potion_of_deadly_grace
1:23.434 kill_command Fluffy_Pillow 92.1/140: 66% focus potion_of_deadly_grace
1:24.858 Waiting 0.100 sec 78.1/140: 56% focus
1:24.958 dire_beast Fluffy_Pillow 79.3/140: 57% focus
1:26.333 Waiting 1.800 sec 96.5/140: 69% focus dire_beast
1:28.133 cobra_shot Fluffy_Pillow 119.5/140: 85% focus dire_beast
1:29.466 Waiting 0.700 sec 96.5/140: 69% focus dire_beast
1:30.166 kill_command Fluffy_Pillow 105.5/140: 75% focus dire_beast
1:31.511 Waiting 2.200 sec 92.7/140: 66% focus dire_beast
1:33.711 cobra_shot Fluffy_Pillow 119.9/140: 86% focus
1:35.046 Waiting 0.500 sec 94.9/140: 68% focus
1:35.546 dire_beast Fluffy_Pillow 100.5/140: 72% focus
1:36.977 kill_command Fluffy_Pillow 118.4/140: 85% focus dire_beast
1:38.168 Waiting 1.300 sec 103.7/140: 74% focus dire_beast
1:39.468 cobra_shot Fluffy_Pillow 120.3/140: 86% focus dire_beast
1:40.801 Waiting 1.800 sec 97.3/140: 69% focus dire_beast
1:42.601 cobra_shot Fluffy_Pillow 120.3/140: 86% focus dire_beast
1:43.936 kill_command Fluffy_Pillow 96.6/140: 69% focus
1:45.120 chimaera_shot Fluffy_Pillow 79.9/140: 57% focus
1:46.457 dire_beast Fluffy_Pillow 105.0/140: 75% focus
1:47.641 bestial_wrath Fluffy_Pillow 120.1/140: 86% focus dire_beast
1:47.641 cobra_shot Fluffy_Pillow 120.1/140: 86% focus bestial_wrath, dire_beast
1:48.977 kill_command Fluffy_Pillow 97.1/140: 69% focus bestial_wrath, dire_beast
1:50.161 cobra_shot Fluffy_Pillow 82.3/140: 59% focus bestial_wrath, dire_beast
1:51.494 kill_command Fluffy_Pillow 59.3/140: 42% focus bestial_wrath, dire_beast
1:52.676 cobra_shot Fluffy_Pillow 44.4/140: 32% focus bestial_wrath, dire_beast
1:54.012 chimaera_shot Fluffy_Pillow 21.5/140: 15% focus bestial_wrath, dire_beast
1:55.346 kill_command Fluffy_Pillow 46.6/140: 33% focus bestial_wrath
1:56.528 Waiting 0.400 sec 29.9/140: 21% focus bestial_wrath
1:56.928 dire_beast Fluffy_Pillow 34.4/140: 25% focus bestial_wrath
1:58.287 cobra_shot Fluffy_Pillow 51.5/140: 37% focus bestial_wrath, dire_beast
1:59.621 Waiting 0.200 sec 28.5/140: 20% focus bestial_wrath, dire_beast
1:59.821 a_murder_of_crows Fluffy_Pillow 31.1/140: 22% focus bestial_wrath, dire_beast
2:01.334 Waiting 0.500 sec 20.4/140: 15% focus bestial_wrath, dire_beast
2:01.834 chimaera_shot Fluffy_Pillow 26.8/140: 19% focus bestial_wrath, dire_beast
2:03.331 kill_command Fluffy_Pillow 55.9/140: 40% focus dire_beast
2:04.515 Waiting 3.000 sec 41.0/140: 29% focus dire_beast
2:07.515 dire_beast Fluffy_Pillow 75.7/140: 54% focus
2:08.933 Waiting 0.900 sec 93.5/140: 67% focus dire_beast
2:09.833 kill_command Fluffy_Pillow 105.0/140: 75% focus dire_beast
2:11.169 Waiting 2.200 sec 92.1/140: 66% focus dire_beast
2:13.369 cobra_shot Fluffy_Pillow 120.2/140: 86% focus dire_beast
2:14.704 Waiting 1.700 sec 97.2/140: 69% focus dire_beast
2:16.404 kill_command Fluffy_Pillow 117.9/140: 84% focus
2:17.824 Waiting 0.400 sec 103.9/140: 74% focus
2:18.224 dire_beast Fluffy_Pillow 108.4/140: 77% focus
2:19.579 cobra_shot Fluffy_Pillow 125.4/140: 90% focus dire_beast
2:20.914 Waiting 1.300 sec 102.5/140: 73% focus dire_beast
2:22.214 cobra_shot Fluffy_Pillow 119.1/140: 85% focus dire_beast
2:23.548 kill_command Fluffy_Pillow 96.1/140: 69% focus dire_beast
2:24.735 chimaera_shot Fluffy_Pillow 81.3/140: 58% focus dire_beast
2:26.068 Waiting 1.000 sec 108.3/140: 77% focus dire_beast
2:27.068 cobra_shot Fluffy_Pillow 120.0/140: 86% focus
2:28.401 Waiting 0.400 sec 95.0/140: 68% focus
2:28.801 dire_beast Fluffy_Pillow 99.6/140: 71% focus
2:30.224 bestial_wrath Fluffy_Pillow 117.4/140: 84% focus dire_beast
2:30.224 aspect_of_the_wild Fluffy_Pillow 117.4/140: 84% focus bestial_wrath, dire_beast
2:30.224 kill_command Fluffy_Pillow 117.4/140: 84% focus aspect_of_the_wild, bestial_wrath, dire_beast
2:31.409 cobra_shot Fluffy_Pillow 114.4/140: 82% focus aspect_of_the_wild, bestial_wrath, dire_beast
2:32.745 kill_command Fluffy_Pillow 104.8/140: 75% focus aspect_of_the_wild, bestial_wrath, dire_beast
2:33.928 cobra_shot Fluffy_Pillow 101.7/140: 73% focus aspect_of_the_wild, bestial_wrath, dire_beast
2:35.263 kill_command Fluffy_Pillow 92.1/140: 66% focus aspect_of_the_wild, bestial_wrath, dire_beast
2:36.449 chimaera_shot Fluffy_Pillow 89.1/140: 64% focus aspect_of_the_wild, bestial_wrath, dire_beast
2:37.782 cobra_shot Fluffy_Pillow 127.8/140: 91% focus aspect_of_the_wild, bestial_wrath
2:39.116 kill_command Fluffy_Pillow 116.1/140: 83% focus aspect_of_the_wild, bestial_wrath
2:40.301 dire_beast Fluffy_Pillow 110.6/140: 79% focus bestial_wrath
2:41.488 cobra_shot Fluffy_Pillow 125.7/140: 90% focus bestial_wrath, dire_beast
2:42.822 kill_command Fluffy_Pillow 102.8/140: 73% focus bestial_wrath, dire_beast
2:44.007 cobra_shot Fluffy_Pillow 87.9/140: 63% focus bestial_wrath, dire_beast
2:45.340 kill_command Fluffy_Pillow 64.9/140: 46% focus dire_beast
2:46.526 chimaera_shot Fluffy_Pillow 50.1/140: 36% focus dire_beast
2:47.860 Waiting 2.900 sec 77.1/140: 55% focus dire_beast
2:50.760 dire_beast Fluffy_Pillow 110.4/140: 79% focus
2:52.132 kill_command Fluffy_Pillow 127.6/140: 91% focus dire_beast
2:53.317 Waiting 0.500 sec 112.8/140: 81% focus dire_beast
2:53.817 cobra_shot Fluffy_Pillow 119.2/140: 85% focus dire_beast
2:55.152 Waiting 1.800 sec 96.2/140: 69% focus dire_beast
2:56.952 cobra_shot Fluffy_Pillow 119.2/140: 85% focus dire_beast
2:58.286 Waiting 0.300 sec 96.2/140: 69% focus dire_beast
2:58.586 kill_command Fluffy_Pillow 100.1/140: 71% focus dire_beast
2:59.969 a_murder_of_crows Fluffy_Pillow 86.0/140: 61% focus
3:01.335 chimaera_shot Fluffy_Pillow 71.3/140: 51% focus
3:02.669 dire_beast Fluffy_Pillow 96.4/140: 69% focus
3:03.853 Waiting 0.600 sec 111.5/140: 80% focus dire_beast
3:04.453 cobra_shot Fluffy_Pillow 119.2/140: 85% focus dire_beast
3:05.787 kill_command Fluffy_Pillow 96.2/140: 69% focus dire_beast
3:06.971 dire_beast Fluffy_Pillow 81.3/140: 58% focus dire_beast
3:08.156 bestial_wrath Fluffy_Pillow 98.2/140: 70% focus dire_beast(2)
3:08.156 cobra_shot Fluffy_Pillow 98.2/140: 70% focus bestial_wrath, dire_beast(2)
3:09.490 kill_command Fluffy_Pillow 77.3/140: 55% focus bestial_wrath, dire_beast(2)
3:10.672 chimaera_shot Fluffy_Pillow 64.1/140: 46% focus bestial_wrath, dire_beast(2)
3:12.007 cobra_shot Fluffy_Pillow 91.2/140: 65% focus bestial_wrath, dire_beast
3:13.340 kill_command Fluffy_Pillow 68.2/140: 49% focus bestial_wrath, dire_beast
3:14.525 cobra_shot Fluffy_Pillow 53.3/140: 38% focus bestial_wrath, dire_beast
3:15.859 Waiting 0.200 sec 28.4/140: 20% focus bestial_wrath
3:16.059 kill_command Fluffy_Pillow 30.6/140: 22% focus bestial_wrath
3:17.244 Waiting 0.200 sec 14.0/140: 10% focus bestial_wrath
3:17.444 dire_beast Fluffy_Pillow 16.2/140: 12% focus bestial_wrath
3:18.802 chimaera_shot Fluffy_Pillow 33.3/140: 24% focus bestial_wrath, dire_beast
3:20.137 cobra_shot Fluffy_Pillow 60.4/140: 43% focus bestial_wrath, dire_beast
3:21.471 kill_command Fluffy_Pillow 37.4/140: 27% focus bestial_wrath, dire_beast
3:22.655 Waiting 3.900 sec 22.5/140: 16% focus bestial_wrath, dire_beast
3:26.555 chimaera_shot Fluffy_Pillow 70.8/140: 51% focus
3:28.123 dire_beast Fluffy_Pillow 98.5/140: 70% focus
3:29.447 kill_command Fluffy_Pillow 115.2/140: 82% focus dire_beast
3:30.632 Waiting 1.500 sec 100.4/140: 72% focus dire_beast
3:32.132 cobra_shot Fluffy_Pillow 119.5/140: 85% focus dire_beast
3:33.466 Waiting 1.800 sec 96.5/140: 69% focus dire_beast
3:35.266 cobra_shot Fluffy_Pillow 119.5/140: 85% focus dire_beast
3:36.602 kill_command Fluffy_Pillow 94.6/140: 68% focus
3:37.786 chimaera_shot Fluffy_Pillow 77.9/140: 56% focus
3:39.122 dire_beast Fluffy_Pillow 103.0/140: 74% focus
3:40.307 Waiting 0.100 sec 118.1/140: 84% focus dire_beast
3:40.407 cobra_shot Fluffy_Pillow 119.4/140: 85% focus dire_beast
3:41.740 Waiting 1.300 sec 96.4/140: 69% focus dire_beast
3:43.040 kill_command Fluffy_Pillow 113.0/140: 81% focus dire_beast
3:44.440 Waiting 1.500 sec 100.9/140: 72% focus dire_beast
3:45.940 cobra_shot Fluffy_Pillow 120.1/140: 86% focus dire_beast
3:47.273 Waiting 2.200 sec 95.1/140: 68% focus
3:49.473 cobra_shot Fluffy_Pillow 119.9/140: 86% focus
3:50.807 dire_beast Fluffy_Pillow 94.9/140: 68% focus
3:51.991 bestial_wrath Fluffy_Pillow 110.0/140: 79% focus dire_beast
3:51.991 dire_beast Fluffy_Pillow 110.0/140: 79% focus bestial_wrath, dire_beast
3:53.176 kill_command Fluffy_Pillow 127.0/140: 91% focus bestial_wrath, dire_beast(2)
3:54.361 cobra_shot Fluffy_Pillow 113.9/140: 81% focus bestial_wrath, dire_beast(2)
3:55.694 kill_command Fluffy_Pillow 92.9/140: 66% focus bestial_wrath, dire_beast(2)
3:56.879 chimaera_shot Fluffy_Pillow 79.8/140: 57% focus bestial_wrath, dire_beast(2)
3:58.213 cobra_shot Fluffy_Pillow 108.8/140: 78% focus bestial_wrath, dire_beast(2)
3:59.548 kill_command Fluffy_Pillow 85.9/140: 61% focus bestial_wrath, dire_beast
4:00.734 a_murder_of_crows Fluffy_Pillow 69.3/140: 49% focus bestial_wrath
4:02.069 cobra_shot Fluffy_Pillow 54.3/140: 39% focus bestial_wrath
4:03.402 dire_beast Fluffy_Pillow 29.3/140: 21% focus bestial_wrath
4:04.586 kill_command Fluffy_Pillow 44.4/140: 32% focus bestial_wrath, dire_beast
4:05.771 chimaera_shot Fluffy_Pillow 29.6/140: 21% focus bestial_wrath, dire_beast
4:07.107 Waiting 3.900 sec 56.6/140: 40% focus dire_beast
4:11.007 kill_command Fluffy_Pillow 106.5/140: 76% focus dire_beast
4:12.425 Waiting 1.400 sec 92.8/140: 66% focus
4:13.825 dire_beast Fluffy_Pillow 108.6/140: 78% focus
4:15.232 cobra_shot Fluffy_Pillow 126.2/140: 90% focus dire_beast
4:16.568 Waiting 1.100 sec 103.3/140: 74% focus dire_beast
4:17.668 kill_command Fluffy_Pillow 117.3/140: 84% focus dire_beast
4:19.078 Waiting 1.100 sec 105.3/140: 75% focus dire_beast
4:20.178 cobra_shot Fluffy_Pillow 119.4/140: 85% focus dire_beast
4:21.513 Waiting 1.600 sec 96.4/140: 69% focus dire_beast
4:23.113 dire_beast Fluffy_Pillow 115.2/140: 82% focus
4:24.298 bestial_wrath Fluffy_Pillow 130.3/140: 93% focus dire_beast
4:24.298 kill_command Fluffy_Pillow 130.3/140: 93% focus bestial_wrath, dire_beast
4:25.735 cobra_shot Fluffy_Pillow 118.7/140: 85% focus bestial_wrath, dire_beast
4:27.068 kill_command Fluffy_Pillow 95.7/140: 68% focus bestial_wrath, dire_beast
4:28.253 chimaera_shot Fluffy_Pillow 80.8/140: 58% focus bestial_wrath, dire_beast
4:29.585 cobra_shot Fluffy_Pillow 107.9/140: 77% focus bestial_wrath, dire_beast
4:30.918 aspect_of_the_wild Fluffy_Pillow 84.9/140: 61% focus bestial_wrath, dire_beast
4:30.918 kill_command Fluffy_Pillow 84.9/140: 61% focus aspect_of_the_wild, bestial_wrath, dire_beast
4:32.103 cobra_shot Fluffy_Pillow 80.3/140: 57% focus aspect_of_the_wild, bestial_wrath
4:33.438 kill_command Fluffy_Pillow 68.7/140: 49% focus aspect_of_the_wild, bestial_wrath
4:34.623 dire_beast Fluffy_Pillow 63.9/140: 46% focus aspect_of_the_wild, bestial_wrath
4:35.807 cobra_shot Fluffy_Pillow 90.9/140: 65% focus aspect_of_the_wild, bestial_wrath, dire_beast
4:37.143 kill_command Fluffy_Pillow 81.3/140: 58% focus aspect_of_the_wild, bestial_wrath, dire_beast
4:38.327 chimaera_shot Fluffy_Pillow 78.2/140: 56% focus aspect_of_the_wild, bestial_wrath, dire_beast
4:39.660 Waiting 0.100 sec 118.6/140: 85% focus aspect_of_the_wild, dire_beast
4:39.760 cobra_shot Fluffy_Pillow 120.9/140: 86% focus aspect_of_the_wild, dire_beast
4:41.096 Waiting 0.800 sec 109.5/140: 78% focus dire_beast
4:41.896 cobra_shot Fluffy_Pillow 119.7/140: 86% focus dire_beast
4:43.230 Waiting 0.400 sec 94.8/140: 68% focus
4:43.630 kill_command Fluffy_Pillow 99.3/140: 71% focus
4:44.982 Waiting 0.100 sec 84.5/140: 60% focus
4:45.082 dire_beast Fluffy_Pillow 85.6/140: 61% focus
4:46.454 Waiting 0.600 sec 102.9/140: 73% focus dire_beast
4:47.054 dire_beast Fluffy_Pillow 110.6/140: 79% focus dire_beast
4:48.240 cobra_shot Fluffy_Pillow 127.5/140: 91% focus dire_beast(2)
4:49.574 Waiting 0.700 sec 106.5/140: 76% focus dire_beast(2)
4:50.274 kill_command Fluffy_Pillow 116.5/140: 83% focus dire_beast(2)
4:51.636 Waiting 1.000 sec 105.9/140: 76% focus dire_beast(2)
4:52.636 cobra_shot Fluffy_Pillow 120.2/140: 86% focus dire_beast(2)
4:53.969 Waiting 1.800 sec 97.2/140: 69% focus dire_beast
4:55.769 cobra_shot Fluffy_Pillow 119.2/140: 85% focus
4:57.103 kill_command Fluffy_Pillow 94.2/140: 67% focus
4:58.291 dire_beast Fluffy_Pillow 77.6/140: 55% focus
4:59.476 bestial_wrath Fluffy_Pillow 92.7/140: 66% focus dire_beast
4:59.476 cobra_shot Fluffy_Pillow 92.7/140: 66% focus bestial_wrath, dire_beast
5:00.812 a_murder_of_crows Fluffy_Pillow 69.8/140: 50% focus bestial_wrath, dire_beast
5:02.147 kill_command Fluffy_Pillow 56.8/140: 41% focus bestial_wrath, dire_beast
5:03.331 chimaera_shot Fluffy_Pillow 42.0/140: 30% focus bestial_wrath, dire_beast
5:04.667 cobra_shot Fluffy_Pillow 69.0/140: 49% focus bestial_wrath, dire_beast
5:06.003 kill_command Fluffy_Pillow 46.1/140: 33% focus bestial_wrath, dire_beast
5:07.186 Waiting 1.000 sec 29.4/140: 21% focus bestial_wrath
5:08.186 cobra_shot Fluffy_Pillow 40.7/140: 29% focus bestial_wrath
5:09.521 dire_beast Fluffy_Pillow 15.7/140: 11% focus bestial_wrath
5:10.705 kill_command Fluffy_Pillow 30.9/140: 22% focus bestial_wrath, dire_beast
5:11.891 chimaera_shot Fluffy_Pillow 16.0/140: 11% focus bestial_wrath, dire_beast
5:13.226 cobra_shot Fluffy_Pillow 43.1/140: 31% focus bestial_wrath, dire_beast
5:14.561 Waiting 0.800 sec 20.1/140: 14% focus dire_beast
5:15.361 kill_command Fluffy_Pillow 30.3/140: 22% focus dire_beast
5:16.545 Waiting 3.100 sec 15.4/140: 11% focus dire_beast
5:19.645 chimaera_shot Fluffy_Pillow 51.9/140: 37% focus
5:21.211 dire_beast Fluffy_Pillow 79.5/140: 57% focus
5:22.396 dire_beast Fluffy_Pillow 94.7/140: 68% focus dire_beast
5:23.580 kill_command Fluffy_Pillow 111.6/140: 80% focus dire_beast(2)
5:24.763 Waiting 1.500 sec 98.5/140: 70% focus dire_beast(2)
5:26.263 cobra_shot Fluffy_Pillow 119.9/140: 86% focus dire_beast(2)
5:27.596 Waiting 1.500 sec 98.9/140: 71% focus dire_beast(2)
5:29.096 cobra_shot Fluffy_Pillow 120.3/140: 86% focus dire_beast(2)
5:30.431 kill_command Fluffy_Pillow 96.1/140: 69% focus
5:31.616 chimaera_shot Fluffy_Pillow 79.5/140: 57% focus
5:32.950 dire_beast Fluffy_Pillow 104.5/140: 75% focus
5:34.226 bestial_wrath Fluffy_Pillow 120.7/140: 86% focus dire_beast
5:34.226 cobra_shot Fluffy_Pillow 120.7/140: 86% focus bestial_wrath, dire_beast
5:35.560 kill_command Fluffy_Pillow 97.7/140: 70% focus bestial_wrath, dire_beast
5:36.745 cobra_shot Fluffy_Pillow 82.8/140: 59% focus bestial_wrath, dire_beast
5:38.078 dire_beast Fluffy_Pillow 59.8/140: 43% focus bestial_wrath, dire_beast
5:39.262 kill_command Fluffy_Pillow 76.7/140: 55% focus bestial_wrath, dire_beast(2)
5:40.448 chimaera_shot Fluffy_Pillow 63.7/140: 45% focus bestial_wrath, dire_beast(2)
5:41.782 cobra_shot Fluffy_Pillow 90.7/140: 65% focus bestial_wrath, dire_beast
5:43.117 kill_command Fluffy_Pillow 67.8/140: 48% focus bestial_wrath, dire_beast
5:44.303 cobra_shot Fluffy_Pillow 52.9/140: 38% focus bestial_wrath, dire_beast
5:45.638 Waiting 0.100 sec 30.0/140: 21% focus bestial_wrath, dire_beast
5:45.738 kill_command Fluffy_Pillow 31.2/140: 22% focus bestial_wrath, dire_beast
5:46.922 Waiting 1.300 sec 14.6/140: 10% focus bestial_wrath
5:48.222 chimaera_shot Fluffy_Pillow 29.2/140: 21% focus bestial_wrath
5:49.768 dire_beast Fluffy_Pillow 56.7/140: 40% focus
5:50.952 Waiting 1.200 sec 71.8/140: 51% focus dire_beast
5:52.152 kill_command Fluffy_Pillow 87.1/140: 62% focus dire_beast
5:53.576 Waiting 3.500 sec 75.3/140: 54% focus dire_beast
5:57.076 cobra_shot Fluffy_Pillow 120.0/140: 86% focus dire_beast
5:58.411 Waiting 0.400 sec 95.0/140: 68% focus
5:58.811 kill_command Fluffy_Pillow 99.5/140: 71% focus
6:00.230 dire_beast Fluffy_Pillow 85.5/140: 61% focus
6:01.599 a_murder_of_crows Fluffy_Pillow 102.7/140: 73% focus dire_beast
6:02.936 chimaera_shot Fluffy_Pillow 89.8/140: 64% focus dire_beast
6:04.271 Waiting 0.200 sec 116.9/140: 83% focus dire_beast
6:04.471 cobra_shot Fluffy_Pillow 119.4/140: 85% focus dire_beast
6:05.806 kill_command Fluffy_Pillow 96.5/140: 69% focus dire_beast
6:06.989 Waiting 3.200 sec 81.6/140: 58% focus dire_beast
6:10.189 cobra_shot Fluffy_Pillow 119.7/140: 86% focus
6:11.523 dire_beast Fluffy_Pillow 94.8/140: 68% focus
6:12.709 bestial_wrath Fluffy_Pillow 109.9/140: 79% focus dire_beast
6:12.709 kill_command Fluffy_Pillow 109.9/140: 79% focus bestial_wrath, dire_beast
6:13.893 cobra_shot Fluffy_Pillow 95.0/140: 68% focus bestial_wrath, dire_beast
6:15.227 kill_command Fluffy_Pillow 72.1/140: 51% focus bestial_wrath, dire_beast
6:16.414 chimaera_shot Fluffy_Pillow 57.2/140: 41% focus bestial_wrath, dire_beast
6:17.746 cobra_shot Fluffy_Pillow 84.3/140: 60% focus bestial_wrath, dire_beast
6:19.082 kill_command Fluffy_Pillow 61.3/140: 44% focus bestial_wrath, dire_beast
6:20.266 cobra_shot Fluffy_Pillow 44.7/140: 32% focus bestial_wrath
6:21.600 Waiting 0.400 sec 19.7/140: 14% focus bestial_wrath
6:22.000 dire_beast Fluffy_Pillow 24.2/140: 17% focus bestial_wrath
6:23.354 kill_command Fluffy_Pillow 41.2/140: 29% focus bestial_wrath, dire_beast
6:24.540 chimaera_shot Fluffy_Pillow 26.4/140: 19% focus bestial_wrath, dire_beast
6:25.874 cobra_shot Fluffy_Pillow 53.4/140: 38% focus bestial_wrath, dire_beast
6:27.207 kill_command Fluffy_Pillow 30.4/140: 22% focus bestial_wrath, dire_beast
6:28.391 Waiting 3.900 sec 15.6/140: 11% focus dire_beast
6:32.291 chimaera_shot Fluffy_Pillow 62.2/140: 44% focus
6:33.860 dire_beast Fluffy_Pillow 89.9/140: 64% focus
6:35.043 kill_command Fluffy_Pillow 105.0/140: 75% focus dire_beast
6:36.228 Waiting 2.300 sec 90.2/140: 64% focus dire_beast
6:38.528 cobra_shot Fluffy_Pillow 119.5/140: 85% focus dire_beast
6:39.861 Waiting 1.600 sec 96.6/140: 69% focus dire_beast
6:41.461 dire_beast Fluffy_Pillow 117.0/140: 84% focus dire_beast
6:42.646 kill_command Fluffy_Pillow 132.1/140: 94% focus dire_beast
6:43.831 Waiting 0.200 sec 117.3/140: 84% focus dire_beast
6:44.031 cobra_shot Fluffy_Pillow 119.8/140: 86% focus dire_beast
6:45.366 Waiting 1.800 sec 96.9/140: 69% focus dire_beast
6:47.166 cobra_shot Fluffy_Pillow 119.8/140: 86% focus dire_beast
6:48.500 Waiting 0.600 sec 96.9/140: 69% focus dire_beast
6:49.100 kill_command Fluffy_Pillow 104.5/140: 75% focus dire_beast
6:50.485 dire_beast Fluffy_Pillow 90.7/140: 65% focus
6:51.669 bestial_wrath Fluffy_Pillow 105.8/140: 76% focus dire_beast
6:51.669 aspect_of_the_wild Fluffy_Pillow 105.8/140: 76% focus bestial_wrath, dire_beast
6:51.669 cobra_shot Fluffy_Pillow 105.8/140: 76% focus aspect_of_the_wild, bestial_wrath, dire_beast
6:53.004 kill_command Fluffy_Pillow 96.2/140: 69% focus aspect_of_the_wild, bestial_wrath, dire_beast
6:54.190 cobra_shot Fluffy_Pillow 93.2/140: 67% focus aspect_of_the_wild, bestial_wrath, dire_beast
6:55.526 kill_command Fluffy_Pillow 83.6/140: 60% focus aspect_of_the_wild, bestial_wrath, dire_beast
6:56.710 chimaera_shot Fluffy_Pillow 80.6/140: 58% focus aspect_of_the_wild, bestial_wrath, dire_beast
6:58.043 cobra_shot Fluffy_Pillow 120.9/140: 86% focus aspect_of_the_wild, bestial_wrath, dire_beast
6:59.377 kill_command Fluffy_Pillow 109.3/140: 78% focus aspect_of_the_wild, bestial_wrath
7:00.560 cobra_shot Fluffy_Pillow 104.5/140: 75% focus aspect_of_the_wild, bestial_wrath
7:01.894 a_murder_of_crows Fluffy_Pillow 90.6/140: 65% focus bestial_wrath
7:03.228 dire_beast Fluffy_Pillow 75.6/140: 54% focus bestial_wrath
7:04.413 kill_command Fluffy_Pillow 90.8/140: 65% focus bestial_wrath, dire_beast
7:05.597 chimaera_shot Fluffy_Pillow 75.9/140: 54% focus bestial_wrath, dire_beast
7:06.931 Waiting 1.300 sec 102.9/140: 74% focus dire_beast
7:08.231 cobra_shot Fluffy_Pillow 119.5/140: 85% focus dire_beast
7:09.566 Waiting 1.300 sec 96.6/140: 69% focus dire_beast
7:10.866 kill_command Fluffy_Pillow 113.2/140: 81% focus dire_beast
7:12.252 Waiting 1.400 sec 99.1/140: 71% focus
7:13.652 dire_beast Fluffy_Pillow 114.9/140: 82% focus
7:15.059 cobra_shot Fluffy_Pillow 132.5/140: 95% focus dire_beast
7:16.393 Waiting 0.800 sec 109.5/140: 78% focus dire_beast
7:17.193 cobra_shot Fluffy_Pillow 119.7/140: 86% focus dire_beast
7:18.529 kill_command Fluffy_Pillow 96.8/140: 69% focus dire_beast
7:19.714 chimaera_shot Fluffy_Pillow 81.9/140: 59% focus dire_beast
7:21.047 Waiting 0.800 sec 109.0/140: 78% focus dire_beast
7:21.847 cobra_shot Fluffy_Pillow 119.2/140: 85% focus dire_beast
7:23.181 Waiting 1.100 sec 94.2/140: 67% focus
7:24.281 dire_beast Fluffy_Pillow 106.6/140: 76% focus
7:25.703 kill_command Fluffy_Pillow 124.4/140: 89% focus dire_beast
7:26.886 Waiting 0.700 sec 109.5/140: 78% focus dire_beast

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 6234 6234 0
Agility 19607 18242 8342 (7252)
Stamina 24274 24274 14849
Intellect 6002 6002 0
Spirit -1 -1 0
Health 1456440 1456440 0
Focus 140 140 0
Crit 24.98% 24.98% 3143
Haste 12.71% 12.71% 4131
Damage / Heal Versatility 2.84% 2.84% 1136
Attack Power 19607 18242 0
Mastery 68.65% 66.22% 7502
Armor 2313 2313 2313
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 815.00
Local Head Collar of Honorable Exultation
ilevel: 825, stats: { 311 Armor, +1541 Sta, +1028 AgiInt, +849 Mastery, +340 Haste }, gems: { +50 Mastery }
Local Neck Chain of the Green Flight
ilevel: 805, stats: { +719 Sta, +1063 Mastery, +488 Crit }
Local Shoulders Tideskorn Mantle
ilevel: 830, stats: { 292 Armor, +807 AgiInt, +1211 Sta, +616 Crit, +291 Mastery }
Local Chest Breastplate of Ten Lashes
ilevel: 825, stats: { 383 Armor, +1028 AgiInt, +1542 Sta, +748 Crit, +441 Mastery }
Local Waist Boulderbuckle Strap
ilevel: 825, stats: { 215 Armor, +771 AgiInt, +1157 Sta, +580 Haste, +312 Mastery }
Local Legs Gravenscale Leggings of the Harmonious
ilevel: 815, stats: { 325 Armor, +1404 Sta, +936 AgiInt, +327 Mastery, +818 Vers }
Local Feet Gravenscale Treads of the Feverflare
ilevel: 825, stats: { 263 Armor, +1157 Sta, +771 AgiInt, +446 Haste, +446 Mastery }
Local Wrists Gravenscale Armbands of the Peerless
ilevel: 815, stats: { 162 Armor, +790 Sta, +526 AgiInt, +229 Crit, +413 Mastery }
Local Hands Sea Stalker's Gloves
ilevel: 830, stats: { 243 Armor, +807 AgiInt, +1211 Sta, +590 Mastery, +318 Vers }
Local Finger1 Band of Fused Coral
ilevel: 840, stats: { +997 Sta, +1263 Haste, +505 Crit }, gems: { +50 Mastery }
Local Finger2 Vale Walker's Circle of the Feverflare
ilevel: 840, stats: { +997 Sta, +1263 Haste, +505 Mastery }
Local Trinket1 Enchanted Roc Feather
ilevel: 680, stats: { +253 Agi, +253 Mastery }
Local Trinket2 Caged Horror
ilevel: 840, stats: { +898 Mastery }
Local Back Drape of the Raven Lord
ilevel: 825, stats: { 119 Armor, +578 StrAgiInt, +867 Sta, +430 Mastery, +239 Haste }, gems: { +50 Mastery }
Local Main Hand Titanstrike
ilevel: 803, weapon: { 4512 - 4513, 3 }, stats: { +837 Agi, +1256 Sta, +557 Crit, +534 Mastery }, relics: { +25 ilevels, +28 ilevels }

Talents

Level
15 Big Game Hunter (Beast Mastery Hunter) Way of the Cobra (Beast Mastery Hunter) Dire Stable (Beast Mastery Hunter)
30 Stomp (Beast Mastery Hunter) Dire Frenzy (Beast Mastery Hunter) Chimaera Shot (Beast Mastery Hunter)
45 Posthaste Farstrider Dash
60 One with the Pack (Beast Mastery Hunter) Bestial Fury (Beast Mastery Hunter) Blink Strikes (Beast Mastery Hunter)
75 Binding Shot Wyvern Sting Intimidation (Beast Mastery Hunter)
90 A Murder of Crows Barrage Volley
100 Stampede (Beast Mastery Hunter) Killer Cobra (Beast Mastery Hunter) Aspect of the Beast

Profile

hunter="Rinotor"
origin="https://eu.api.battle.net/wow/character/hyjal/Rinotor/advanced"
thumbnail="http://eu.battle.net/static-render/eu/hyjal/211/115093459-avatar.jpg"
level=110
race=worgen
role=attack
position=ranged_back
professions=jewelcrafting=700/blacksmithing=700
talents=http://eu.battle.net/wow/en/tool/talent-calculator#Ya!1202201
artifact=56:0:0:0:0:871:2:872:3:873:3:874:3:875:1:877:1:881:1:1336:1
spec=beast_mastery

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=nightborne_delicacy_platter
actions.precombat+=/summon_pet
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/augmentation,type=defiled

# Executed every time the actor is available.
actions=auto_shot
actions+=/arcane_torrent,if=focus.deficit>=30
actions+=/blood_fury
actions+=/berserking
actions+=/potion,name=deadly_grace
actions+=/a_murder_of_crows
actions+=/stampede,if=buff.bloodlust.up|buff.bestial_wrath.up|cooldown.bestial_wrath.remains<=2|target.time_to_die<=14
actions+=/dire_beast,if=cooldown.bestial_wrath.remains>2
actions+=/dire_frenzy,if=cooldown.bestial_wrath.remains>2
actions+=/aspect_of_the_wild,if=buff.bestial_wrath.up
actions+=/barrage,if=spell_targets.barrage>1|(spell_targets.barrage=1&focus>90)
actions+=/titans_thunder,if=cooldown.dire_beast.remains>=3|buff.bestial_wrath.up&pet.dire_beast.active
actions+=/bestial_wrath
actions+=/multi_shot,if=spell_targets.multi_shot>4&(pet.buff.beast_cleave.remains<gcd.max|pet.buff.beast_cleave.down)
actions+=/kill_command
actions+=/multi_shot,if=spell_targets.multi_shot>1&(pet.buff.beast_cleave.remains<gcd.max*2|pet.buff.beast_cleave.down)
actions+=/chimaera_shot,if=focus<90
actions+=/cobra_shot,if=talent.killer_cobra.enabled&(cooldown.bestial_wrath.remains>=4&(buff.bestial_wrath.up&cooldown.kill_command.remains>=2)|focus>119)|!talent.killer_cobra.enabled&focus>90

head=collar_of_honorable_exultation,id=136777,bonus_id=1726/1808/1477,gems=50mastery
neck=chain_of_the_green_flight,id=137311,bonus_id=1826/1457
shoulders=tideskorn_mantle,id=134213,bonus_id=1726/1492/3339
back=drape_of_the_raven_lord,id=136770,bonus_id=1726/1808/1477,gems=50mastery
chest=breastplate_of_ten_lashes,id=137368,bonus_id=1726/1477
wrists=gravenscale_armbands,id=128907,bonus_id=596/600/689/1688/3408
hands=sea_stalkers_gloves,id=134253,bonus_id=3397/1492/1675
waist=boulderbuckle_strap,id=134481,bonus_id=1726/1477
legs=gravenscale_leggings,id=128904,bonus_id=596/600/689/1717/3408
feet=gravenscale_treads,id=128901,bonus_id=689/1700/3408/600/598
finger1=band_of_fused_coral,id=134532,bonus_id=1726/1808/1492/3337,gems=50mastery
finger2=vale_walkers_circle,id=121192,bonus_id=1727/1763/1632/1813
trinket1=enchanted_roc_feather,id=121071,bonus_id=1812/605
trinket2=caged_horror,id=136716,bonus_id=1726/1492/3337
main_hand=titanstrike,id=128861,gem_id=132355/133052/0/0,relic_id=1793:1605:1809/1793:1615:1809/0/0

# Gear Summary
# gear_ilvl=814.87
# gear_agility=8342
# gear_stamina=14849
# gear_crit_rating=3143
# gear_haste_rating=4131
# gear_mastery_rating=7502
# gear_versatility_rating=1136
# gear_armor=2313
summon_pet=cat

Lâstykökö

Lâstykökö : 154335 dps

  • Race: Gnome
  • Class: Mage
  • Spec: Fire
  • Level: 110
  • Role: Spell
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
154335.1 154335.1 99.8 / 0.065% 20072.4 / 13.0% 8.6
RPS Out RPS In Primary Resource Waiting APM Active Skill
17964.1 17964.1 Mana 0.00% 50.1 100.0% 100%
Origin https://eu.api.battle.net/wow/character/hyjal/Lâstykökö/advanced
Talents
  • 15: Pyromaniac (Fire Mage)
  • 30: Cauterize
  • 45: Incanter's Flow
  • 60: Flame On (Fire Mage)
  • 75: Ice Floes
  • 90: Unstable Magic
  • 100: Meteor (Fire Mage)
  • Talent Calculator
Artifact
Professions
  • inscription: 719
  • tailoring: 769

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Lâstykökö 154335
Deadly Grace 6340 4.0% 21.9 7.10sec 128046 0 Direct 21.9 68869 159231 128046 65.5%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.94 21.94 0.00 0.00 0.0000 0.0000 2809911.80 2809911.80 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.57 34.51% 68868.61 63952 73791 68859.62 0 73791 521548 521548 0.00
crit 14.37 65.49% 159231.12 127905 184478 159313.97 145820 174639 2288364 2288364 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:5.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=47572 to 71358} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:47572.00
  • base_dd_max:71358.00
 
Fire Blast 11375 7.4% 56.3 8.06sec 90960 0 Direct 56.3 0 90960 90960 100.0%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 56.27 56.27 0.00 0.00 0.0000 0.0000 5117888.39 5117888.39 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 56.27 100.00% 90960.38 77963 112446 90968.64 87320 95080 5117888 5117888 0.00
 
 

Action details: fire_blast

Static Values
  • id:108853
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:11000.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.heating_up.up
Spelldata
  • id:108853
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Blasts the enemy for {$s1=0} Fire damage. This damage is always a critical strike. Unaffected by the global cooldown and castable while casting.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Fireball 36386 23.6% 172.7 2.53sec 94892 55185 Direct 172.5 60347 126171 95021 52.7%  

Stats details: fireball

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 172.72 172.49 0.00 0.00 1.7195 0.0000 16389833.72 16389833.72 0.00 55185.18 55185.18
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 81.62 47.32% 60346.66 56037 64658 60346.86 59397 61342 4925642 4925642 0.00
crit 90.86 52.68% 126170.64 112074 161645 126158.94 122710 131435 11464192 11464192 0.00
 
 

Action details: fireball

Static Values
  • id:133
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:22000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:133
  • name:Fireball
  • school:fire
  • tooltip:
  • description:Throws a fiery ball that causes {$s1=1} Fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Mastery: Ignite (ignite) 32274 20.9% 351.7 1.29sec 41306 0 Periodic 449.2 32340 0 32340 0.0% 99.7%

Stats details: ignite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 351.66 0.00 449.16 449.16 0.0000 1.0000 14525747.77 14525747.77 0.00 32340.02 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 449.2 100.00% 32339.81 3873 122620 32366.27 27775 37494 14525748 14525748 0.00
 
 

Action details: ignite

Static Values
  • id:12846
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:12846
  • name:Mastery: Ignite
  • school:physical
  • tooltip:
  • description:Your target burns for an additional $m1% over {$12654d=9 seconds} of the total direct damage caused by your Fireball, Fire Blast, Scorch, Pyroblast{$?s153561=false}[, Meteor][]{$?s198929=false}[, Cinderstorm][], and Flamestrike. If this effect is reapplied, any remaining damage will be added to the new Ignite. Every $t3 sec, your Ignites may spread to another nearby enemy.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:9.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Meteor 0 (7041) 0.0% (4.6%) 8.3 60.46sec 379554 293890

Stats details: meteor

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.34 0.00 57.47 0.00 1.2915 1.1441 0.00 0.00 0.00 41379.75 293890.33
 
 

Action details: meteor

Static Values
  • id:153561
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:11000.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:cooldown.combustion.remains>30|(cooldown.combustion.remains>target.time_to_die)|buff.rune_of_power.up
Spelldata
  • id:153561
  • name:Meteor
  • school:fire
  • tooltip:
  • description:Calls down a meteor which lands at the target location after {$177345d=3 seconds}, dealing {$153564s1=1} Fire damage, split evenly between all targets within 8 yards, and burns the ground, dealing ${8*{$155158s1=0}} Fire damage over {$175396d=8 seconds} to all enemies in the area.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Meteor (_impact) 5615 3.6% 8.3 58.52sec 303447 0 Direct 8.3 168632 359481 304017 70.9%  

Stats details: meteor_impact

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.32 8.31 0.00 0.00 0.0000 0.0000 2525418.50 2525418.50 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.41 29.06% 168632.01 156623 180719 163251.03 0 180719 407091 407091 0.00
crit 5.89 70.94% 359481.43 313246 451796 359498.45 325293 415653 2118327 2118327 0.00
 
 

Action details: meteor_impact

Static Values
  • id:153564
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:1.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:153564
  • name:Meteor
  • school:fire
  • tooltip:
  • description:{$@spelldesc153561=Calls down a meteor which lands at the target location after {$177345d=3 seconds}, dealing {$153564s1=1} Fire damage, split evenly between all targets within 8 yards, and burns the ground, dealing ${8*{$155158s1=0}} Fire damage over {$175396d=8 seconds} to all enemies in the area. }
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:5.625000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Meteor Burn 1426 0.9% 57.5 7.65sec 11158 0 Periodic 57.5 5624 13402 11158 71.2% 0.0%

Stats details: meteor_burn

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 57.47 0.00 0.00 57.47 0.0000 0.0000 641249.80 641249.80 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.6 28.84% 5623.57 5221 6024 5623.46 5355 5967 93220 93220 0.00
crit 40.9 71.16% 13401.92 10441 15060 13406.90 12582 14052 548030 548030 0.00
 
 

Action details: meteor_burn

Static Values
  • id:155158
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:155158
  • name:Meteor Burn
  • school:fire
  • tooltip:Burning for $w1 Fire damage every $t1 sec.
  • description:{$@spelldesc153561=Calls down a meteor which lands at the target location after {$177345d=3 seconds}, dealing {$153564s1=1} Fire damage, split evenly between all targets within 8 yards, and burns the ground, dealing ${8*{$155158s1=0}} Fire damage over {$175396d=8 seconds} to all enemies in the area. }
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.187500
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Phoenix's Flames 4928 3.2% 10.6 46.09sec 209482 172633 Direct 10.5 0 210045 210045 100.0%  

Stats details: phoenixs_flames

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.55 10.52 0.00 0.00 1.2135 0.0000 2210216.61 2210216.61 0.00 172632.71 172632.71
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 10.52 100.00% 210045.42 167065 240960 210139.56 188752 231143 2210217 2210217 0.00
 
 

Action details: phoenixs_flames

Static Values
  • id:194466
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:194466
  • name:Phoenix's Flames
  • school:fire
  • tooltip:
  • description:Hurls a Phoenix that causes {$s1=1} Fire damage to the target and splashes {$224637s2=0} Fire damage to other nearby enemies. This damage is always a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Pyroblast 51429 33.3% 103.3 4.36sec 223934 178981 Direct 104.1 127142 292894 222163 57.3%  

Stats details: pyroblast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 103.30 104.12 0.00 0.00 1.2512 0.0000 23131261.00 23131261.00 0.00 178980.50 178980.50
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 44.43 42.67% 127142.30 118059 136222 127141.13 123772 131681 5649026 5649026 0.00
crit 59.69 57.33% 292893.56 236118 340555 292928.22 282313 304726 17482235 17482235 0.00
 
 

Action details: pyroblast

Static Values
  • id:11366
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:27500.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:4.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:11366
  • name:Pyroblast
  • school:fire
  • tooltip:
  • description:Hurls an immense fiery boulder that causes {$s1=1} Fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Scorch 3 0.0% 0.0 233.19sec 35272 27321 Direct 0.0 0 35272 35272 100.0%  

Stats details: scorch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.04 0.04 0.00 0.00 1.2914 0.0000 1393.39 1393.39 0.00 27321.38 27321.38
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 0.04 100.00% 35272.18 27846 40163 1373.59 0 40163 1393 1393 0.00
 
 

Action details: scorch

Static Values
  • id:2948
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:11000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.combustion.remains>cast_time
Spelldata
  • id:2948
  • name:Scorch
  • school:fire
  • tooltip:
  • description:Scorches an enemy for {$s1=1} Fire damage. Castable while moving.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Unstable Magic (_explosion) 4558 3.0% 43.2 9.92sec 47490 0 Direct 43.2 47488 0 47488 0.0%  

Stats details: unstable_magic_explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.24 43.24 0.00 0.00 0.0000 0.0000 2053378.92 2053378.92 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 43.24 100.00% 47488.30 28019 80823 47510.16 38692 57861 2053379 2053379 0.00
 
 

Action details: unstable_magic_explosion

Static Values
  • id:157976
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:157976
  • name:Unstable Magic
  • school:none
  • tooltip:
  • description:{$?s137021=false}[Arcane Blast]?s137019[Fireball][Frostbolt] has a {$?s137020=false}[{$s2=20}%]?s137021[{$s1=15}%][{$s3=25}%] chance to explode on impact, dealing {$s4=50}% additional damage to the target and all other enemies within $157977A1 yds.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63364.94
  • base_dd_max:63364.94
 
Simple Action Stats Execute Interval
Lâstykökö
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Lâstykökö
  • harmful:false
  • if_expr:
 
Combustion 4.3 120.37sec

Stats details: combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.32 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: combustion

Static Values
  • id:190319
  • school:fire
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:110000.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:190319
  • name:Combustion
  • school:fire
  • tooltip:Critical Strike chance increased by $w1%. Mastery increased by $w2.
  • description:Engulfs you in flames for {$d=10 seconds}, increasing your critical strike chance by {$s1=100}% and granting you Mastery equal to your Critical Strike stat. Unaffected by the global cooldown and castable while casting.
 
Counterspell 10.8 43.01sec

Stats details: counterspell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.77 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: counterspell

Static Values
  • id:2139
  • school:arcane
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:22000.0
  • secondary_cost:0.0
  • cooldown:24.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.debuff.casting.react
Spelldata
  • id:2139
  • name:Counterspell
  • school:arcane
  • tooltip:
  • description:Counters the enemy's spellcast, preventing any spell from that school of magic from being cast for {$d=6 seconds}$?s12598[ and silencing the target for $55021d][].
 
Flame On 8.2 59.08sec

Stats details: flame_on

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.25 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flame_on

Static Values
  • id:205029
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:action.fire_blast.charges=0&(cooldown.combustion.remains>40+(talent.kindling.enabled*25)|target.time_to_die.remains<cooldown.combustion.remains)
Spelldata
  • id:205029
  • name:Flame On
  • school:fire
  • tooltip:
  • description:Immediately grants {$s1=2} charges of Fire Blast.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Lâstykökö
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Lâstykökö
  • harmful:false
  • if_expr:
 
Phoenix's Flames (_splash) 10.5 46.13sec

Stats details: phoenixs_flames_splash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.52 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: phoenixs_flames_splash

Static Values
  • id:224637
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:224637
  • name:Phoenix's Flames
  • school:fire
  • tooltip:
  • description:{$@spelldesc194466=Hurls a Phoenix that causes {$s1=1} Fire damage to the target and splashes {$224637s2=0} Fire damage to other nearby enemies. This damage is always a critical strike.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 11.66% 0.0(0.0) 1.0

Buff details

  • buff initial source:Lâstykökö
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Combustion 4.3 0.0 120.4sec 120.4sec 9.50% 15.11% 85.3(85.3) 4.2

Buff details

  • buff initial source:Lâstykökö
  • cooldown name:buff_combustion
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • combustion_1:9.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190319
  • name:Combustion
  • tooltip:Critical Strike chance increased by $w1%. Mastery increased by $w2.
  • description:Engulfs you in flames for {$d=10 seconds}, increasing your critical strike chance by {$s1=100}% and granting you Mastery equal to your Critical Strike stat. Unaffected by the global cooldown and castable while casting.
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Enhanced Pyrotechnics 50.4 31.2 8.6sec 5.3sec 47.05% 36.35% 0.0(0.0) 0.1

Buff details

  • buff initial source:Lâstykökö
  • cooldown name:buff_enhanced_pyrotechnics
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • enhanced_pyrotechnics_1:32.37%
  • enhanced_pyrotechnics_2:10.68%
  • enhanced_pyrotechnics_3:3.22%
  • enhanced_pyrotechnics_4:0.70%
  • enhanced_pyrotechnics_5:0.08%
  • enhanced_pyrotechnics_6:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:157644
  • name:Enhanced Pyrotechnics
  • tooltip:Increases critical strike chance of Fireball by {$s1=10}%.
  • description:{$@spelldesc157642=Each time your Fireball fails to critically strike a target, it gains a stacking {$157644s1=10}% increased critical strike chance. Effect ends when Fireball critically strikes.}
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Heating Up 114.1 0.0 4.0sec 4.0sec 31.96% 45.50% 0.0(0.0) 0.0

Buff details

  • buff initial source:Lâstykökö
  • cooldown name:buff_heating_up
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • heating_up_1:31.96%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:48107
  • name:Heating Up
  • tooltip:Scored a spell critical. A second spell critical in a row will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.
  • description:Scored a spell critical. A second spell critical in a row will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Hot Streak! 95.2 0.0 4.7sec 4.7sec 20.99% 37.91% 0.0(0.0) 0.0

Buff details

  • buff initial source:Lâstykökö
  • cooldown name:buff_hot_streak
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • hot_streak_1:20.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:48108
  • name:Hot Streak!
  • tooltip:Your next Pyroblast or Flamestrike spell is instant cast, and causes double the normal Ignite damage.
  • description:{$@spelldesc195283=Getting two direct-damage critical strikes in a row will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Potion of Deadly Grace 2.0 0.0 119.7sec 0.0sec 10.83% 10.89% 0.0(0.0) 2.0

Buff details

  • buff initial source:Lâstykökö
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:10.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Pyretic Incantation 74.3 143.1 6.1sec 2.1sec 58.22% 70.77% 38.3(38.3) 0.0

Buff details

  • buff initial source:Lâstykökö
  • cooldown name:buff_pyretic_incantation
  • max_stacks:5
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • pyretic_incantation_1:24.70%
  • pyretic_incantation_2:12.97%
  • pyretic_incantation_3:2.62%
  • pyretic_incantation_4:6.63%
  • pyretic_incantation_5:11.30%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194329
  • name:Pyretic Incantation
  • tooltip:Your spells deal an additional $m1% critical hit damage.
  • description:Your spells deal an additional $m1% critical hit damage.
  • max_stacks:5
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Lâstykökö
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Lâstykökö
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Incanter's Flow

Buff details

  • buff initial source:Lâstykökö
  • cooldown name:buff_incanters_flow
  • max_stacks:5
  • duration:1350.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • incanters_flow_1:20.00%
  • incanters_flow_2:20.00%
  • incanters_flow_3:20.00%
  • incanters_flow_4:20.00%
  • incanters_flow_5:20.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:116267
  • name:Incanter's Flow
  • tooltip:Increases spell damage by $w1%.
  • description:{$@spelldesc1463=Magical energy flows through you while in combat, building up to ${$116267m1*5}% increased damage and then diminishing down to {$116267s1=4}% increased damage, cycling every 10 sec.}
  • max_stacks:5
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Molten Armor

Buff details

  • buff initial source:Lâstykökö
  • cooldown name:buff_molten_armor
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • molten_armor_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:30482
  • name:Molten Armor
  • tooltip:Spell critical strike chance increased by $w1%. Physical damage taken reduced by $w2%.
  • description:Increases your spell critical strike chance by {$s1=15}% and reduces all Physical damage you take by {$s2=6}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (the_hungry_magister)

Buff details

  • buff initial source:Lâstykökö
  • cooldown name:buff_the_hungry_magister
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:375.00

Stack Uptimes

  • the_hungry_magister_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225602
  • name:Well Fed
  • tooltip:Critical Strike increased by $w1.
  • description:Increases critical strike by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Lâstykökö
combustion Mana 4.3 475318.3 110000.0 109993.5 0.0
counterspell Mana 10.8 236945.7 22000.0 22000.4 0.0
fire_blast Mana 56.3 618916.3 11000.0 11000.0 8.3
fireball Mana 172.7 3799897.1 22000.0 22000.1 4.3
meteor Mana 8.3 91772.6 11000.0 10999.8 34.5
pyroblast Mana 104.3 2868068.4 27500.0 27765.8 8.1
scorch Mana 0.0 434.2 11000.0 10991.2 3.2
Resource Gains Type Count Total Average Overflow
mp5_regen Mana 1801.20 7429944.48 (100.00%) 4125.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Mana 16495.60 17964.12
Combat End Resource Mean Min Max
Mana 494094.73 188375.00 749375.00

Benefits & Uptimes

Benefits %
Incanter's Flow Incanter's Flow 1 20.3%
Incanter's Flow Incanter's Flow 2 19.8%
Incanter's Flow Incanter's Flow 3 19.9%
Incanter's Flow Incanter's Flow 4 19.7%
Incanter's Flow Incanter's Flow 5 20.3%
Uptimes %

Procs

Count Interval
Heating Up generated 114.1 4.0sec
Heating Up removed 18.5 22.5sec
IB conversions of HU 55.9 8.1sec
Total Hot Streak procs 95.2 4.7sec
Hot Streak spells used 343.4 1.3sec
Hot Streak spell crits 217.4 2.1sec
Wasted Hot Streak spell crits 8.1 48.9sec
Direct Ignite applications 1.0 0.0sec
Ignites spread 1.0 0.0sec

Statistics & Data Analysis

Fight Length
Sample Data Lâstykökö Fight Length
Count 9999
Mean 450.42
Minimum 350.15
Maximum 555.44
Spread ( max - min ) 205.29
Range [ ( max - min ) / 2 * 100% ] 22.79%
DPS
Sample Data Lâstykökö Damage Per Second
Count 9999
Mean 154335.14
Minimum 137351.65
Maximum 176879.99
Spread ( max - min ) 39528.34
Range [ ( max - min ) / 2 * 100% ] 12.81%
Standard Deviation 5089.9012
5th Percentile 146330.13
95th Percentile 163057.14
( 95th Percentile - 5th Percentile ) 16727.01
Mean Distribution
Standard Deviation 50.9016
95.00% Confidence Intervall ( 154235.37 - 154434.90 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 41
0.1% Error 4178
0.1 Scale Factor Error with Delta=300 221157
0.05 Scale Factor Error with Delta=300 884631
0.01 Scale Factor Error with Delta=300 22115785
Priority Target DPS
Sample Data Lâstykökö Priority Target Damage Per Second
Count 9999
Mean 154335.14
Minimum 137351.65
Maximum 176879.99
Spread ( max - min ) 39528.34
Range [ ( max - min ) / 2 * 100% ] 12.81%
Standard Deviation 5089.9012
5th Percentile 146330.13
95th Percentile 163057.14
( 95th Percentile - 5th Percentile ) 16727.01
Mean Distribution
Standard Deviation 50.9016
95.00% Confidence Intervall ( 154235.37 - 154434.90 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 41
0.1% Error 4178
0.1 Scale Factor Error with Delta=300 221157
0.05 Scale Factor Error with Delta=300 884631
0.01 Scale Factor Error with Delta=300 22115785
DPS(e)
Sample Data Lâstykökö Damage Per Second (Effective)
Count 9999
Mean 154335.14
Minimum 137351.65
Maximum 176879.99
Spread ( max - min ) 39528.34
Range [ ( max - min ) / 2 * 100% ] 12.81%
Damage
Sample Data Lâstykökö Damage
Count 9999
Mean 69406299.91
Minimum 50612029.45
Maximum 89349654.47
Spread ( max - min ) 38737625.02
Range [ ( max - min ) / 2 * 100% ] 27.91%
DTPS
Sample Data Lâstykökö Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Lâstykökö Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Lâstykökö Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Lâstykökö Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Lâstykökö Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Lâstykökö Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data LâstykököTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Lâstykökö Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_whispered_pact
1 0.00 food,type=the_hungry_magister
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
4 0.00 mirror_image
5 0.00 potion,name=deadly_grace
6 0.00 pyroblast
Default action list Executed every time the actor is available.
# count action,conditions
7 10.77 counterspell,if=target.debuff.casting.react
0.00 time_warp,if=target.health.pct<25|time=0
0.00 shard_of_the_exodar_warp,if=buff.bloodlust.down
0.00 mirror_image,if=buff.combustion.down
0.00 rune_of_power,if=cooldown.combustion.remains>40&buff.combustion.down&(cooldown.flame_on.remains<5|cooldown.flame_on.remains>30)&!talent.kindling.enabled|target.time_to_die.remains<11|talent.kindling.enabled&(charges_fractional>1.8|time<40)&cooldown.combustion.remains>40
8 0.00 call_action_list,name=combustion_phase,if=cooldown.combustion.remains<=action.rune_of_power.cast_time+(!talent.kindling.enabled*gcd)|buff.combustion.up
9 0.00 call_action_list,name=rop_phase,if=buff.rune_of_power.up&buff.combustion.down
A 0.00 call_action_list,name=single_target
actions.combustion_phase
# count action,conditions
0.00 rune_of_power,if=buff.combustion.down
B 0.00 call_action_list,name=active_talents
C 4.32 combustion
D 1.00 potion,name=deadly_grace
0.00 blood_fury
0.00 berserking
0.00 arcane_torrent
E 25.25 pyroblast,if=buff.hot_streak.up
F 16.81 fire_blast,if=buff.heating_up.up
G 8.89 phoenixs_flames
H 0.05 scorch,if=buff.combustion.remains>cast_time
0.00 scorch,if=target.health.pct<=25&equipped.132454
actions.active_talents
# count action,conditions
J 8.25 flame_on,if=action.fire_blast.charges=0&(cooldown.combustion.remains>40+(talent.kindling.enabled*25)|target.time_to_die.remains<cooldown.combustion.remains)
0.00 blast_wave,if=(buff.combustion.down)|(buff.combustion.up&action.fire_blast.charges<1&action.phoenixs_flames.charges<1)
K 8.34 meteor,if=cooldown.combustion.remains>30|(cooldown.combustion.remains>target.time_to_die)|buff.rune_of_power.up
0.00 cinderstorm,if=cooldown.combustion.remains<cast_time&(buff.rune_of_power.up|!talent.rune_on_power.enabled)|cooldown.combustion.remains>10*spell_haste&!buff.combustion.up
0.00 dragons_breath,if=equipped.132863
0.00 living_bomb,if=active_enemies>3&buff.combustion.down
actions.single_target
# count action,conditions
L 0.00 pyroblast,if=buff.hot_streak.up&buff.hot_streak.remains<action.fireball.execute_time
0.00 phoenixs_flames,if=charges_fractional>2.7&active_enemies>2
0.00 flamestrike,if=talent.flame_patch.enabled&active_enemies>2&buff.hot_streak.react
M 78.05 pyroblast,if=buff.hot_streak.up&!prev_gcd.pyroblast
0.00 pyroblast,if=buff.hot_streak.react&target.health.pct<=25&equipped.132454
0.00 pyroblast,if=buff.kaelthas_ultimate_ability.react
N 0.00 call_action_list,name=active_talents
O 39.45 fire_blast,if=!talent.kindling.enabled&buff.heating_up.up&(!talent.rune_of_power.enabled|charges_fractional>1.4|cooldown.combustion.remains<40)&(3-charges_fractional)*(12*spell_haste)<cooldown.combustion.remains+3|target.time_to_die.remains<4
0.00 fire_blast,if=talent.kindling.enabled&buff.heating_up.up&(!talent.rune_of_power.enabled|charges_fractional>1.5|cooldown.combustion.remains<40)&(3-charges_fractional)*(18*spell_haste)<cooldown.combustion.remains+3|target.time_to_die.remains<4
P 1.66 phoenixs_flames,if=(buff.combustion.up|buff.rune_of_power.up|buff.incanters_flow.stack>3|talent.mirror_image.enabled)&artifact.phoenix_reborn.enabled&(4-charges_fractional)*13<cooldown.combustion.remains+5|target.time_to_die.remains<10
0.00 phoenixs_flames,if=(buff.combustion.up|buff.rune_of_power.up)&(4-charges_fractional)*30<cooldown.combustion.remains+5
0.00 scorch,if=target.health.pct<=25&equipped.132454
Q 173.30 fireball

Sample Sequence

01256CKGFEFJEFEFEGEGEQQQOMQQMQMQQQQOMQQOMQQQMOQMQM7QQKQQOMJQMQMQMOQMQMOQMQOMQQMQQMQQOMQQQQOMQQMQOMQQQQMQQ7MQQCKDEFEFJEEFEFEEQQQQQQQOMQQQQQ7OMQQMOQMQMKQOMJOQMOQMQMQMOQMQQQ7OMQMQMQMQQOMQMQQQQOMQQQQOMQ7MQQMQQQQCKEFEFJEFEFEGEQQQOMQQQQMQMQMOQMQMOQMQQQKQQQOMJQMQMOQ7MOQMQQQQOMQMQMQQOMQMQQQOMQM7QQQOMQQQQMQQQQFECJKFEFEGEGEGMQQOMQQQOMQQQQQOMQQQMQMOQMJKOMQQOMQMQOMQMQQMQOMQQQQPOMQQMQ

Sample Sequence Table

time name target resources buffs
Pre flask Lâstykökö 1155000.0/1155000: 100% mana
Pre food Lâstykökö 1155000.0/1155000: 100% mana
Pre augmentation Lâstykökö 1155000.0/1155000: 100% mana
Pre potion Fluffy_Pillow 1155000.0/1155000: 100% mana potion_of_deadly_grace
0:00.000 pyroblast Fluffy_Pillow 1127500.0/1155000: 98% mana potion_of_deadly_grace
0:00.000 combustion Fluffy_Pillow 1127500.0/1155000: 98% mana potion_of_deadly_grace
0:00.000 meteor Fluffy_Pillow 1017500.0/1155000: 88% mana combustion, potion_of_deadly_grace
0:01.223 phoenixs_flames Fluffy_Pillow 1023000.0/1155000: 89% mana bloodlust, combustion, potion_of_deadly_grace
0:02.218 fire_blast Fluffy_Pillow 1039500.0/1155000: 90% mana bloodlust, combustion, heating_up, pyretic_incantation, potion_of_deadly_grace
0:02.218 pyroblast Fluffy_Pillow 1028500.0/1155000: 89% mana bloodlust, combustion, hot_streak, pyretic_incantation(2), potion_of_deadly_grace
0:03.213 fire_blast Fluffy_Pillow 1017500.0/1155000: 88% mana bloodlust, combustion, heating_up, pyretic_incantation(3), potion_of_deadly_grace
0:03.213 flame_on Fluffy_Pillow 1006500.0/1155000: 87% mana bloodlust, combustion, hot_streak, pyretic_incantation(4), potion_of_deadly_grace
0:03.213 pyroblast Fluffy_Pillow 1006500.0/1155000: 87% mana bloodlust, combustion, hot_streak, pyretic_incantation(4), potion_of_deadly_grace
0:04.206 fire_blast Fluffy_Pillow 995500.0/1155000: 86% mana bloodlust, combustion, heating_up, pyretic_incantation(5), potion_of_deadly_grace
0:04.206 pyroblast Fluffy_Pillow 984500.0/1155000: 85% mana bloodlust, combustion, hot_streak, pyretic_incantation(5), potion_of_deadly_grace
0:05.201 fire_blast Fluffy_Pillow 973500.0/1155000: 84% mana bloodlust, combustion, heating_up, pyretic_incantation(5), potion_of_deadly_grace
0:05.201 pyroblast Fluffy_Pillow 962500.0/1155000: 83% mana bloodlust, combustion, hot_streak, pyretic_incantation(5), potion_of_deadly_grace
0:06.196 phoenixs_flames Fluffy_Pillow 951500.0/1155000: 82% mana bloodlust, combustion, heating_up, pyretic_incantation(5), potion_of_deadly_grace
0:07.191 pyroblast Fluffy_Pillow 968000.0/1155000: 84% mana bloodlust, combustion, hot_streak, pyretic_incantation(5), potion_of_deadly_grace
0:08.185 phoenixs_flames Fluffy_Pillow 957000.0/1155000: 83% mana bloodlust, combustion, heating_up, pyretic_incantation(5), potion_of_deadly_grace
0:09.179 pyroblast Fluffy_Pillow 973500.0/1155000: 84% mana bloodlust, combustion, hot_streak, pyretic_incantation(5), potion_of_deadly_grace
0:10.174 fireball Fluffy_Pillow 962500.0/1155000: 83% mana bloodlust, heating_up, pyretic_incantation(5), potion_of_deadly_grace
0:11.533 fireball Fluffy_Pillow 965250.0/1155000: 84% mana bloodlust, heating_up, pyretic_incantation(5), potion_of_deadly_grace
0:12.889 fireball Fluffy_Pillow 963875.0/1155000: 83% mana bloodlust, enhanced_pyrotechnics, potion_of_deadly_grace
0:14.245 fire_blast Fluffy_Pillow 962500.0/1155000: 83% mana bloodlust, heating_up, pyretic_incantation, potion_of_deadly_grace
0:14.245 pyroblast Fluffy_Pillow 951500.0/1155000: 82% mana bloodlust, hot_streak, pyretic_incantation(2), potion_of_deadly_grace
0:15.240 fireball Fluffy_Pillow 940500.0/1155000: 81% mana bloodlust, heating_up, potion_of_deadly_grace
0:16.596 fireball Fluffy_Pillow 943250.0/1155000: 82% mana bloodlust, heating_up, potion_of_deadly_grace
0:17.950 pyroblast Fluffy_Pillow 941875.0/1155000: 82% mana bloodlust, hot_streak, pyretic_incantation, potion_of_deadly_grace
0:18.945 fireball Fluffy_Pillow 930875.0/1155000: 81% mana bloodlust, hot_streak, pyretic_incantation(3), potion_of_deadly_grace
0:20.300 pyroblast Fluffy_Pillow 933625.0/1155000: 81% mana bloodlust, hot_streak, pyretic_incantation(3), potion_of_deadly_grace
0:21.293 fireball Fluffy_Pillow 922625.0/1155000: 80% mana bloodlust, enhanced_pyrotechnics, potion_of_deadly_grace
0:22.651 fireball Fluffy_Pillow 921250.0/1155000: 80% mana bloodlust, enhanced_pyrotechnics, potion_of_deadly_grace
0:24.007 fireball Fluffy_Pillow 924000.0/1155000: 80% mana bloodlust, enhanced_pyrotechnics(2)
0:25.363 fireball Fluffy_Pillow 922625.0/1155000: 80% mana bloodlust, enhanced_pyrotechnics(3)
0:26.718 fire_blast Fluffy_Pillow 921250.0/1155000: 80% mana bloodlust, heating_up, pyretic_incantation
0:26.718 pyroblast Fluffy_Pillow 910250.0/1155000: 79% mana bloodlust, hot_streak, pyretic_incantation(2)
0:27.712 fireball Fluffy_Pillow 899250.0/1155000: 78% mana bloodlust, enhanced_pyrotechnics
0:29.068 fireball Fluffy_Pillow 902000.0/1155000: 78% mana bloodlust, enhanced_pyrotechnics
0:30.425 fire_blast Fluffy_Pillow 900625.0/1155000: 78% mana bloodlust, heating_up, pyretic_incantation
0:30.425 pyroblast Fluffy_Pillow 889625.0/1155000: 77% mana bloodlust, hot_streak, pyretic_incantation(2)
0:31.419 fireball Fluffy_Pillow 878625.0/1155000: 76% mana bloodlust, enhanced_pyrotechnics
0:32.774 fireball Fluffy_Pillow 881375.0/1155000: 76% mana bloodlust, enhanced_pyrotechnics
0:34.130 fireball Fluffy_Pillow 880000.0/1155000: 76% mana bloodlust, heating_up, pyretic_incantation
0:35.486 pyroblast Fluffy_Pillow 878625.0/1155000: 76% mana bloodlust, hot_streak, pyretic_incantation(2)
0:36.480 fire_blast Fluffy_Pillow 867625.0/1155000: 75% mana bloodlust, heating_up
0:36.480 fireball Fluffy_Pillow 856625.0/1155000: 74% mana bloodlust, hot_streak, pyretic_incantation
0:37.834 pyroblast Fluffy_Pillow 859375.0/1155000: 74% mana bloodlust, hot_streak, pyretic_incantation
0:38.830 fireball Fluffy_Pillow 848375.0/1155000: 73% mana bloodlust, enhanced_pyrotechnics, hot_streak
0:40.185 pyroblast Fluffy_Pillow 847000.0/1155000: 73% mana bloodlust, enhanced_pyrotechnics, hot_streak
0:41.231 counterspell Fluffy_Pillow 836000.0/1155000: 72% mana enhanced_pyrotechnics(2)
0:41.231 fireball Fluffy_Pillow 814000.0/1155000: 70% mana enhanced_pyrotechnics(2)
0:42.991 fireball Fluffy_Pillow 820875.0/1155000: 71% mana enhanced_pyrotechnics(2)
0:44.751 meteor Fluffy_Pillow 831875.0/1155000: 72% mana heating_up, pyretic_incantation
0:46.291 fireball Fluffy_Pillow 845625.0/1155000: 73% mana enhanced_pyrotechnics
0:48.048 fireball Fluffy_Pillow 852500.0/1155000: 74% mana enhanced_pyrotechnics
0:49.807 fire_blast Fluffy_Pillow 859375.0/1155000: 74% mana heating_up, pyretic_incantation
0:49.807 pyroblast Fluffy_Pillow 848375.0/1155000: 73% mana hot_streak, pyretic_incantation(2)
0:51.100 flame_on Fluffy_Pillow 841500.0/1155000: 73% mana hot_streak, pyretic_incantation(4)
0:51.100 fireball Fluffy_Pillow 841500.0/1155000: 73% mana hot_streak, pyretic_incantation(4)
0:52.861 pyroblast Fluffy_Pillow 848375.0/1155000: 73% mana hot_streak, pyretic_incantation(4)
0:54.152 fireball Fluffy_Pillow 841500.0/1155000: 73% mana hot_streak, pyretic_incantation(5)
0:55.914 pyroblast Fluffy_Pillow 848375.0/1155000: 73% mana hot_streak, pyretic_incantation(5)
0:57.205 fireball Fluffy_Pillow 841500.0/1155000: 73% mana hot_streak, pyretic_incantation(5)
0:58.966 pyroblast Fluffy_Pillow 848375.0/1155000: 73% mana hot_streak, pyretic_incantation(5)
1:00.259 fire_blast Fluffy_Pillow 845625.0/1155000: 73% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
1:00.259 fireball Fluffy_Pillow 834625.0/1155000: 72% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation(2)
1:02.018 pyroblast Fluffy_Pillow 841500.0/1155000: 73% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation(2)
1:03.308 fireball Fluffy_Pillow 834625.0/1155000: 72% mana hot_streak, pyretic_incantation(4)
1:05.069 pyroblast Fluffy_Pillow 841500.0/1155000: 73% mana hot_streak, pyretic_incantation(4)
1:06.361 fire_blast Fluffy_Pillow 834625.0/1155000: 72% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
1:06.361 fireball Fluffy_Pillow 823625.0/1155000: 71% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation(2)
1:08.121 pyroblast Fluffy_Pillow 830500.0/1155000: 72% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation(2)
1:09.413 fireball Fluffy_Pillow 823625.0/1155000: 71% mana enhanced_pyrotechnics(2), heating_up, pyretic_incantation
1:11.174 fire_blast Fluffy_Pillow 830500.0/1155000: 72% mana enhanced_pyrotechnics(2), heating_up, pyretic_incantation
1:11.174 pyroblast Fluffy_Pillow 819500.0/1155000: 71% mana enhanced_pyrotechnics(2), hot_streak, pyretic_incantation(2)
1:12.466 fireball Fluffy_Pillow 812625.0/1155000: 70% mana enhanced_pyrotechnics(3), heating_up, pyretic_incantation
1:14.228 fireball Fluffy_Pillow 819500.0/1155000: 71% mana enhanced_pyrotechnics(3), heating_up, pyretic_incantation
1:15.988 pyroblast Fluffy_Pillow 826375.0/1155000: 72% mana hot_streak, pyretic_incantation(2)
1:17.278 fireball Fluffy_Pillow 823625.0/1155000: 71% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
1:19.039 fireball Fluffy_Pillow 830500.0/1155000: 72% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
1:20.799 pyroblast Fluffy_Pillow 837375.0/1155000: 73% mana hot_streak, pyretic_incantation(2)
1:22.092 fireball Fluffy_Pillow 830500.0/1155000: 72% mana enhanced_pyrotechnics
1:23.853 fireball Fluffy_Pillow 837375.0/1155000: 73% mana enhanced_pyrotechnics
1:25.613 fire_blast Fluffy_Pillow 844250.0/1155000: 73% mana heating_up, pyretic_incantation
1:25.613 pyroblast Fluffy_Pillow 833250.0/1155000: 72% mana hot_streak, pyretic_incantation(2)
1:26.904 fireball Fluffy_Pillow 826375.0/1155000: 72% mana enhanced_pyrotechnics
1:28.662 fireball Fluffy_Pillow 833250.0/1155000: 72% mana enhanced_pyrotechnics
1:30.424 fireball Fluffy_Pillow 840125.0/1155000: 73% mana heating_up, pyretic_incantation
1:32.184 fireball Fluffy_Pillow 847000.0/1155000: 73% mana enhanced_pyrotechnics
1:33.944 fire_blast Fluffy_Pillow 853875.0/1155000: 74% mana heating_up, pyretic_incantation
1:33.944 pyroblast Fluffy_Pillow 842875.0/1155000: 73% mana hot_streak, pyretic_incantation(2)
1:35.233 fireball Fluffy_Pillow 836000.0/1155000: 72% mana heating_up
1:36.993 fireball Fluffy_Pillow 842875.0/1155000: 73% mana heating_up
1:38.753 pyroblast Fluffy_Pillow 853875.0/1155000: 74% mana hot_streak, pyretic_incantation
1:40.044 fireball Fluffy_Pillow 847000.0/1155000: 73% mana heating_up
1:41.804 fire_blast Fluffy_Pillow 853875.0/1155000: 74% mana heating_up
1:41.804 pyroblast Fluffy_Pillow 842875.0/1155000: 73% mana hot_streak, pyretic_incantation
1:43.097 fireball Fluffy_Pillow 836000.0/1155000: 72% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
1:44.858 fireball Fluffy_Pillow 842875.0/1155000: 73% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
1:46.619 fireball Fluffy_Pillow 849750.0/1155000: 74% mana enhanced_pyrotechnics(2)
1:48.379 fireball Fluffy_Pillow 856625.0/1155000: 74% mana heating_up, pyretic_incantation
1:50.139 pyroblast Fluffy_Pillow 863500.0/1155000: 75% mana hot_streak, pyretic_incantation(2)
1:51.429 fireball Fluffy_Pillow 856625.0/1155000: 74% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
1:53.191 fireball Fluffy_Pillow 863500.0/1155000: 75% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
1:54.951 counterspell Fluffy_Pillow 870375.0/1155000: 75% mana hot_streak, pyretic_incantation(2)
1:54.951 pyroblast Fluffy_Pillow 848375.0/1155000: 73% mana hot_streak, pyretic_incantation(2)
1:56.242 fireball Fluffy_Pillow 841500.0/1155000: 73% mana heating_up
1:58.003 fireball Fluffy_Pillow 852500.0/1155000: 74% mana heating_up
1:59.765 combustion Fluffy_Pillow 859375.0/1155000: 74% mana hot_streak, pyretic_incantation
2:00.000 meteor Fluffy_Pillow 753500.0/1155000: 65% mana combustion, hot_streak, pyretic_incantation
2:01.292 potion Fluffy_Pillow 763125.0/1155000: 66% mana combustion, hot_streak, pyretic_incantation(2)
2:01.292 pyroblast Fluffy_Pillow 763125.0/1155000: 66% mana combustion, hot_streak, pyretic_incantation(2), potion_of_deadly_grace
2:02.582 fire_blast Fluffy_Pillow 756250.0/1155000: 65% mana combustion, heating_up, pyretic_incantation(3), potion_of_deadly_grace
2:02.582 pyroblast Fluffy_Pillow 745250.0/1155000: 65% mana combustion, hot_streak, pyretic_incantation(4), potion_of_deadly_grace
2:03.873 fire_blast Fluffy_Pillow 738375.0/1155000: 64% mana combustion, heating_up, pyretic_incantation(5), potion_of_deadly_grace
2:03.873 flame_on Fluffy_Pillow 727375.0/1155000: 63% mana combustion, hot_streak, pyretic_incantation(5), potion_of_deadly_grace
2:03.873 pyroblast Fluffy_Pillow 727375.0/1155000: 63% mana combustion, hot_streak, pyretic_incantation(5), potion_of_deadly_grace
2:05.163 pyroblast Fluffy_Pillow 720500.0/1155000: 62% mana combustion, hot_streak, pyretic_incantation(5), potion_of_deadly_grace
2:06.455 fire_blast Fluffy_Pillow 713625.0/1155000: 62% mana combustion, heating_up, pyretic_incantation(5), potion_of_deadly_grace
2:06.455 pyroblast Fluffy_Pillow 702625.0/1155000: 61% mana combustion, hot_streak, pyretic_incantation(5), potion_of_deadly_grace
2:07.746 fire_blast Fluffy_Pillow 695750.0/1155000: 60% mana combustion, heating_up, pyretic_incantation(5), potion_of_deadly_grace
2:07.746 pyroblast Fluffy_Pillow 684750.0/1155000: 59% mana combustion, hot_streak, pyretic_incantation(5), potion_of_deadly_grace
2:09.038 pyroblast Fluffy_Pillow 682000.0/1155000: 59% mana combustion, hot_streak, pyretic_incantation(5), potion_of_deadly_grace
2:10.329 fireball Fluffy_Pillow 675125.0/1155000: 58% mana heating_up, pyretic_incantation(5), potion_of_deadly_grace
2:12.089 fireball Fluffy_Pillow 682000.0/1155000: 59% mana heating_up, pyretic_incantation(5), potion_of_deadly_grace
2:13.849 fireball Fluffy_Pillow 688875.0/1155000: 60% mana enhanced_pyrotechnics, potion_of_deadly_grace
2:15.609 fireball Fluffy_Pillow 695750.0/1155000: 60% mana heating_up, pyretic_incantation, potion_of_deadly_grace
2:17.370 fireball Fluffy_Pillow 702625.0/1155000: 61% mana enhanced_pyrotechnics, potion_of_deadly_grace
2:19.132 fireball Fluffy_Pillow 709500.0/1155000: 61% mana enhanced_pyrotechnics(2), potion_of_deadly_grace
2:20.893 fireball Fluffy_Pillow 716375.0/1155000: 62% mana enhanced_pyrotechnics(3), potion_of_deadly_grace
2:22.654 fire_blast Fluffy_Pillow 723250.0/1155000: 63% mana heating_up, pyretic_incantation, potion_of_deadly_grace
2:22.654 pyroblast Fluffy_Pillow 712250.0/1155000: 62% mana hot_streak, pyretic_incantation(2), potion_of_deadly_grace
2:23.945 fireball Fluffy_Pillow 705375.0/1155000: 61% mana enhanced_pyrotechnics, heating_up, pyretic_incantation, potion_of_deadly_grace
2:25.707 fireball Fluffy_Pillow 712250.0/1155000: 62% mana enhanced_pyrotechnics, heating_up, pyretic_incantation, potion_of_deadly_grace
2:27.469 fireball Fluffy_Pillow 719125.0/1155000: 62% mana enhanced_pyrotechnics(2)
2:29.228 fireball Fluffy_Pillow 726000.0/1155000: 63% mana enhanced_pyrotechnics(3)
2:30.989 fireball Fluffy_Pillow 732875.0/1155000: 63% mana enhanced_pyrotechnics(4)
2:32.748 counterspell Fluffy_Pillow 739750.0/1155000: 64% mana heating_up, pyretic_incantation
2:32.748 fire_blast Fluffy_Pillow 717750.0/1155000: 62% mana heating_up, pyretic_incantation
2:32.748 pyroblast Fluffy_Pillow 706750.0/1155000: 61% mana hot_streak, pyretic_incantation(2)
2:34.042 fireball Fluffy_Pillow 704000.0/1155000: 61% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
2:35.799 fireball Fluffy_Pillow 710875.0/1155000: 62% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
2:37.559 pyroblast Fluffy_Pillow 717750.0/1155000: 62% mana hot_streak, pyretic_incantation(2)
2:38.851 fire_blast Fluffy_Pillow 710875.0/1155000: 62% mana heating_up
2:38.851 fireball Fluffy_Pillow 699875.0/1155000: 61% mana hot_streak, pyretic_incantation
2:40.612 pyroblast Fluffy_Pillow 706750.0/1155000: 61% mana hot_streak, pyretic_incantation
2:41.902 fireball Fluffy_Pillow 699875.0/1155000: 61% mana hot_streak, pyretic_incantation(3)
2:43.662 pyroblast Fluffy_Pillow 706750.0/1155000: 61% mana hot_streak, pyretic_incantation(3)
2:44.953 meteor Fluffy_Pillow 699875.0/1155000: 61% mana heating_up
2:46.291 fireball Fluffy_Pillow 713625.0/1155000: 62% mana heating_up
2:48.051 fire_blast Fluffy_Pillow 720500.0/1155000: 62% mana heating_up
2:48.051 pyroblast Fluffy_Pillow 709500.0/1155000: 61% mana hot_streak, pyretic_incantation
2:49.343 flame_on Fluffy_Pillow 702625.0/1155000: 61% mana heating_up
2:49.343 fire_blast Fluffy_Pillow 702625.0/1155000: 61% mana heating_up
2:49.343 fireball Fluffy_Pillow 691625.0/1155000: 60% mana hot_streak, pyretic_incantation
2:51.104 pyroblast Fluffy_Pillow 698500.0/1155000: 60% mana hot_streak, pyretic_incantation
2:52.396 fire_blast Fluffy_Pillow 691625.0/1155000: 60% mana heating_up
2:52.396 fireball Fluffy_Pillow 680625.0/1155000: 59% mana hot_streak, pyretic_incantation
2:54.156 pyroblast Fluffy_Pillow 687500.0/1155000: 60% mana hot_streak, pyretic_incantation
2:55.448 fireball Fluffy_Pillow 680625.0/1155000: 59% mana hot_streak, pyretic_incantation(3)
2:57.208 pyroblast Fluffy_Pillow 687500.0/1155000: 60% mana hot_streak, pyretic_incantation(3)
2:58.500 fireball Fluffy_Pillow 680625.0/1155000: 59% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation
3:00.260 pyroblast Fluffy_Pillow 691625.0/1155000: 60% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation
3:01.551 fire_blast Fluffy_Pillow 684750.0/1155000: 59% mana heating_up
3:01.551 fireball Fluffy_Pillow 673750.0/1155000: 58% mana hot_streak, pyretic_incantation
3:03.310 pyroblast Fluffy_Pillow 680625.0/1155000: 59% mana hot_streak, pyretic_incantation
3:04.601 fireball Fluffy_Pillow 673750.0/1155000: 58% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
3:06.361 fireball Fluffy_Pillow 680625.0/1155000: 59% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
3:08.121 fireball Fluffy_Pillow 687500.0/1155000: 60% mana enhanced_pyrotechnics(2)
3:09.882 counterspell Fluffy_Pillow 694375.0/1155000: 60% mana heating_up, pyretic_incantation
3:09.882 fire_blast Fluffy_Pillow 672375.0/1155000: 58% mana heating_up, pyretic_incantation
3:09.936 pyroblast Fluffy_Pillow 661375.0/1155000: 57% mana hot_streak, pyretic_incantation(2)
3:11.226 fireball Fluffy_Pillow 654500.0/1155000: 57% mana hot_streak, pyretic_incantation(4)
3:12.985 pyroblast Fluffy_Pillow 661375.0/1155000: 57% mana hot_streak, pyretic_incantation(4)
3:14.278 fireball Fluffy_Pillow 658625.0/1155000: 57% mana hot_streak, pyretic_incantation(5)
3:16.038 pyroblast Fluffy_Pillow 665500.0/1155000: 58% mana hot_streak, pyretic_incantation(5)
3:17.330 fireball Fluffy_Pillow 658625.0/1155000: 57% mana hot_streak, pyretic_incantation(5)
3:19.090 pyroblast Fluffy_Pillow 665500.0/1155000: 58% mana hot_streak, pyretic_incantation(5)
3:20.382 fireball Fluffy_Pillow 658625.0/1155000: 57% mana enhanced_pyrotechnics
3:22.144 fireball Fluffy_Pillow 665500.0/1155000: 58% mana enhanced_pyrotechnics
3:23.905 fire_blast Fluffy_Pillow 672375.0/1155000: 58% mana heating_up, pyretic_incantation
3:23.905 pyroblast Fluffy_Pillow 661375.0/1155000: 57% mana hot_streak, pyretic_incantation(2)
3:25.197 fireball Fluffy_Pillow 654500.0/1155000: 57% mana hot_streak, pyretic_incantation(4)
3:26.956 pyroblast Fluffy_Pillow 661375.0/1155000: 57% mana hot_streak, pyretic_incantation(4)
3:28.247 fireball Fluffy_Pillow 654500.0/1155000: 57% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
3:30.007 fireball Fluffy_Pillow 665500.0/1155000: 58% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
3:31.767 fireball Fluffy_Pillow 672375.0/1155000: 58% mana enhanced_pyrotechnics(2)
3:33.528 fireball Fluffy_Pillow 679250.0/1155000: 59% mana enhanced_pyrotechnics(3)
3:35.288 fire_blast Fluffy_Pillow 686125.0/1155000: 59% mana heating_up, pyretic_incantation
3:35.288 pyroblast Fluffy_Pillow 675125.0/1155000: 58% mana hot_streak, pyretic_incantation(2)
3:36.579 fireball Fluffy_Pillow 668250.0/1155000: 58% mana enhanced_pyrotechnics
3:38.340 fireball Fluffy_Pillow 675125.0/1155000: 58% mana enhanced_pyrotechnics
3:40.102 fireball Fluffy_Pillow 682000.0/1155000: 59% mana heating_up, pyretic_incantation
3:41.863 fireball Fluffy_Pillow 688875.0/1155000: 60% mana enhanced_pyrotechnics
3:43.623 fire_blast Fluffy_Pillow 695750.0/1155000: 60% mana heating_up, pyretic_incantation
3:43.623 pyroblast Fluffy_Pillow 684750.0/1155000: 59% mana hot_streak, pyretic_incantation(2)
3:44.915 fireball Fluffy_Pillow 677875.0/1155000: 59% mana hot_streak
3:46.675 counterspell Fluffy_Pillow 684750.0/1155000: 59% mana hot_streak
3:46.675 pyroblast Fluffy_Pillow 662750.0/1155000: 57% mana hot_streak
3:47.968 fireball Fluffy_Pillow 655875.0/1155000: 57% mana heating_up
3:49.729 fireball Fluffy_Pillow 662750.0/1155000: 57% mana heating_up
3:51.488 pyroblast Fluffy_Pillow 669625.0/1155000: 58% mana hot_streak, pyretic_incantation
3:52.780 fireball Fluffy_Pillow 666875.0/1155000: 58% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
3:54.540 fireball Fluffy_Pillow 673750.0/1155000: 58% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
3:56.302 fireball Fluffy_Pillow 680625.0/1155000: 59% mana enhanced_pyrotechnics(2)
3:58.062 fireball Fluffy_Pillow 687500.0/1155000: 60% mana heating_up, pyretic_incantation
3:59.824 combustion Fluffy_Pillow 694375.0/1155000: 60% mana hot_streak, pyretic_incantation(2)
4:00.000 meteor Fluffy_Pillow 588500.0/1155000: 51% mana combustion, hot_streak, pyretic_incantation(2)
4:01.293 pyroblast Fluffy_Pillow 598125.0/1155000: 52% mana combustion, hot_streak, pyretic_incantation(3)
4:02.583 fire_blast Fluffy_Pillow 591250.0/1155000: 51% mana combustion, heating_up, pyretic_incantation(4)
4:02.583 pyroblast Fluffy_Pillow 580250.0/1155000: 50% mana combustion, hot_streak, pyretic_incantation(5)
4:03.874 fire_blast Fluffy_Pillow 573375.0/1155000: 50% mana combustion, heating_up, pyretic_incantation(5)
4:03.874 flame_on Fluffy_Pillow 562375.0/1155000: 49% mana combustion, hot_streak, pyretic_incantation(5)
4:03.874 pyroblast Fluffy_Pillow 562375.0/1155000: 49% mana combustion, hot_streak, pyretic_incantation(5)
4:05.167 fire_blast Fluffy_Pillow 555500.0/1155000: 48% mana combustion, heating_up, pyretic_incantation(5)
4:05.167 pyroblast Fluffy_Pillow 544500.0/1155000: 47% mana combustion, hot_streak, pyretic_incantation(5)
4:06.458 fire_blast Fluffy_Pillow 537625.0/1155000: 47% mana combustion, heating_up, pyretic_incantation(5)
4:06.458 pyroblast Fluffy_Pillow 526625.0/1155000: 46% mana combustion, hot_streak, pyretic_incantation(5)
4:07.750 phoenixs_flames Fluffy_Pillow 519750.0/1155000: 45% mana combustion, heating_up, pyretic_incantation(5)
4:09.043 pyroblast Fluffy_Pillow 544500.0/1155000: 47% mana combustion, hot_streak, pyretic_incantation(5)
4:10.336 fireball Fluffy_Pillow 537625.0/1155000: 47% mana heating_up, pyretic_incantation(5)
4:12.097 fireball Fluffy_Pillow 544500.0/1155000: 47% mana heating_up, pyretic_incantation(5)
4:13.857 fireball Fluffy_Pillow 551375.0/1155000: 48% mana enhanced_pyrotechnics
4:15.618 fire_blast Fluffy_Pillow 558250.0/1155000: 48% mana heating_up, pyretic_incantation
4:15.618 pyroblast Fluffy_Pillow 547250.0/1155000: 47% mana hot_streak, pyretic_incantation(2)
4:16.910 fireball Fluffy_Pillow 540375.0/1155000: 47% mana heating_up
4:18.670 fireball Fluffy_Pillow 547250.0/1155000: 47% mana heating_up
4:20.432 fireball Fluffy_Pillow 554125.0/1155000: 48% mana enhanced_pyrotechnics
4:22.192 fireball Fluffy_Pillow 561000.0/1155000: 49% mana heating_up, pyretic_incantation
4:23.953 pyroblast Fluffy_Pillow 567875.0/1155000: 49% mana hot_streak, pyretic_incantation(2)
4:25.244 fireball Fluffy_Pillow 561000.0/1155000: 49% mana hot_streak, pyretic_incantation(4)
4:27.004 pyroblast Fluffy_Pillow 572000.0/1155000: 50% mana hot_streak, pyretic_incantation(4)
4:28.295 fireball Fluffy_Pillow 565125.0/1155000: 49% mana hot_streak, pyretic_incantation(5)
4:30.056 pyroblast Fluffy_Pillow 572000.0/1155000: 50% mana hot_streak, pyretic_incantation(5)
4:31.347 fire_blast Fluffy_Pillow 565125.0/1155000: 49% mana heating_up
4:31.347 fireball Fluffy_Pillow 554125.0/1155000: 48% mana hot_streak, pyretic_incantation
4:33.107 pyroblast Fluffy_Pillow 561000.0/1155000: 49% mana hot_streak, pyretic_incantation
4:34.398 fireball Fluffy_Pillow 554125.0/1155000: 48% mana hot_streak, pyretic_incantation(3)
4:36.158 pyroblast Fluffy_Pillow 561000.0/1155000: 49% mana hot_streak, pyretic_incantation(3)
4:37.448 fire_blast Fluffy_Pillow 554125.0/1155000: 48% mana heating_up
4:37.448 fireball Fluffy_Pillow 543125.0/1155000: 47% mana hot_streak, pyretic_incantation
4:39.208 pyroblast Fluffy_Pillow 550000.0/1155000: 48% mana hot_streak, pyretic_incantation
4:40.500 fireball Fluffy_Pillow 543125.0/1155000: 47% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
4:42.260 fireball Fluffy_Pillow 554125.0/1155000: 48% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
4:44.022 fireball Fluffy_Pillow 561000.0/1155000: 49% mana enhanced_pyrotechnics(2)
4:45.782 meteor Fluffy_Pillow 567875.0/1155000: 49% mana heating_up, pyretic_incantation
4:47.075 fireball Fluffy_Pillow 577500.0/1155000: 50% mana enhanced_pyrotechnics
4:48.835 fireball Fluffy_Pillow 584375.0/1155000: 51% mana enhanced_pyrotechnics
4:50.595 fireball Fluffy_Pillow 591250.0/1155000: 51% mana enhanced_pyrotechnics(2)
4:52.355 fire_blast Fluffy_Pillow 598125.0/1155000: 52% mana heating_up, pyretic_incantation
4:52.355 pyroblast Fluffy_Pillow 587125.0/1155000: 51% mana hot_streak, pyretic_incantation(2)
4:53.648 flame_on Fluffy_Pillow 580250.0/1155000: 50% mana hot_streak, pyretic_incantation(4)
4:53.648 fireball Fluffy_Pillow 580250.0/1155000: 50% mana hot_streak, pyretic_incantation(4)
4:55.410 pyroblast Fluffy_Pillow 587125.0/1155000: 51% mana hot_streak, pyretic_incantation(4)
4:56.700 fireball Fluffy_Pillow 580250.0/1155000: 50% mana hot_streak, pyretic_incantation(5)
4:58.458 pyroblast Fluffy_Pillow 587125.0/1155000: 51% mana hot_streak, pyretic_incantation(5)
4:59.749 fire_blast Fluffy_Pillow 580250.0/1155000: 50% mana heating_up
4:59.749 fireball Fluffy_Pillow 569250.0/1155000: 49% mana hot_streak, pyretic_incantation
5:01.510 counterspell Fluffy_Pillow 580250.0/1155000: 50% mana hot_streak, pyretic_incantation
5:01.510 pyroblast Fluffy_Pillow 558250.0/1155000: 48% mana hot_streak, pyretic_incantation
5:02.803 fire_blast Fluffy_Pillow 551375.0/1155000: 48% mana heating_up
5:02.803 fireball Fluffy_Pillow 540375.0/1155000: 47% mana hot_streak, pyretic_incantation
5:04.563 pyroblast Fluffy_Pillow 547250.0/1155000: 47% mana hot_streak, pyretic_incantation
5:05.855 fireball Fluffy_Pillow 540375.0/1155000: 47% mana heating_up
5:07.615 fireball Fluffy_Pillow 547250.0/1155000: 47% mana heating_up
5:09.374 fireball Fluffy_Pillow 554125.0/1155000: 48% mana enhanced_pyrotechnics
5:11.135 fireball Fluffy_Pillow 561000.0/1155000: 49% mana enhanced_pyrotechnics(2)
5:12.894 fire_blast Fluffy_Pillow 567875.0/1155000: 49% mana heating_up, pyretic_incantation
5:12.894 pyroblast Fluffy_Pillow 556875.0/1155000: 48% mana hot_streak, pyretic_incantation(2)
5:14.186 fireball Fluffy_Pillow 550000.0/1155000: 48% mana hot_streak, pyretic_incantation(4)
5:15.946 pyroblast Fluffy_Pillow 556875.0/1155000: 48% mana hot_streak, pyretic_incantation(4)
5:17.238 fireball Fluffy_Pillow 550000.0/1155000: 48% mana hot_streak, pyretic_incantation(5)
5:18.999 pyroblast Fluffy_Pillow 556875.0/1155000: 48% mana hot_streak, pyretic_incantation(5)
5:20.290 fireball Fluffy_Pillow 554125.0/1155000: 48% mana enhanced_pyrotechnics
5:22.050 fireball Fluffy_Pillow 561000.0/1155000: 49% mana enhanced_pyrotechnics
5:23.811 fire_blast Fluffy_Pillow 567875.0/1155000: 49% mana heating_up, pyretic_incantation
5:23.811 pyroblast Fluffy_Pillow 556875.0/1155000: 48% mana hot_streak, pyretic_incantation(2)
5:25.101 fireball Fluffy_Pillow 550000.0/1155000: 48% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation
5:26.860 pyroblast Fluffy_Pillow 556875.0/1155000: 48% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation
5:28.151 fireball Fluffy_Pillow 550000.0/1155000: 48% mana heating_up
5:29.913 fireball Fluffy_Pillow 556875.0/1155000: 48% mana heating_up
5:31.674 fireball Fluffy_Pillow 563750.0/1155000: 49% mana enhanced_pyrotechnics
5:33.433 fire_blast Fluffy_Pillow 570625.0/1155000: 49% mana heating_up, pyretic_incantation
5:33.433 pyroblast Fluffy_Pillow 559625.0/1155000: 48% mana hot_streak, pyretic_incantation(2)
5:34.725 fireball Fluffy_Pillow 552750.0/1155000: 48% mana hot_streak, pyretic_incantation(4)
5:36.484 pyroblast Fluffy_Pillow 559625.0/1155000: 48% mana hot_streak, pyretic_incantation(4)
5:37.775 counterspell Fluffy_Pillow 556875.0/1155000: 48% mana enhanced_pyrotechnics
5:37.775 fireball Fluffy_Pillow 534875.0/1155000: 46% mana enhanced_pyrotechnics
5:39.536 fireball Fluffy_Pillow 541750.0/1155000: 47% mana enhanced_pyrotechnics
5:41.297 fireball Fluffy_Pillow 548625.0/1155000: 48% mana enhanced_pyrotechnics(2)
5:43.059 fire_blast Fluffy_Pillow 555500.0/1155000: 48% mana heating_up, pyretic_incantation
5:43.059 pyroblast Fluffy_Pillow 544500.0/1155000: 47% mana hot_streak, pyretic_incantation(2)
5:44.352 fireball Fluffy_Pillow 537625.0/1155000: 47% mana heating_up
5:46.114 fireball Fluffy_Pillow 544500.0/1155000: 47% mana heating_up
5:47.875 fireball Fluffy_Pillow 551375.0/1155000: 48% mana enhanced_pyrotechnics
5:49.636 fireball Fluffy_Pillow 558250.0/1155000: 48% mana heating_up, pyretic_incantation
5:51.397 pyroblast Fluffy_Pillow 565125.0/1155000: 49% mana hot_streak, pyretic_incantation(2)
5:52.688 fireball Fluffy_Pillow 558250.0/1155000: 48% mana enhanced_pyrotechnics
5:54.449 fireball Fluffy_Pillow 565125.0/1155000: 49% mana enhanced_pyrotechnics
5:56.208 fireball Fluffy_Pillow 572000.0/1155000: 50% mana heating_up, pyretic_incantation
5:57.968 fireball Fluffy_Pillow 578875.0/1155000: 50% mana enhanced_pyrotechnics
5:59.729 fire_blast Fluffy_Pillow 585750.0/1155000: 51% mana heating_up, pyretic_incantation
5:59.729 pyroblast Fluffy_Pillow 574750.0/1155000: 50% mana hot_streak, pyretic_incantation(2)
6:01.019 combustion Fluffy_Pillow 572000.0/1155000: 50% mana heating_up
6:01.019 flame_on Fluffy_Pillow 462000.0/1155000: 40% mana combustion, heating_up
6:01.019 meteor Fluffy_Pillow 462000.0/1155000: 40% mana combustion, heating_up
6:02.311 fire_blast Fluffy_Pillow 471625.0/1155000: 41% mana combustion, heating_up
6:02.311 pyroblast Fluffy_Pillow 460625.0/1155000: 40% mana combustion, hot_streak, pyretic_incantation
6:03.602 fire_blast Fluffy_Pillow 453750.0/1155000: 39% mana combustion, heating_up, pyretic_incantation(2)
6:03.602 pyroblast Fluffy_Pillow 442750.0/1155000: 38% mana combustion, hot_streak, pyretic_incantation(3)
6:04.893 phoenixs_flames Fluffy_Pillow 435875.0/1155000: 38% mana combustion, heating_up, pyretic_incantation(4)
6:06.185 pyroblast Fluffy_Pillow 456500.0/1155000: 40% mana combustion, hot_streak, pyretic_incantation(5)
6:07.477 phoenixs_flames Fluffy_Pillow 449625.0/1155000: 39% mana combustion, heating_up, pyretic_incantation(5)
6:08.771 pyroblast Fluffy_Pillow 474375.0/1155000: 41% mana combustion, hot_streak, pyretic_incantation(5)
6:10.061 phoenixs_flames Fluffy_Pillow 467500.0/1155000: 40% mana combustion, heating_up, pyretic_incantation(5)
6:11.353 pyroblast Fluffy_Pillow 488125.0/1155000: 42% mana hot_streak, pyretic_incantation(5)
6:12.645 fireball Fluffy_Pillow 481250.0/1155000: 42% mana
6:14.406 fireball Fluffy_Pillow 488125.0/1155000: 42% mana
6:16.166 fire_blast Fluffy_Pillow 495000.0/1155000: 43% mana heating_up, pyretic_incantation
6:16.166 pyroblast Fluffy_Pillow 484000.0/1155000: 42% mana hot_streak, pyretic_incantation(2)
6:17.460 fireball Fluffy_Pillow 477125.0/1155000: 41% mana enhanced_pyrotechnics
6:19.221 fireball Fluffy_Pillow 484000.0/1155000: 42% mana enhanced_pyrotechnics
6:20.981 fireball Fluffy_Pillow 490875.0/1155000: 43% mana enhanced_pyrotechnics(2)
6:22.742 fire_blast Fluffy_Pillow 497750.0/1155000: 43% mana heating_up, pyretic_incantation
6:22.904 pyroblast Fluffy_Pillow 490875.0/1155000: 43% mana hot_streak, pyretic_incantation(2)
6:24.196 fireball Fluffy_Pillow 484000.0/1155000: 42% mana enhanced_pyrotechnics
6:25.956 fireball Fluffy_Pillow 490875.0/1155000: 43% mana enhanced_pyrotechnics
6:27.717 fireball Fluffy_Pillow 497750.0/1155000: 43% mana enhanced_pyrotechnics(2)
6:29.476 fireball Fluffy_Pillow 504625.0/1155000: 44% mana heating_up, pyretic_incantation
6:31.235 fireball Fluffy_Pillow 511500.0/1155000: 44% mana enhanced_pyrotechnics
6:32.996 fire_blast Fluffy_Pillow 518375.0/1155000: 45% mana heating_up, pyretic_incantation
6:33.200 pyroblast Fluffy_Pillow 511500.0/1155000: 44% mana hot_streak, pyretic_incantation(2)
6:34.491 fireball Fluffy_Pillow 504625.0/1155000: 44% mana
6:36.250 fireball Fluffy_Pillow 515625.0/1155000: 45% mana
6:38.011 fireball Fluffy_Pillow 522500.0/1155000: 45% mana heating_up, pyretic_incantation
6:39.771 pyroblast Fluffy_Pillow 529375.0/1155000: 46% mana hot_streak, pyretic_incantation(2)
6:41.062 fireball Fluffy_Pillow 522500.0/1155000: 45% mana hot_streak, pyretic_incantation(4)
6:42.821 pyroblast Fluffy_Pillow 529375.0/1155000: 46% mana hot_streak, pyretic_incantation(4)
6:44.115 fire_blast Fluffy_Pillow 522500.0/1155000: 45% mana heating_up
6:44.115 fireball Fluffy_Pillow 511500.0/1155000: 44% mana hot_streak, pyretic_incantation
6:45.875 pyroblast Fluffy_Pillow 518375.0/1155000: 45% mana hot_streak, pyretic_incantation
6:47.165 flame_on Fluffy_Pillow 511500.0/1155000: 44% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
6:47.165 meteor Fluffy_Pillow 511500.0/1155000: 44% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
6:48.458 fire_blast Fluffy_Pillow 521125.0/1155000: 45% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
6:48.458 pyroblast Fluffy_Pillow 510125.0/1155000: 44% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation(2)
6:49.751 fireball Fluffy_Pillow 507375.0/1155000: 44% mana enhanced_pyrotechnics
6:51.513 fireball Fluffy_Pillow 514250.0/1155000: 45% mana enhanced_pyrotechnics
6:53.273 fire_blast Fluffy_Pillow 521125.0/1155000: 45% mana heating_up, pyretic_incantation
6:53.273 pyroblast Fluffy_Pillow 510125.0/1155000: 44% mana hot_streak, pyretic_incantation(2)
6:54.565 fireball Fluffy_Pillow 503250.0/1155000: 44% mana enhanced_pyrotechnics, hot_streak
6:56.326 pyroblast Fluffy_Pillow 510125.0/1155000: 44% mana enhanced_pyrotechnics, hot_streak
6:57.619 fireball Fluffy_Pillow 503250.0/1155000: 44% mana enhanced_pyrotechnics(2), heating_up, pyretic_incantation
6:59.380 fire_blast Fluffy_Pillow 510125.0/1155000: 44% mana enhanced_pyrotechnics(2), heating_up, pyretic_incantation
6:59.380 pyroblast Fluffy_Pillow 499125.0/1155000: 43% mana enhanced_pyrotechnics(2), hot_streak, pyretic_incantation(2)
7:00.671 fireball Fluffy_Pillow 492250.0/1155000: 43% mana hot_streak, pyretic_incantation(4)
7:02.431 pyroblast Fluffy_Pillow 499125.0/1155000: 43% mana hot_streak, pyretic_incantation(4)
7:03.723 fireball Fluffy_Pillow 492250.0/1155000: 43% mana heating_up
7:05.483 fireball Fluffy_Pillow 499125.0/1155000: 43% mana heating_up
7:07.244 pyroblast Fluffy_Pillow 506000.0/1155000: 44% mana hot_streak, pyretic_incantation
7:08.537 fireball Fluffy_Pillow 503250.0/1155000: 44% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
7:10.298 fire_blast Fluffy_Pillow 510125.0/1155000: 44% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
7:10.298 pyroblast Fluffy_Pillow 499125.0/1155000: 43% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation(2)
7:11.588 fireball Fluffy_Pillow 492250.0/1155000: 43% mana enhanced_pyrotechnics(2)
7:13.349 fireball Fluffy_Pillow 499125.0/1155000: 43% mana enhanced_pyrotechnics(2)
7:15.109 fireball Fluffy_Pillow 506000.0/1155000: 44% mana heating_up, pyretic_incantation
7:16.871 fireball Fluffy_Pillow 512875.0/1155000: 44% mana enhanced_pyrotechnics
7:18.630 phoenixs_flames Fluffy_Pillow 519750.0/1155000: 45% mana enhanced_pyrotechnics(2)
7:19.920 fire_blast Fluffy_Pillow 540375.0/1155000: 47% mana enhanced_pyrotechnics(3), heating_up
7:19.920 pyroblast Fluffy_Pillow 529375.0/1155000: 46% mana enhanced_pyrotechnics(3), hot_streak, pyretic_incantation
7:21.214 fireball Fluffy_Pillow 522500.0/1155000: 45% mana enhanced_pyrotechnics(3), heating_up, pyretic_incantation(2)
7:22.975 fireball Fluffy_Pillow 529375.0/1155000: 46% mana enhanced_pyrotechnics(3), heating_up, pyretic_incantation(2)
7:24.734 pyroblast Fluffy_Pillow 536250.0/1155000: 46% mana hot_streak, pyretic_incantation(3)
7:26.024 fireball Fluffy_Pillow 533500.0/1155000: 46% mana enhanced_pyrotechnics

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4870 4545 0
Agility 6579 6254 0
Stamina 25112 25112 15297
Intellect 25136 23430 14984 (503)
Spirit 0 0 0
Health 1506720 1506720 0
Mana 1155000 1155000 0
Spell Power 25136 23430 0
Melee Crit 20.76% 19.69% 5142
Spell Crit 40.76% 24.69% 5142
Haste 16.55% 16.55% 5003
Damage / Heal Versatility 3.41% 3.41% 1364
ManaReg per Second 16500 16500 0
Mastery 16.57% 16.57% 4931
Armor 1474 1474 1474
Run Speed 8 0 0

Gear

Source Slot Average Item Level: 817.00
Local Head Cowl of Tirisgarde
ilevel: 810, stats: { 183 Armor, +1340 Sta, +894 Int, +659 Mastery, +466 Vers }
Local Neck Chain of the Underking
ilevel: 825, stats: { +867 Sta, +1003 Crit, +668 Mastery, +287 Avoidance }, enchant: { +75 Haste }
Local Shoulders Shoulderpads of Crashing Waves
ilevel: 810, stats: { 169 Armor, +670 Int, +1005 Sta, +530 Mastery, +313 Crit }
Local Shirt Precious' Ribbon
ilevel: 1
Local Chest Ravencourt Formal Robes
ilevel: 825, stats: { 238 Armor, +1028 Int, +1542 Sta, +748 Mastery, +441 Crit }
Local Waist Imbued Silkweave Cinch of the Fireflash
ilevel: 825, stats: { 134 Armor, +1157 Sta, +771 Int, +446 Crit, +446 Haste }
Local Legs Oakheart's Trunkwarmers
ilevel: 825, stats: { 208 Armor, +1541 Sta, +1028 Int, +748 Vers, +441 Haste }
Local Feet Slippers of Martyrdom
ilevel: 835, stats: { 170 Armor, +846 Int, +1269 Sta, +641 Haste, +284 Mastery }, gems: { +50 Haste }
Local Wrists Bracers of Tirisgarde
ilevel: 820, stats: { 102 Armor, +827 Sta, +552 Int, +455 Crit, +202 Mastery }, gems: { +50 Haste }
Local Hands Gloves of Tirisgarde
ilevel: 840, stats: { 157 Armor, +1329 Sta, +886 Int, +552 Crit, +391 Haste }
Local Finger1 Seal of Malicious Deceit
ilevel: 845, stats: { +1045 Sta, +1132 Haste, +669 Crit }, enchant: { +50 Crit }
Local Finger2 Empowered Ring of the Kirin Tor
ilevel: 850, stats: { +1094 Sta, +1180 Mastery, +655 Crit }, enchant: { +150 Vers }
Local Trinket1 Bane of the Darklady
ilevel: 680, stats: { +253 Int, +253 Crit }
Local Trinket2 An'she's Infusion of Light
ilevel: 820, stats: { +933 Int, +834 Haste }
Local Back Drape of the Raven Lord
ilevel: 810, stats: { 113 Armor, +503 StrAgiInt, +754 Sta, +406 Mastery, +226 Haste, +271 Avoidance }, enchant: { +100 Crit }
Local Main Hand Felo'melorn
ilevel: 825, weapon: { 1305 - 2425, 2.6 }, stats: { +440 Int, +660 Sta, +254 Haste, +254 Mastery, +5602 Int }, relics: { +39 ilevels, +36 ilevels }
Local Off Hand Heart of the Phoenix
ilevel: 825, stats: { +578 Int, +867 Sta, +463 Haste, +205 Crit }
Local Tabard Renowned Guild Tabard
ilevel: 1

Talents

Level
15 Pyromaniac (Fire Mage) Conflagration (Fire Mage) Firestarter (Fire Mage)
30 Shimmer Cauterize Cold Snap
45 Mirror Image Rune of Power Incanter's Flow
60 Blast Wave (Fire Mage) Flame On (Fire Mage) Controlled Burn (Fire Mage)
75 Ice Floes Ring of Frost Ice Ward
90 Living Bomb (Fire Mage) Unstable Magic Flame Patch (Fire Mage)
100 Kindling (Fire Mage) Cinderstorm (Fire Mage) Meteor (Fire Mage)

Profile

mage="Lâstykökö"
origin="https://eu.api.battle.net/wow/character/hyjal/Lâstykökö/advanced"
thumbnail="http://eu.battle.net/static-render/eu/hyjal/105/115117161-avatar.jpg"
level=110
race=gnome
role=spell
position=back
professions=tailoring=769/inscription=719
talents=http://eu.battle.net/wow/en/tool/talent-calculator#eZ!0121012
artifact=54:0:0:0:0:748:1:749:3:751:3:754:3:755:1:756:3:759:1:763:1:1340:1
spec=fire

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_whispered_pact
actions.precombat+=/food,type=the_hungry_magister
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/pyroblast

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/time_warp,if=target.health.pct<25|time=0
actions+=/shard_of_the_exodar_warp,if=buff.bloodlust.down
actions+=/mirror_image,if=buff.combustion.down
actions+=/rune_of_power,if=cooldown.combustion.remains>40&buff.combustion.down&(cooldown.flame_on.remains<5|cooldown.flame_on.remains>30)&!talent.kindling.enabled|target.time_to_die.remains<11|talent.kindling.enabled&(charges_fractional>1.8|time<40)&cooldown.combustion.remains>40
actions+=/call_action_list,name=combustion_phase,if=cooldown.combustion.remains<=action.rune_of_power.cast_time+(!talent.kindling.enabled*gcd)|buff.combustion.up
actions+=/call_action_list,name=rop_phase,if=buff.rune_of_power.up&buff.combustion.down
actions+=/call_action_list,name=single_target

actions.combustion_phase=rune_of_power,if=buff.combustion.down
actions.combustion_phase+=/call_action_list,name=active_talents
actions.combustion_phase+=/combustion
actions.combustion_phase+=/potion,name=deadly_grace
actions.combustion_phase+=/blood_fury
actions.combustion_phase+=/berserking
actions.combustion_phase+=/arcane_torrent
actions.combustion_phase+=/pyroblast,if=buff.hot_streak.up
actions.combustion_phase+=/fire_blast,if=buff.heating_up.up
actions.combustion_phase+=/phoenixs_flames
actions.combustion_phase+=/scorch,if=buff.combustion.remains>cast_time
actions.combustion_phase+=/scorch,if=target.health.pct<=25&equipped.132454

actions.rop_phase=rune_of_power
actions.rop_phase+=/pyroblast,if=buff.hot_streak.up
actions.rop_phase+=/call_action_list,name=active_talents
actions.rop_phase+=/pyroblast,if=buff.kaelthas_ultimate_ability.react
actions.rop_phase+=/fire_blast,if=!prev_off_gcd.fire_blast
actions.rop_phase+=/phoenixs_flames,if=!prev_gcd.phoenixs_flames
actions.rop_phase+=/scorch,if=target.health.pct<=25&equipped.132454
actions.rop_phase+=/fireball

actions.active_talents=flame_on,if=action.fire_blast.charges=0&(cooldown.combustion.remains>40+(talent.kindling.enabled*25)|target.time_to_die.remains<cooldown.combustion.remains)
actions.active_talents+=/blast_wave,if=(buff.combustion.down)|(buff.combustion.up&action.fire_blast.charges<1&action.phoenixs_flames.charges<1)
actions.active_talents+=/meteor,if=cooldown.combustion.remains>30|(cooldown.combustion.remains>target.time_to_die)|buff.rune_of_power.up
actions.active_talents+=/cinderstorm,if=cooldown.combustion.remains<cast_time&(buff.rune_of_power.up|!talent.rune_on_power.enabled)|cooldown.combustion.remains>10*spell_haste&!buff.combustion.up
actions.active_talents+=/dragons_breath,if=equipped.132863
actions.active_talents+=/living_bomb,if=active_enemies>3&buff.combustion.down

actions.single_target=pyroblast,if=buff.hot_streak.up&buff.hot_streak.remains<action.fireball.execute_time
actions.single_target+=/phoenixs_flames,if=charges_fractional>2.7&active_enemies>2
actions.single_target+=/flamestrike,if=talent.flame_patch.enabled&active_enemies>2&buff.hot_streak.react
actions.single_target+=/pyroblast,if=buff.hot_streak.up&!prev_gcd.pyroblast
actions.single_target+=/pyroblast,if=buff.hot_streak.react&target.health.pct<=25&equipped.132454
actions.single_target+=/pyroblast,if=buff.kaelthas_ultimate_ability.react
actions.single_target+=/call_action_list,name=active_talents
actions.single_target+=/fire_blast,if=!talent.kindling.enabled&buff.heating_up.up&(!talent.rune_of_power.enabled|charges_fractional>1.4|cooldown.combustion.remains<40)&(3-charges_fractional)*(12*spell_haste)<cooldown.combustion.remains+3|target.time_to_die.remains<4
actions.single_target+=/fire_blast,if=talent.kindling.enabled&buff.heating_up.up&(!talent.rune_of_power.enabled|charges_fractional>1.5|cooldown.combustion.remains<40)&(3-charges_fractional)*(18*spell_haste)<cooldown.combustion.remains+3|target.time_to_die.remains<4
actions.single_target+=/phoenixs_flames,if=(buff.combustion.up|buff.rune_of_power.up|buff.incanters_flow.stack>3|talent.mirror_image.enabled)&artifact.phoenix_reborn.enabled&(4-charges_fractional)*13<cooldown.combustion.remains+5|target.time_to_die.remains<10
actions.single_target+=/phoenixs_flames,if=(buff.combustion.up|buff.rune_of_power.up)&(4-charges_fractional)*30<cooldown.combustion.remains+5
actions.single_target+=/scorch,if=target.health.pct<=25&equipped.132454
actions.single_target+=/fireball

head=cowl_of_tirisgarde,id=139749,bonus_id=3385/3381
neck=chain_of_the_underking,id=134495,bonus_id=1726/40/1477,enchant=75haste
shoulders=shoulderpads_of_crashing_waves,id=137360,bonus_id=1826/1462/3339
back=drape_of_the_raven_lord,id=136770,bonus_id=1826/40/1462/3339,enchant=gift_of_critical_strike
chest=ravencourt_formal_robes,id=139246,bonus_id=1726/1477
shirt=precious_ribbon,id=52019
tabard=renowned_guild_tabard,id=69210
wrists=bracers_of_tirisgarde,id=139754,bonus_id=3386/3382,gems=50haste
hands=gloves_of_tirisgarde,id=139748,bonus_id=3386/3384
waist=imbued_silkweave_cinch,id=127001,bonus_id=689/1693/3408/601/598
legs=oakhearts_trunkwarmers,id=137304,bonus_id=1726/1477
feet=slippers_of_martyrdom,id=134417,bonus_id=1726/1808/1487/3339,gems=50haste
finger1=seal_of_malicious_deceit,id=134489,bonus_id=1727/1497/3336,enchant=50crit
finger2=empowered_ring_of_the_kirin_tor,id=139599,enchant=150vers
trinket1=bane_of_the_darklady,id=129259,bonus_id=1793
trinket2=anshes_infusion_of_light,id=139114,bonus_id=3395/604/1482/1675
main_hand=felomelorn,id=128820,gem_id=133686/141266/0/0,relic_id=1726:1487:3339/3396:1487:1675/0/0
off_hand=heart_of_the_phoenix,id=133959

# Gear Summary
# gear_ilvl=816.88
# gear_stamina=15297
# gear_intellect=14984
# gear_crit_rating=5142
# gear_haste_rating=5003
# gear_mastery_rating=4931
# gear_versatility_rating=1364
# gear_avoidance_rating=558
# gear_armor=1474
# set_bonus=tier19oh_2pc=1

Ehöl

Ehöl : 229196 dps

  • Race: Night Elf
  • Class: Monk
  • Spec: Windwalker
  • Level: 110
  • Role: Dps
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
229195.9 229195.9 98.3 / 0.043% 19713.9 / 8.6% 16435.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
11.3 11.3 Energy 12.63% 42.9 100.0% 100%
Origin https://eu.api.battle.net/wow/character/hyjal/Ehöl/advanced
Talents
  • 15: Chi Wave
  • 30: Tiger's Lust
  • 45: Energizing Elixir (Windwalker Monk)
  • 60: Leg Sweep
  • 75: Healing Elixir
  • 90: Hit Combo (Windwalker Monk)
  • 100: Whirling Dragon Punch (Windwalker Monk)
  • Talent Calculator
Artifact
Professions
  • alchemy: 600
  • enchanting: 607

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Ehöl 229196
Blackout Kick 24237 10.6% 76.3 5.78sec 143213 142573 Direct 76.3 112076 224109 143215 27.8% 0.0%  

Stats details: blackout_kick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.28 76.28 0.00 0.00 1.0045 0.0000 10924196.23 16059603.22 31.98 142572.58 142572.58
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 55.08 72.21% 112076.18 58186 123106 112021.50 103670 120692 6172848 9074671 31.98
crit 21.20 27.79% 224109.26 116747 246213 224004.14 170196 246213 4751348 6984932 31.98
 
 

Action details: blackout_kick

Static Values
  • id:100784
  • school:physical
  • resource:chi
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:3.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:chi.max-chi<=1&cooldown.chi_brew.up|buff.serenity.up
Spelldata
  • id:100784
  • name:Blackout Kick
  • school:physical
  • tooltip:
  • description:Kick with a blast of Chi energy, dealing {$s1=0} Physical damage.
 
Chi Wave 0 (9803) 0.0% (4.3%) 28.5 16.02sec 154715 154024

Stats details: chi_wave

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.54 0.00 226.55 0.00 1.0045 0.8740 0.00 0.00 0.00 19481.07 154024.21
 
 

Action details: chi_wave

Static Values
  • id:115098
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:energy.time_to_max>2|buff.serenity.down
Spelldata
  • id:115098
  • name:Chi Wave
  • school:nature
  • tooltip:
  • description:A wave of Chi energy flows through friends and foes, dealing $<damage> Nature damage or $<healing> healing. Bounces up to {$115098s1=7} times to targets within $132466a2 yards.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:7.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Chi Wave (_damage) 9803 4.3% 113.4 3.97sec 38943 0 Periodic 113.4 30533 61037 38955 27.6% 0.0% 0.0%

Stats details: chi_wave_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 113.40 0.00 0.00 113.37 0.0000 0.0000 4416182.14 4416182.14 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 82.1 72.39% 30532.95 14301 33964 30521.15 28621 32341 2505669 2505669 0.00
crit 31.3 27.61% 61037.27 28601 67929 61016.16 50947 67929 1910514 1910514 0.00
 
 

Action details: chi_wave_damage

Static Values
  • id:132467
  • school:nature
  • resource:none
  • range:50000.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:132467
  • name:Chi Wave
  • school:nature
  • tooltip:
  • description:{$@spelldesc115098=A wave of Chi energy flows through friends and foes, dealing $<damage> Nature damage or $<healing> healing. Bounces up to {$115098s1=7} times to targets within $132466a2 yards.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.867000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Deadly Grace 3382 1.5% 23.8 6.31sec 63056 0 Direct 23.8 49421 98851 63056 27.6% 0.0%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.79 23.79 0.00 0.00 0.0000 0.0000 1499958.35 1499958.35 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.23 72.41% 49420.73 32241 71923 49410.55 35497 62313 851278 851278 0.00
crit 6.56 27.59% 98850.56 64483 143846 98733.10 0 143846 648681 648681 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:5.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=47572 to 71358} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:47572.00
  • base_dd_max:71358.00
 
Fists of Fury 42706 18.7% 21.1 21.66sec 913237 248790 Periodic 104.9 143654 287388 183339 27.6% 0.0% 16.0%

Stats details: fists_of_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.06 0.00 104.91 104.91 3.6707 0.6863 19233686.02 28275340.31 31.98 248789.74 248789.74
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.9 72.39% 143654.14 74760 167874 143574.50 131393 155789 10909206 16037566 31.98
crit 29.0 27.61% 287388.39 149998 335747 287265.95 227055 329492 8324480 12237774 31.98
 
 

Action details: fists_of_fury

Static Values
  • id:113656
  • school:physical
  • resource:chi
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3.0
  • secondary_cost:0.0
  • cooldown:24.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:113656
  • name:Fists of Fury
  • school:physical
  • tooltip:$w3 damage every $t3 sec. $?s125671[Parrying all attacks.][]
  • description:Pummels all targets in front of you, dealing ${5*{$s5=0}} damage over {$113656d=4 seconds}. Can be channeled while moving.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: fists_of_fury_tick

Static Values
  • id:117418
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:117418
  • name:Fists of Fury
  • school:physical
  • tooltip:
  • description:{$@spelldesc113656=Pummels all targets in front of you, dealing ${5*{$s5=0}} damage over {$113656d=4 seconds}. Can be channeled while moving.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:5.250000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
melee_main_hand 6562 2.9% 164.1 2.76sec 18011 8056 Direct 164.1 16578 33165 18011 27.6% 19.0%  

Stats details: melee_main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 164.13 164.13 0.00 0.00 2.2355 0.0000 2956059.35 4345687.25 31.98 8056.46 8056.46
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 87.58 53.36% 16578.40 8101 18583 16567.34 15213 17739 1451858 2134368 31.98
crit 45.35 27.63% 33165.24 16202 37167 33143.07 28281 36672 1504202 2211319 31.98
miss 31.20 19.01% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
melee_off_hand 3266 1.4% 163.1 2.76sec 9019 4022 Direct 163.1 8295 16590 9019 27.7% 19.0%  

Stats details: melee_off_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 163.13 163.13 0.00 0.00 2.2422 0.0000 1471232.71 2162851.44 31.98 4022.37 4022.37
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 86.96 53.31% 8295.18 4050 9292 8290.11 7510 8916 721329 1060422 31.98
crit 45.20 27.71% 16589.55 8101 18583 16578.39 14402 18322 749904 1102429 31.98
miss 30.97 18.98% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: melee_off_hand

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Rising Sun Kick 29407 12.9% 42.2 10.61sec 313771 312369 Direct 42.2 245364 491281 313774 27.8% 0.0%  

Stats details: rising_sun_kick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.23 42.23 0.00 0.00 1.0045 0.0000 13251328.56 19480708.18 31.98 312369.26 312369.26
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.48 72.18% 245363.50 126441 278854 245152.22 220110 269709 7479752 10995944 31.98
crit 11.75 27.82% 491280.85 253691 557709 490968.15 314242 557709 5771576 8484764 31.98
 
 

Action details: rising_sun_kick

Static Values
  • id:107428
  • school:physical
  • resource:chi
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:107428
  • name:Rising Sun Kick
  • school:physical
  • tooltip:
  • description:Kick upwards, dealing {$185099s1=0} damage{$?s128595=false}[, and reducing the effectiveness of healing on the target for {$115804d=10 seconds}][].
 
Shadow Wave 5993 2.6% 18.9 21.42sec 142916 0 Direct 18.9 111937 223686 142914 27.7% 0.0%  

Stats details: shadow_wave

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.88 18.88 0.00 0.00 0.0000 0.0000 2698742.35 2698742.35 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.65 72.28% 111936.77 56321 125638 111951.10 72928 125638 1527819 1527819 0.00
crit 5.23 27.72% 223686.07 112641 251277 222094.73 0 251277 1170923 1170923 0.00
 
 

Action details: shadow_wave

Static Values
  • id:215047
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215047
  • name:Shadow Wave
  • school:shadow
  • tooltip:
  • description:{$@spelldesc215089=Your melee attacks have a chance to unleash 4 Shadow Waves that deal {$s1=78543} Shadow damage to enemies in their path. The waves travel 15 yards away from you, and then return.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:103875.90
  • base_dd_max:103875.90
 
Strike of the Windlord 13389 (20078) 5.8% (8.8%) 11.2 41.60sec 804093 534477 Direct 11.2 419471 841372 536126 27.7% 0.0%  

Stats details: strike_of_the_windlord

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.24 11.24 0.00 0.00 1.5045 0.0000 6028090.25 8861863.67 31.98 534477.28 534477.28
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.13 72.35% 419470.76 247329 555040 419264.94 263008 555040 3412009 5015976 31.98
crit 3.11 27.65% 841371.89 493509 1110080 818743.80 0 1110080 2616081 3845888 31.10
 
 

Action details: strike_of_the_windlord

Static Values
  • id:205320
  • school:physical
  • resource:chi
  • range:9.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:40.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205320
  • name:Strike of the Windlord
  • school:physical
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Strike with both |cFFFFCC99Fists of the Heavens|r at all enemies in front of you, dealing ${$222029sw1+$205414sw1} damage and reducing movement speed by {$s2=50}% for {$d=6 seconds}.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:22.50
 
    Strike of the Windlord (_offhand) 6689 2.9% 0.0 0.00sec 0 0 Direct 11.2 209780 420453 267941 27.6% 0.0%  

Stats details: strike_of_the_windlord_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 11.24 0.00 0.00 0.0000 0.0000 3012593.00 4428797.07 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.14 72.39% 209780.17 123665 277520 209703.65 133923 277520 1707457 2510123 31.98
crit 3.10 27.61% 420452.90 246755 555040 409073.20 0 555040 1305136 1918674 31.09
 
 

Action details: strike_of_the_windlord_offhand

Static Values
  • id:205414
  • school:physical
  • resource:none
  • range:12.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205414
  • name:Strike of the Windlord
  • school:physical
  • tooltip:
  • description:{$@spelldesc205320=Strike with both |cFFFFCC99Fists of the Heavens|r at all enemies in front of you, dealing ${$222029sw1+$205414sw1} damage and reducing movement speed by {$s2=50}% for {$d=6 seconds}.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:22.50
 
Tiger Palm 7958 3.5% 101.4 4.44sec 35357 35199 Direct 101.4 27698 55377 35357 27.7% 0.0%  

Stats details: tiger_palm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 101.40 101.40 0.00 0.00 1.0045 0.0000 3585329.62 5270774.15 31.98 35198.60 35198.60
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.35 72.33% 27697.95 13208 30778 27683.71 25808 29293 2031526 2986535 31.98
crit 28.06 27.67% 55377.31 26416 61556 55346.20 45141 61556 1553804 2284239 31.98
 
 

Action details: tiger_palm

Static Values
  • id:100780
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:chi.max-chi>=2&!buff.serenity.up
Spelldata
  • id:100780
  • name:Tiger Palm
  • school:physical
  • tooltip:
  • description:Attack with the palm of your hand, dealing {$s1=1} damage.$?a137025[ Tiger Palm has an $137384m1% chance to make your next Blackout Kick cost no Chi.][]$?a137023[ Reduces the remaining cooldown on your Brews by {$s3=1} sec.][]$?a137025[ |cFFFFFFFFGenerates {$s2=1} Chi.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.050000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Touch of Death 9815 (13568) 4.3% (5.9%) 3.7 145.16sec 1642646 1635710 Periodic 3.6 1209244 0 1209244 0.0% 0.0% 6.5%

Stats details: touch_of_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.71 0.00 3.65 3.65 1.0045 8.0000 4410915.82 0.00 0.00 185158.73 1635709.58
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.6 100.00% 1209243.75 1209244 1209244 1209243.75 1209244 1209244 4410916 0 0.00
 
 

Action details: touch_of_death

Static Values
  • id:115080
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!artifact.gale_burst.enabled
Spelldata
  • id:115080
  • name:Touch of Death
  • school:physical
  • tooltip:Taking $w1 damage when this effect expires.
  • description:Use ancient Pandaren knowledge of anatomy to inflict mortal damage on an enemy. After {$d=8 seconds}, the target will take damage equal to your maximum health, reduced against players.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:8.00
  • base_tick_time:8.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Gale Burst 3753 1.6% 3.7 136.38sec 453486 0 Direct 3.7 454395 0 454395 0.0% 0.0%  

Stats details: gale_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.71 3.70 0.00 0.00 0.0000 0.0000 1682102.37 1682102.37 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.70 100.00% 454395.17 2732 900190 456511.28 245719 682836 1682102 1682102 0.00
 
 

Action details: gale_burst

Static Values
  • id:195403
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:195403
  • name:Gale Burst
  • school:physical
  • tooltip:
  • description:{$@spelldesc195399=Increases damage done by Touch of Death by {$s1=10}% of all damage you dealt to the target during the duration.}
 
Whirling Dragon Punch 18121 7.9% 20.7 21.83sec 393953 225240 Periodic 62.1 102967 205925 131452 27.7% 0.0% 3.0%

Stats details: whirling_dragon_punch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.71 0.00 62.08 62.08 1.7491 0.2170 8160439.97 11996619.74 31.98 225239.86 225239.86
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 44.9 72.33% 102966.92 51200 110582 102937.86 90841 110582 4623560 6797072 31.98
crit 17.2 27.67% 205925.45 102400 221165 205905.12 132699 221165 3536880 5199548 31.98
 
 

Action details: whirling_dragon_punch

Static Values
  • id:152175
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:24.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:152175
  • name:Whirling Dragon Punch
  • school:physical
  • tooltip:
  • description:Performs a devastating whirling upward strike, dealing ${3*{$158221s1=0}} damage to all nearby enemies. Only usable while Fists of Fury and Rising Sun Kick are on cooldown.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:1.00
  • base_tick_time:0.25
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: whirling_dragon_punch_tick

Static Values
  • id:158221
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:158221
  • name:Whirling Dragon Punch
  • school:physical
  • tooltip:
  • description:{$@spelldesc152175=Performs a devastating whirling upward strike, dealing ${3*{$158221s1=0}} damage to all nearby enemies. Only usable while Fists of Fury and Rising Sun Kick are on cooldown.}
 
pet - fire_spirit 104510 / 22054
auto_attack_mh 4620 0.4% 41.8 10.08sec 10449 4934 Direct 41.8 9619 19235 10449 27.7% 19.1%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.82 41.82 0.00 0.00 2.1180 0.0000 436954.26 642364.15 31.98 4933.60 4933.60
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 22.26 53.22% 9618.59 8675 10082 9618.54 9293 9910 214064 314694 31.98
crit 11.59 27.71% 19235.34 17313 20164 19234.12 18118 20164 222891 327670 31.98
miss 7.97 19.07% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 2310 0.2% 41.8 10.08sec 5223 2466 Direct 41.8 4809 9618 5223 27.7% 19.1%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.82 41.82 0.00 0.00 2.1180 0.0000 218423.88 321103.80 31.98 2466.20 2466.20
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 22.24 53.18% 4809.35 4328 5041 4809.36 4641 4992 106945 157219 31.98
crit 11.59 27.72% 9617.78 8675 10082 9617.67 9011 10082 111479 163885 31.98
miss 7.99 19.10% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Blackout Kick 10632 1.0% 13.6 31.66sec 74118 0 Direct 13.6 58053 116100 74117 27.7% 0.0%  

Stats details: blackout_kick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.57 13.57 0.00 0.00 0.0000 0.0000 1005771.87 1478579.92 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.81 72.33% 58053.26 53137 61553 58054.05 55519 60712 569765 837609 31.98
crit 3.76 27.67% 116099.64 106275 123106 114320.29 0 123106 436007 640971 31.48
 
 

Action details: blackout_kick

Static Values
  • id:100784
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:100784
  • name:Blackout Kick
  • school:physical
  • tooltip:
  • description:Kick with a blast of Chi energy, dealing {$s1=0} Physical damage.
 
Chi Wave (_damage) 5557 0.5% 0.0 0.00sec 0 0 Direct 23.2 17802 35686 22748 27.7% 0.0%  

Stats details: chi_wave_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 23.15 0.00 0.00 0.0000 0.0000 526643.64 526643.64 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.75 72.34% 17802.19 14026 29280 17775.33 15228 24288 298149 298149 0.00
crit 6.40 27.66% 35685.52 28051 58559 35576.54 0 58559 228495 228495 0.00
 
 

Action details: chi_wave_damage

Static Values
  • id:132467
  • school:nature
  • resource:none
  • range:50000.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:132467
  • name:Chi Wave
  • school:nature
  • tooltip:
  • description:{$@spelldesc115098=A wave of Chi energy flows through friends and foes, dealing $<damage> Nature damage or $<healing> healing. Bounces up to {$115098s1=7} times to targets within $132466a2 yards.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Fists of Fury 32184 3.0% 6.1 77.79sec 501050 157706 Periodic 29.7 80440 160906 102661 27.6% 0.0% 4.3%

Stats details: fists_of_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.08 0.00 29.68 29.68 3.1773 0.6510 3046887.40 4479213.09 31.98 157706.39 157706.39
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 21.5 72.38% 80439.81 73806 83937 80454.38 76075 83546 1727985 2540301 31.98
crit 8.2 27.62% 160906.09 147613 167874 160896.63 0 167874 1318903 1938912 31.97
 
 

Action details: fists_of_fury

Static Values
  • id:113656
  • school:physical
  • resource:chi
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:113656
  • name:Fists of Fury
  • school:physical
  • tooltip:$w3 damage every $t3 sec. $?s125671[Parrying all attacks.][]
  • description:Pummels all targets in front of you, dealing ${5*{$s5=0}} damage over {$113656d=4 seconds}. Can be channeled while moving.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:4.00
  • base_tick_time:0.17
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: fists_of_fury_tick

Static Values
  • id:117418
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:117418
  • name:Fists of Fury
  • school:physical
  • tooltip:
  • description:{$@spelldesc113656=Pummels all targets in front of you, dealing ${5*{$s5=0}} damage over {$113656d=4 seconds}. Can be channeled while moving.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Rising Sun Kick 17714 1.6% 10.0 44.33sec 167258 0 Direct 10.0 131001 262110 167259 27.7% 0.0%  

Stats details: rising_sun_kick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.00 10.00 0.00 0.00 0.0000 0.0000 1673001.56 2459470.76 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.24 72.35% 131001.19 122600 139427 130949.06 123401 138665 947968 1393603 31.98
crit 2.77 27.65% 262110.20 245200 278854 250640.70 0 278854 725033 1065868 30.59
 
 

Action details: rising_sun_kick

Static Values
  • id:107428
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:107428
  • name:Rising Sun Kick
  • school:physical
  • tooltip:
  • description:Kick upwards, dealing {$185099s1=0} damage{$?s128595=false}[, and reducing the effectiveness of healing on the target for {$115804d=10 seconds}][].
 
Strike of the Windlord 14315 1.3% 0.0 0.00sec 0 0 Direct 5.4 197837 395631 252461 27.6% 0.0%  

Stats details: strike_of_the_windlord

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 5.38 0.00 0.00 0.0000 0.0000 1357354.80 1995440.13 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.89 72.38% 197837.14 176990 205558 197218.93 0 205558 769858 1131765 31.89
crit 1.48 27.62% 395630.89 352853 411116 321244.66 0 411116 587496 863675 25.98
 
 

Action details: strike_of_the_windlord

Static Values
  • id:222029
  • school:physical
  • resource:none
  • range:12.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222029
  • name:Strike of the Windlord
  • school:physical
  • tooltip:
  • description:{$@spelldesc205320=Strike with both |cFFFFCC99Fists of the Heavens|r at all enemies in front of you, dealing ${$222029sw1+$205414sw1} damage and reducing movement speed by {$s2=50}% for {$d=6 seconds}.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:22.50
 
Strike of the Windlord (_offhand) 7216 0.7% 0.0 0.00sec 0 0 Direct 5.4 99757 199447 127301 27.6% 0.0%  

Stats details: strike_of_the_windlord_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 5.38 0.00 0.00 0.0000 0.0000 684391.00 1006119.59 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.89 72.37% 99757.14 89878 102779 99434.21 0 102779 388165 570639 31.89
crit 1.49 27.63% 199446.81 180330 205558 162015.30 0 205558 296226 435481 25.98
 
 

Action details: strike_of_the_windlord_offhand

Static Values
  • id:205414
  • school:physical
  • resource:none
  • range:12.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205414
  • name:Strike of the Windlord
  • school:physical
  • tooltip:
  • description:{$@spelldesc205320=Strike with both |cFFFFCC99Fists of the Heavens|r at all enemies in front of you, dealing ${$222029sw1+$205414sw1} damage and reducing movement speed by {$s2=50}% for {$d=6 seconds}.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:22.50
 
Tiger Palm 3939 0.4% 20.0 21.53sec 18618 0 Direct 20.0 14593 29185 18618 27.6% 0.0%  

Stats details: tiger_palm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.02 20.02 0.00 0.00 0.0000 0.0000 372796.31 548045.89 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.50 72.42% 14592.93 12959 15389 14589.98 14036 15134 211609 311086 31.98
crit 5.52 27.58% 29185.35 25918 30778 29115.43 0 30778 161187 236960 31.91
 
 

Action details: tiger_palm

Static Values
  • id:100780
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:100780
  • name:Tiger Palm
  • school:physical
  • tooltip:
  • description:Attack with the palm of your hand, dealing {$s1=1} damage.$?a137025[ Tiger Palm has an $137384m1% chance to make your next Blackout Kick cost no Chi.][]$?a137023[ Reduces the remaining cooldown on your Brews by {$s3=1} sec.][]$?a137025[ |cFFFFFFFFGenerates {$s2=1} Chi.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.050000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Whirling Dragon Punch 6023 0.6% 2.9 130.39sec 194137 336343 Periodic 8.4 53517 107031 68348 27.7% 0.0% 0.4%

Stats details: whirling_dragon_punch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.94 0.00 8.36 8.36 0.5775 0.2033 571110.09 839585.93 31.98 336342.81 336342.81
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.0 72.28% 53517.00 48618 55291 53281.94 0 55291 323211 475150 31.91
crit 2.3 27.72% 107031.38 99143 110582 95391.21 0 110582 247899 364436 28.54
 
 

Action details: whirling_dragon_punch

Static Values
  • id:152175
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:152175
  • name:Whirling Dragon Punch
  • school:physical
  • tooltip:
  • description:Performs a devastating whirling upward strike, dealing ${3*{$158221s1=0}} damage to all nearby enemies. Only usable while Fists of Fury and Rising Sun Kick are on cooldown.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:1.00
  • base_tick_time:0.25
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: whirling_dragon_punch_tick

Static Values
  • id:158221
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:158221
  • name:Whirling Dragon Punch
  • school:physical
  • tooltip:
  • description:{$@spelldesc152175=Performs a devastating whirling upward strike, dealing ${3*{$158221s1=0}} damage to all nearby enemies. Only usable while Fists of Fury and Rising Sun Kick are on cooldown.}
 
pet - earth_spirit 104534 / 22059
auto_attack_mh 4618 0.4% 41.8 10.08sec 10446 4932 Direct 41.8 9618 19237 10446 27.6% 19.0%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.82 41.82 0.00 0.00 2.1180 0.0000 436808.50 642149.87 31.98 4931.96 4931.96
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 22.32 53.38% 9617.94 8675 10082 9618.02 9340 9976 214691 315616 31.98
crit 11.55 27.61% 19237.35 17351 20164 19237.28 17466 20164 222117 326534 31.98
miss 7.95 19.01% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 2311 0.2% 41.8 10.08sec 5228 2468 Direct 41.8 4809 9617 5228 27.7% 19.0%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.82 41.82 0.00 0.00 2.1180 0.0000 218607.50 321373.73 31.98 2468.27 2468.27
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 22.29 53.30% 4809.22 4328 5041 4809.20 4642 4961 107185 157571 31.98
crit 11.59 27.71% 9617.48 8675 10082 9617.43 9104 10039 111423 163802 31.98
miss 7.94 19.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Blackout Kick 10629 1.0% 13.6 31.66sec 74082 0 Direct 13.6 58054 116096 74080 27.6% 0.0%  

Stats details: blackout_kick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.57 13.57 0.00 0.00 0.0000 0.0000 1005289.74 1477871.14 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.82 72.39% 58054.00 53137 61553 58058.36 55186 60492 570247 838318 31.98
crit 3.75 27.61% 116095.78 106275 123106 114437.20 0 123106 435042 639554 31.52
 
 

Action details: blackout_kick

Static Values
  • id:100784
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:100784
  • name:Blackout Kick
  • school:physical
  • tooltip:
  • description:Kick with a blast of Chi energy, dealing {$s1=0} Physical damage.
 
Chi Wave (_damage) 5549 0.5% 0.0 0.00sec 0 0 Direct 23.2 17814 35626 22715 27.5% 0.0%  

Stats details: chi_wave_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 23.15 0.00 0.00 0.0000 0.0000 525865.37 525865.37 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.78 72.48% 17813.66 14026 29280 17787.76 15338 23649 298927 298927 0.00
crit 6.37 27.52% 35625.52 28051 58559 35541.27 0 58559 226938 226938 0.00
 
 

Action details: chi_wave_damage

Static Values
  • id:132467
  • school:nature
  • resource:none
  • range:50000.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:132467
  • name:Chi Wave
  • school:nature
  • tooltip:
  • description:{$@spelldesc115098=A wave of Chi energy flows through friends and foes, dealing $<damage> Nature damage or $<healing> healing. Bounces up to {$115098s1=7} times to targets within $132466a2 yards.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Fists of Fury 32214 3.0% 6.1 77.79sec 501423 157824 Periodic 29.7 80444 160883 102737 27.7% 0.0% 4.3%

Stats details: fists_of_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.08 0.00 29.68 29.68 3.1773 0.6510 3049156.28 4482548.56 31.98 157823.82 157823.82
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 21.5 72.28% 80444.25 73806 83937 80458.77 76310 83937 1725716 2536966 31.98
crit 8.2 27.72% 160882.86 147613 167874 160894.19 149290 167874 1323440 1945583 31.98
 
 

Action details: fists_of_fury

Static Values
  • id:113656
  • school:physical
  • resource:chi
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:113656
  • name:Fists of Fury
  • school:physical
  • tooltip:$w3 damage every $t3 sec. $?s125671[Parrying all attacks.][]
  • description:Pummels all targets in front of you, dealing ${5*{$s5=0}} damage over {$113656d=4 seconds}. Can be channeled while moving.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:4.00
  • base_tick_time:0.17
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: fists_of_fury_tick

Static Values
  • id:117418
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:117418
  • name:Fists of Fury
  • school:physical
  • tooltip:
  • description:{$@spelldesc113656=Pummels all targets in front of you, dealing ${5*{$s5=0}} damage over {$113656d=4 seconds}. Can be channeled while moving.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Rising Sun Kick 17715 1.6% 10.0 44.33sec 167269 0 Direct 10.0 131018 262024 167268 27.7% 0.0%  

Stats details: rising_sun_kick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.00 10.00 0.00 0.00 0.0000 0.0000 1673107.66 2459626.73 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.23 72.33% 131017.68 122600 139427 130971.31 124202 138438 947862 1393447 31.98
crit 2.77 27.67% 262023.97 245200 278854 250337.55 0 278854 725245 1066179 30.56
 
 

Action details: rising_sun_kick

Static Values
  • id:107428
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:107428
  • name:Rising Sun Kick
  • school:physical
  • tooltip:
  • description:Kick upwards, dealing {$185099s1=0} damage{$?s128595=false}[, and reducing the effectiveness of healing on the target for {$115804d=10 seconds}][].
 
Strike of the Windlord 14305 1.3% 0.0 0.00sec 0 0 Direct 5.4 197847 395580 252347 27.6% 0.0%  

Stats details: strike_of_the_windlord

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 5.38 0.00 0.00 0.0000 0.0000 1356681.03 1994449.62 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.89 72.44% 197846.88 176426 205558 197149.03 0 205558 770532 1132755 31.89
crit 1.48 27.56% 395579.62 353981 411116 321173.94 0 411116 586149 861694 25.97
 
 

Action details: strike_of_the_windlord

Static Values
  • id:222029
  • school:physical
  • resource:none
  • range:12.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222029
  • name:Strike of the Windlord
  • school:physical
  • tooltip:
  • description:{$@spelldesc205320=Strike with both |cFFFFCC99Fists of the Heavens|r at all enemies in front of you, dealing ${$222029sw1+$205414sw1} damage and reducing movement speed by {$s2=50}% for {$d=6 seconds}.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:22.50
 
Strike of the Windlord (_offhand) 7240 0.7% 0.0 0.00sec 0 0 Direct 5.4 99744 199514 127715 28.0% 0.0%  

Stats details: strike_of_the_windlord_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 5.38 0.00 0.00 0.0000 0.0000 686647.49 1009436.86 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.87 71.96% 99744.17 89878 102779 99466.06 0 102779 385908 567322 31.90
crit 1.51 28.04% 199514.36 180330 205558 162749.06 0 205558 300739 442115 26.09
 
 

Action details: strike_of_the_windlord_offhand

Static Values
  • id:205414
  • school:physical
  • resource:none
  • range:12.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205414
  • name:Strike of the Windlord
  • school:physical
  • tooltip:
  • description:{$@spelldesc205320=Strike with both |cFFFFCC99Fists of the Heavens|r at all enemies in front of you, dealing ${$222029sw1+$205414sw1} damage and reducing movement speed by {$s2=50}% for {$d=6 seconds}.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:22.50
 
Tiger Palm 3943 0.4% 20.0 21.53sec 18634 0 Direct 20.0 14594 29178 18635 27.7% 0.0%  

Stats details: tiger_palm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.02 20.02 0.00 0.00 0.0000 0.0000 373131.54 548538.71 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.48 72.30% 14594.39 12959 15389 14591.49 13923 15103 211274 310593 31.98
crit 5.55 27.70% 29177.71 25918 30778 29103.17 0 30778 161857 237946 31.90
 
 

Action details: tiger_palm

Static Values
  • id:100780
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:100780
  • name:Tiger Palm
  • school:physical
  • tooltip:
  • description:Attack with the palm of your hand, dealing {$s1=1} damage.$?a137025[ Tiger Palm has an $137384m1% chance to make your next Blackout Kick cost no Chi.][]$?a137023[ Reduces the remaining cooldown on your Brews by {$s3=1} sec.][]$?a137025[ |cFFFFFFFFGenerates {$s2=1} Chi.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.050000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Whirling Dragon Punch 6009 0.6% 2.9 130.39sec 193740 335656 Periodic 8.4 53511 107061 68212 27.5% 0.0% 0.4%

Stats details: whirling_dragon_punch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.94 0.00 8.36 8.36 0.5775 0.2033 569944.37 837872.22 31.98 335656.29 335656.29
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.1 72.55% 53511.38 48618 55291 53289.72 0 55291 324376 476864 31.92
crit 2.3 27.45% 107061.07 99143 110582 95520.10 0 110582 245568 361008 28.57
 
 

Action details: whirling_dragon_punch

Static Values
  • id:152175
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:152175
  • name:Whirling Dragon Punch
  • school:physical
  • tooltip:
  • description:Performs a devastating whirling upward strike, dealing ${3*{$158221s1=0}} damage to all nearby enemies. Only usable while Fists of Fury and Rising Sun Kick are on cooldown.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:1.00
  • base_tick_time:0.25
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: whirling_dragon_punch_tick

Static Values
  • id:158221
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:158221
  • name:Whirling Dragon Punch
  • school:physical
  • tooltip:
  • description:{$@spelldesc152175=Performs a devastating whirling upward strike, dealing ${3*{$158221s1=0}} damage to all nearby enemies. Only usable while Fists of Fury and Rising Sun Kick are on cooldown.}
 
Simple Action Stats Execute Interval
Ehöl
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Ehöl
  • harmful:false
  • if_expr:
 
Chi Wave (_heal) 0 0.0% 113.2 3.97sec

Stats details: chi_wave_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 113.15 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: chi_wave_heal

Static Values
  • id:132463
  • school:nature
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Ehöl
  • harmful:false
  • if_expr:
Spelldata
  • id:132463
  • name:Chi Wave
  • school:nature
  • tooltip:
  • description:{$@spelldesc115098=A wave of Chi energy flows through friends and foes, dealing $<damage> Nature damage or $<healing> healing. Bounces up to {$115098s1=7} times to targets within $132466a2 yards.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.867000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Energizing Elixir 7.7 61.71sec

Stats details: energizing_elixir

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.71 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: energizing_elixir

Static Values
  • id:115288
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:energy<energy.max&chi<=1&buff.serenity.down
Spelldata
  • id:115288
  • name:Energizing Elixir
  • school:physical
  • tooltip:
  • description:Chug an Energizing Elixir, refilling all your Energy and Chi.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Ehöl
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Ehöl
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Storm, Earth, and Fire 7.4 62.94sec

Stats details: storm_earth_and_fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.41 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: storm_earth_and_fire

Static Values
  • id:137639
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:artifact.strike_of_the_windlord.enabled&cooldown.strike_of_the_windlord.remains<14&cooldown.fists_of_fury.remains<=9&cooldown.rising_sun_kick.remains<=5
Spelldata
  • id:137639
  • name:Storm, Earth, and Fire
  • school:nature
  • tooltip:Elemental spirits summoned, mirroring all of the Monk's attacks. The Monk and spirits each do ${100+$m1}% of normal damage and healing.
  • description:Split into 3 elemental spirits for {$d=15 seconds}, each spirit dealing ${100+$m1}% of normal damage and healing. You directly control the Storm spirit, while Earth and Fire spirits mimic your attacks on nearby enemies. While active, casting Storm, Earth, and Fire again will cause the spirits to fixate on your target.
 
pet - fire_spirit
Chi Wave 5.8 82.82sec

Stats details: chi_wave

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.83 0.00 23.16 0.00 0.0000 0.7485 0.00 0.00 0.00 0.00 0.00
 
 

Action details: chi_wave

Static Values
  • id:115098
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:115098
  • name:Chi Wave
  • school:nature
  • tooltip:
  • description:A wave of Chi energy flows through friends and foes, dealing $<damage> Nature damage or $<healing> healing. Bounces up to {$115098s1=7} times to targets within $132466a2 yards.
 
pet - earth_spirit
Chi Wave 5.8 82.82sec

Stats details: chi_wave

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.83 0.00 23.16 0.00 0.0000 0.7485 0.00 0.00 0.00 0.00 0.00
 
 

Action details: chi_wave

Static Values
  • id:115098
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:115098
  • name:Chi Wave
  • school:nature
  • tooltip:
  • description:A wave of Chi energy flows through friends and foes, dealing $<damage> Nature damage or $<healing> healing. Bounces up to {$115098s1=7} times to targets within $132466a2 yards.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 9.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:Ehöl
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Blackout Kick! (bok_proc) 10.2 0.0 40.3sec 40.3sec 5.49% 4.04% 0.0(0.0) 0.0

Buff details

  • buff initial source:Ehöl
  • cooldown name:buff_bok_proc
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:10.00%
  • default_value:-0.00

Stack Uptimes

  • bok_proc_1:5.49%

Trigger Attempt Success

  • trigger_pct:10.05%

Spelldata details

  • id:116768
  • name:Blackout Kick!
  • tooltip:Your next Blackout Kick costs no Chi.
  • description:{$@spelldesc137384=You have a $m1% chance when you Tiger Palm to cause your next Blackout Kick to cost no Chi within {$116768d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Chaotic Energy 1.0 264.1 0.0sec 1.7sec 99.96% 99.96% 245.1(245.1) 0.0

Buff details

  • buff initial source:Ehöl
  • cooldown name:buff_chaotic_energy
  • max_stacks:20
  • duration:23.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:66.50

Stack Uptimes

  • chaotic_energy_1:0.22%
  • chaotic_energy_2:0.20%
  • chaotic_energy_3:0.45%
  • chaotic_energy_4:0.54%
  • chaotic_energy_5:0.55%
  • chaotic_energy_6:0.23%
  • chaotic_energy_7:0.26%
  • chaotic_energy_8:0.24%
  • chaotic_energy_9:0.25%
  • chaotic_energy_10:0.24%
  • chaotic_energy_11:0.25%
  • chaotic_energy_12:0.25%
  • chaotic_energy_13:0.26%
  • chaotic_energy_14:0.27%
  • chaotic_energy_15:0.30%
  • chaotic_energy_16:0.33%
  • chaotic_energy_17:0.35%
  • chaotic_energy_18:0.35%
  • chaotic_energy_19:0.33%
  • chaotic_energy_20:94.07%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:214831
  • name:Chaotic Energy
  • tooltip:Strength or Agility increased by $w3.
  • description:{$@spelldesc214829=Your melee autoattacks grant you Chaotic Energy, increasing your Strength or Agility by {$214831s3=50}, stacking up to {$214831u=20} times. If you do not autoattack an enemy for 4 sec, this effect will decrease by 1 stack every sec.}
  • max_stacks:20
  • duration:23.00
  • cooldown:0.00
  • default_chance:101.00%
Hit Combo 1.0 304.2 0.0sec 1.5sec 100.00% 99.89% 297.2(297.2) 0.0

Buff details

  • buff initial source:Ehöl
  • cooldown name:buff_hit_combo
  • max_stacks:8
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.02

Stack Uptimes

  • hit_combo_1:0.23%
  • hit_combo_2:0.23%
  • hit_combo_3:0.23%
  • hit_combo_4:0.34%
  • hit_combo_5:0.67%
  • hit_combo_6:0.23%
  • hit_combo_7:0.39%
  • hit_combo_8:97.69%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196741
  • name:Hit Combo
  • tooltip:Damage dealt increased by {$s1=2}%.
  • description:{$@spelldesc196740=Each successive attack that triggers Combo Strikes in a row grants {$196741s1=2}% increased damage, stacking up to {$196741u=8} times.}
  • max_stacks:8
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Potion of Deadly Grace 2.0 0.0 115.6sec 0.0sec 10.83% 10.89% 0.0(0.0) 2.0

Buff details

  • buff initial source:Ehöl
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:10.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Storm, Earth, and Fire 6.4 6.4 74.6sec 34.2sec 21.10% 24.96% 0.0(0.0) 6.2

Buff details

  • buff initial source:Ehöl
  • cooldown name:buff_storm_earth_and_fire
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • storm_earth_and_fire_2:21.10%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:137639
  • name:Storm, Earth, and Fire
  • tooltip:Elemental spirits summoned, mirroring all of the Monk's attacks. The Monk and spirits each do ${100+$m1}% of normal damage and healing.
  • description:Split into 3 elemental spirits for {$d=15 seconds}, each spirit dealing ${100+$m1}% of normal damage and healing. You directly control the Storm spirit, while Earth and Fire spirits mimic your attacks on nearby enemies. While active, casting Storm, Earth, and Fire again will cause the spirits to fixate on your target.
  • max_stacks:2
  • duration:15.00
  • cooldown:1.00
  • default_chance:100.00%
(sef_) earth_spirit: Hit Combo 6.4 62.8 74.7sec 6.1sec 97.44% 94.01% 18.5(18.5) 0.0

Buff details

  • buff initial source:Ehöl_earth_spirit
  • cooldown name:buff_sef_hit_combo
  • max_stacks:8
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.02

Stack Uptimes

  • sef_hit_combo_1:8.86%
  • sef_hit_combo_2:8.63%
  • sef_hit_combo_3:8.11%
  • sef_hit_combo_4:10.06%
  • sef_hit_combo_5:11.34%
  • sef_hit_combo_6:9.06%
  • sef_hit_combo_7:10.91%
  • sef_hit_combo_8:30.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196741
  • name:Hit Combo
  • tooltip:Damage dealt increased by {$s1=2}%.
  • description:{$@spelldesc196740=Each successive attack that triggers Combo Strikes in a row grants {$196741s1=2}% increased damage, stacking up to {$196741u=8} times.}
  • max_stacks:8
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
(sef_) fire_spirit: Hit Combo 6.4 62.8 74.7sec 6.1sec 97.44% 94.01% 18.5(18.5) 0.0

Buff details

  • buff initial source:Ehöl_fire_spirit
  • cooldown name:buff_sef_hit_combo
  • max_stacks:8
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.02

Stack Uptimes

  • sef_hit_combo_1:8.86%
  • sef_hit_combo_2:8.63%
  • sef_hit_combo_3:8.11%
  • sef_hit_combo_4:10.06%
  • sef_hit_combo_5:11.34%
  • sef_hit_combo_6:9.06%
  • sef_hit_combo_7:10.91%
  • sef_hit_combo_8:30.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196741
  • name:Hit Combo
  • tooltip:Damage dealt increased by {$s1=2}%.
  • description:{$@spelldesc196740=Each successive attack that triggers Combo Strikes in a row grants {$196741s1=2}% increased damage, stacking up to {$196741u=8} times.}
  • max_stacks:8
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Ehöl
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Ehöl
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (nightborne_delicacy_platter)

Buff details

  • buff initial source:Ehöl
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:375.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Windwalking (_movement_aura)

Buff details

  • buff initial source:Ehöl
  • cooldown name:buff_windwalking_movement_aura
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • windwalking_movement_aura_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:166646
  • name:Windwalking
  • tooltip:Movement speed increased by {$s1=10}%.
  • description:
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Ehöl
blackout_kick Chi 76.3 66.2 0.9 0.9 165106.4
fists_of_fury Chi 21.1 63.2 3.0 3.0 304415.9
rising_sun_kick Chi 42.2 84.5 2.0 2.0 156884.9
strike_of_the_windlord Chi 11.2 22.5 2.0 2.0 402053.7
tiger_palm Energy 101.4 5070.2 50.0 50.0 707.1
Resource Gains Type Count Total Average Overflow
tiger_palm Chi 101.40 202.81 (81.71%) 2.00 0.00 0.00%
energy_regen Energy 1479.39 4494.48 (89.85%) 3.04 710.38 13.65%
mp5_regen Mana 1479.39 0.00 (0.00%) 0.00 3961339.37 100.00%
blackout_kick_proc Chi 10.12 10.12 (4.08%) 1.00 0.00 0.00%
energizing_elixir_energy Energy 7.72 507.56 (10.15%) 65.79 1035.48 67.11%
energizing_elixir_chi Chi 7.72 35.27 (14.21%) 4.57 41.88 54.28%
pet - fire_spirit
tiger_palm Chi 20.02 0.00 (0.00%) 0.00 20.02 100.00%
pet - earth_spirit
tiger_palm Chi 20.02 0.00 (0.00%) 0.00 20.02 100.00%
Resource RPS-Gain RPS-Loss
Energy 11.11 11.26
Chi 0.53 0.52
Combat End Resource Mean Min Max
Energy 61.42 0.07 130.00
Chi 1.76 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 12.6%

Procs

Count Interval
bok_proc 10.2 40.3sec

Statistics & Data Analysis

Fight Length
Sample Data Ehöl Fight Length
Count 9999
Mean 450.42
Minimum 350.15
Maximum 555.44
Spread ( max - min ) 205.29
Range [ ( max - min ) / 2 * 100% ] 22.79%
DPS
Sample Data Ehöl Damage Per Second
Count 9999
Mean 229195.85
Minimum 210438.12
Maximum 253829.73
Spread ( max - min ) 43391.61
Range [ ( max - min ) / 2 * 100% ] 9.47%
Standard Deviation 5016.2405
5th Percentile 221212.32
95th Percentile 237679.75
( 95th Percentile - 5th Percentile ) 16467.43
Mean Distribution
Standard Deviation 50.1649
95.00% Confidence Intervall ( 229097.53 - 229294.17 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 18
0.1% Error 1840
0.1 Scale Factor Error with Delta=300 214803
0.05 Scale Factor Error with Delta=300 859212
0.01 Scale Factor Error with Delta=300 21480301
Priority Target DPS
Sample Data Ehöl Priority Target Damage Per Second
Count 9999
Mean 229195.85
Minimum 210438.12
Maximum 253829.73
Spread ( max - min ) 43391.61
Range [ ( max - min ) / 2 * 100% ] 9.47%
Standard Deviation 5016.2405
5th Percentile 221212.32
95th Percentile 237679.75
( 95th Percentile - 5th Percentile ) 16467.43
Mean Distribution
Standard Deviation 50.1649
95.00% Confidence Intervall ( 229097.53 - 229294.17 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 18
0.1% Error 1840
0.1 Scale Factor Error with Delta=300 214803
0.05 Scale Factor Error with Delta=300 859212
0.01 Scale Factor Error with Delta=300 21480301
DPS(e)
Sample Data Ehöl Damage Per Second (Effective)
Count 9999
Mean 229195.85
Minimum 210438.12
Maximum 253829.73
Spread ( max - min ) 43391.61
Range [ ( max - min ) / 2 * 100% ] 9.47%
Damage
Sample Data Ehöl Damage
Count 9999
Mean 83330856.73
Minimum 62671897.87
Maximum 108395452.83
Spread ( max - min ) 45723554.96
Range [ ( max - min ) / 2 * 100% ] 27.43%
DTPS
Sample Data Ehöl Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Ehöl Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Ehöl Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Ehöl Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Ehöl Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Ehöl Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data EhölTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Ehöl Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Total Stagger damage generated
Sample Data Total Stagger damage generated
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Stagger damage that was not purified
Sample Data Stagger damage that was not purified
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Stagger damage that was purified
Sample Data Stagger damage that was purified
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Amount of damage purified while at light stagger
Sample Data Amount of damage purified while at light stagger
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Amount of damage purified while at moderate stagger
Sample Data Amount of damage purified while at moderate stagger
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Amount of damage purified while at heavy stagger
Sample Data Amount of damage purified while at heavy stagger
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=nightborne_delicacy_platter
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
4 0.00 potion,name=deadly_grace
Default action list Executed every time the actor is available.
# count action,conditions
5 1.00 auto_attack
0.00 invoke_xuen
6 1.00 potion,name=deadly_grace,if=buff.serenity.up|buff.storm_earth_and_fire.up|(!talent.serenity.enabled&trinket.proc.agility.react)|buff.bloodlust.react|target.time_to_die<=60
0.00 touch_of_death,if=!artifact.gale_burst.enabled
7 3.71 touch_of_death,if=artifact.gale_burst.enabled&cooldown.strike_of_the_windlord.remains<8&cooldown.fists_of_fury.remains<=3&cooldown.rising_sun_kick.remains<8
0.00 blood_fury
0.00 berserking
0.00 arcane_torrent,if=chi.max-chi>=1
8 7.41 storm_earth_and_fire,if=artifact.strike_of_the_windlord.enabled&cooldown.strike_of_the_windlord.remains<14&cooldown.fists_of_fury.remains<=9&cooldown.rising_sun_kick.remains<=5
0.00 storm_earth_and_fire,if=!artifact.strike_of_the_windlord.enabled&cooldown.fists_of_fury.remains<=9&cooldown.rising_sun_kick.remains<=5
0.00 serenity,if=artifact.strike_of_the_windlord.enabled&cooldown.strike_of_the_windlord.remains<7&cooldown.fists_of_fury.remains<=3&cooldown.rising_sun_kick.remains<8
0.00 serenity,if=!artifact.strike_of_the_windlord.enabled&cooldown.fists_of_fury.remains<=3&cooldown.rising_sun_kick.remains<8
9 7.72 energizing_elixir,if=energy<energy.max&chi<=1&buff.serenity.down
0.00 rushing_jade_wind,if=buff.serenity.up&!prev_gcd.rushing_jade_wind
A 11.24 strike_of_the_windlord
B 20.72 whirling_dragon_punch
C 21.06 fists_of_fury
D 0.00 call_action_list,name=st,if=active_enemies<3
E 0.00 call_action_list,name=aoe,if=active_enemies>=3
actions.st
# count action,conditions
F 42.24 rising_sun_kick
0.00 rushing_jade_wind,if=chi>1&!prev_gcd.rushing_jade_wind
G 28.55 chi_wave,if=energy.time_to_max>2|buff.serenity.down
0.00 chi_burst,if=energy.time_to_max>2|buff.serenity.down
H 76.29 blackout_kick,if=(chi>1|buff.bok_proc.up)&buff.serenity.down&!prev_gcd.blackout_kick
I 101.40 tiger_palm,if=(buff.serenity.down&chi<=2)&!prev_gcd.tiger_palm

Sample Sequence

0124578G8IA9CFBIHIHFGIHICIFBIH8IGFHIHCIFIABGIHIFIHIHCGIF9HBHFIHIGHCIAIFBIHGIHIFHIHICGIFBIH86IHFIH7GA9CFIBHIHIFGHIHIHCIFBGIHIHFIHIAICGIFBIHIHF9HGHCIFIBHIH8GFIAIHIHFIHGICHIFBIHIHGFIHICH9AFBGIHIHFIHIHCGIFHBIHI8HFIHI7GHICIAIFBGIHIFH9CHIFGIHBHIFIHIHCGIAIFIBHIHFIGHICIFIHBH8GIF9HCIAGIFBIHIHFIHICGIFIHBHIHFIH7GHICIAHIFB9HGHFIHICIFGIHBH

Sample Sequence Table

time name target resources buffs
Pre flask Ehöl 130.0/130: 100% energy | 5.0/5: 100% chi
Pre food Ehöl 130.0/130: 100% energy | 5.0/5: 100% chi
Pre augmentation Ehöl 130.0/130: 100% energy | 5.0/5: 100% chi
Pre potion Fluffy_Pillow 130.0/130: 100% energy | 5.0/5: 100% chi potion_of_deadly_grace
0:00.000 auto_attack Fluffy_Pillow 130.0/130: 100% energy | 0.0/5: 0% chi potion_of_deadly_grace
0:00.000 touch_of_death Fluffy_Pillow 130.0/130: 100% energy | 0.0/5: 0% chi chaotic_energy, potion_of_deadly_grace
0:01.006 storm_earth_and_fire Fluffy_Pillow 130.0/130: 100% energy | 0.0/5: 0% chi bloodlust, hit_combo, chaotic_energy(3), potion_of_deadly_grace
0:01.006 chi_wave Fluffy_Pillow 130.0/130: 100% energy | 0.0/5: 0% chi bloodlust, hit_combo, storm_earth_and_fire(2), chaotic_energy(3), potion_of_deadly_grace
0:02.011 storm_earth_and_fire Fluffy_Pillow 130.0/130: 100% energy | 0.0/5: 0% chi bloodlust, hit_combo(2), storm_earth_and_fire(2), chaotic_energy(3), potion_of_deadly_grace
0:02.011 tiger_palm Fluffy_Pillow 130.0/130: 100% energy | 0.0/5: 0% chi bloodlust, hit_combo(2), storm_earth_and_fire(2), chaotic_energy(3), potion_of_deadly_grace
0:03.015 strike_of_the_windlord Fluffy_Pillow 94.7/130: 73% energy | 2.0/5: 40% chi bloodlust, hit_combo(3), storm_earth_and_fire(2), chaotic_energy(4), potion_of_deadly_grace
0:04.520 energizing_elixir Fluffy_Pillow 116.7/130: 90% energy | 0.0/5: 0% chi bloodlust, hit_combo(4), storm_earth_and_fire(2), chaotic_energy(4), potion_of_deadly_grace
0:04.520 fists_of_fury Fluffy_Pillow 130.0/130: 100% energy | 5.0/5: 100% chi bloodlust, hit_combo(4), storm_earth_and_fire(2), chaotic_energy(4), potion_of_deadly_grace
0:07.427 rising_sun_kick Fluffy_Pillow 130.0/130: 100% energy | 2.0/5: 40% chi bloodlust, hit_combo(5), storm_earth_and_fire(2), chaotic_energy(4), potion_of_deadly_grace
0:08.430 whirling_dragon_punch Fluffy_Pillow 130.0/130: 100% energy | 0.0/5: 0% chi bloodlust, hit_combo(6), storm_earth_and_fire(2), chaotic_energy(5), potion_of_deadly_grace
0:10.172 tiger_palm Fluffy_Pillow 130.0/130: 100% energy | 0.0/5: 0% chi bloodlust, hit_combo(7), storm_earth_and_fire(2), chaotic_energy(7), potion_of_deadly_grace
0:11.176 blackout_kick Fluffy_Pillow 94.7/130: 73% energy | 2.0/5: 40% chi bloodlust, hit_combo(8), storm_earth_and_fire(2), chaotic_energy(7), potion_of_deadly_grace
0:12.179 tiger_palm Fluffy_Pillow 109.4/130: 84% energy | 1.0/5: 20% chi bloodlust, hit_combo(8), storm_earth_and_fire(2), chaotic_energy(8), potion_of_deadly_grace
0:13.183 Waiting 0.800 sec 74.1/130: 57% energy | 3.0/5: 60% chi bloodlust, hit_combo(8), storm_earth_and_fire(2), chaotic_energy(8), potion_of_deadly_grace
0:13.983 blackout_kick Fluffy_Pillow 85.8/130: 66% energy | 3.0/5: 60% chi bloodlust, hit_combo(8), storm_earth_and_fire(2), chaotic_energy(10), potion_of_deadly_grace
0:15.182 rising_sun_kick Fluffy_Pillow 103.3/130: 79% energy | 2.0/5: 40% chi bloodlust, hit_combo(8), storm_earth_and_fire(2), chaotic_energy(10), potion_of_deadly_grace
0:16.186 chi_wave Fluffy_Pillow 118.0/130: 91% energy | 0.0/5: 0% chi bloodlust, hit_combo(8), chaotic_energy(11), potion_of_deadly_grace
0:17.191 tiger_palm Fluffy_Pillow 130.0/130: 100% energy | 0.0/5: 0% chi bloodlust, hit_combo(8), chaotic_energy(13), potion_of_deadly_grace
0:18.195 blackout_kick Fluffy_Pillow 94.7/130: 73% energy | 2.0/5: 40% chi bloodlust, bok_proc, hit_combo(8), chaotic_energy(13), potion_of_deadly_grace
0:19.200 tiger_palm Fluffy_Pillow 109.4/130: 84% energy | 2.0/5: 40% chi bloodlust, hit_combo(8), chaotic_energy(14), potion_of_deadly_grace
0:20.204 Waiting 0.500 sec 74.1/130: 57% energy | 4.0/5: 80% chi bloodlust, hit_combo(8), chaotic_energy(14), potion_of_deadly_grace
0:20.704 fists_of_fury Fluffy_Pillow 81.4/130: 63% energy | 4.0/5: 80% chi bloodlust, hit_combo(8), chaotic_energy(16), potion_of_deadly_grace
0:23.890 tiger_palm Fluffy_Pillow 128.0/130: 98% energy | 1.0/5: 20% chi bloodlust, hit_combo(8), chaotic_energy(16)
0:24.895 rising_sun_kick Fluffy_Pillow 92.8/130: 71% energy | 3.0/5: 60% chi bloodlust, hit_combo(8), chaotic_energy(17)
0:25.899 whirling_dragon_punch Fluffy_Pillow 107.4/130: 83% energy | 1.0/5: 20% chi bloodlust, hit_combo(8), chaotic_energy(19)
0:27.567 tiger_palm Fluffy_Pillow 130.0/130: 100% energy | 1.0/5: 20% chi bloodlust, hit_combo(8), chaotic_energy(19)
0:28.573 blackout_kick Fluffy_Pillow 94.7/130: 73% energy | 3.0/5: 60% chi bloodlust, hit_combo(8), chaotic_energy(20)
0:29.577 storm_earth_and_fire Fluffy_Pillow 109.4/130: 84% energy | 2.0/5: 40% chi bloodlust, hit_combo(8), chaotic_energy(20)
0:29.577 tiger_palm Fluffy_Pillow 109.4/130: 84% energy | 2.0/5: 40% chi bloodlust, hit_combo(8), storm_earth_and_fire(2), chaotic_energy(20)
0:30.580 Waiting 0.400 sec 74.1/130: 57% energy | 4.0/5: 80% chi bloodlust, bok_proc, hit_combo(8), storm_earth_and_fire(2), chaotic_energy(20)
0:30.980 chi_wave Fluffy_Pillow 80.0/130: 62% energy | 4.0/5: 80% chi bloodlust, bok_proc, hit_combo(8), storm_earth_and_fire(2), chaotic_energy(20)
0:32.192 rising_sun_kick Fluffy_Pillow 97.7/130: 75% energy | 4.0/5: 80% chi bloodlust, bok_proc, hit_combo(8), storm_earth_and_fire(2), chaotic_energy(20)
0:33.197 blackout_kick Fluffy_Pillow 112.4/130: 86% energy | 2.0/5: 40% chi bloodlust, bok_proc, hit_combo(8), storm_earth_and_fire(2), chaotic_energy(20)
0:34.202 tiger_palm Fluffy_Pillow 127.1/130: 98% energy | 2.0/5: 40% chi bloodlust, hit_combo(8), storm_earth_and_fire(2), chaotic_energy(20)
0:35.207 Waiting 0.800 sec 91.8/130: 71% energy | 4.0/5: 80% chi bloodlust, hit_combo(8), storm_earth_and_fire(2), chaotic_energy(20)
0:36.007 blackout_kick Fluffy_Pillow 103.5/130: 80% energy | 4.0/5: 80% chi bloodlust, hit_combo(8), storm_earth_and_fire(2), chaotic_energy(20)
0:37.202 fists_of_fury Fluffy_Pillow 121.0/130: 93% energy | 3.0/5: 60% chi bloodlust, hit_combo(8), storm_earth_and_fire(2), chaotic_energy(20)
0:40.339 tiger_palm Fluffy_Pillow 130.0/130: 100% energy | 0.0/5: 0% chi bloodlust, hit_combo(8), storm_earth_and_fire(2), chaotic_energy(20)
0:41.343 rising_sun_kick Fluffy_Pillow 91.3/130: 70% energy | 2.0/5: 40% chi hit_combo(8), storm_earth_and_fire(2), chaotic_energy(20)
0:42.347 tiger_palm Fluffy_Pillow 102.6/130: 79% energy | 0.0/5: 0% chi hit_combo(8), storm_earth_and_fire(2), chaotic_energy(20)
0:43.349 strike_of_the_windlord Fluffy_Pillow 63.9/130: 49% energy | 2.0/5: 40% chi hit_combo(8), storm_earth_and_fire(2), chaotic_energy(20)
0:44.852 whirling_dragon_punch Fluffy_Pillow 80.8/130: 62% energy | 0.0/5: 0% chi hit_combo(8), chaotic_energy(20)
0:46.570 chi_wave Fluffy_Pillow 100.1/130: 77% energy | 0.0/5: 0% chi hit_combo(8), chaotic_energy(20)
0:47.575 tiger_palm Fluffy_Pillow 111.5/130: 86% energy | 0.0/5: 0% chi hit_combo(8), chaotic_energy(20)
0:48.577 blackout_kick Fluffy_Pillow 72.7/130: 56% energy | 2.0/5: 40% chi hit_combo(8), chaotic_energy(20)
0:49.581 tiger_palm Fluffy_Pillow 84.0/130: 65% energy | 1.0/5: 20% chi hit_combo(8), chaotic_energy(20)
0:50.586 rising_sun_kick Fluffy_Pillow 45.4/130: 35% energy | 3.0/5: 60% chi hit_combo(8), chaotic_energy(20)
0:51.591 tiger_palm Fluffy_Pillow 56.7/130: 44% energy | 1.0/5: 20% chi hit_combo(8), chaotic_energy(20)
0:52.596 blackout_kick Fluffy_Pillow 18.0/130: 14% energy | 3.0/5: 60% chi hit_combo(8), chaotic_energy(20)
0:53.600 Waiting 1.900 sec 29.3/130: 23% energy | 2.0/5: 40% chi hit_combo(8), chaotic_energy(20)
0:55.500 tiger_palm Fluffy_Pillow 50.7/130: 39% energy | 2.0/5: 40% chi hit_combo(8), chaotic_energy(20)
0:56.503 blackout_kick Fluffy_Pillow 12.0/130: 9% energy | 4.0/5: 80% chi hit_combo(8), chaotic_energy(20)
0:57.507 fists_of_fury Fluffy_Pillow 23.3/130: 18% energy | 3.0/5: 60% chi hit_combo(8), chaotic_energy(20)
1:01.329 chi_wave Fluffy_Pillow 66.3/130: 51% energy | 0.0/5: 0% chi hit_combo(8), chaotic_energy(20)
1:02.575 tiger_palm Fluffy_Pillow 80.3/130: 62% energy | 0.0/5: 0% chi hit_combo(8), chaotic_energy(20)
1:03.581 rising_sun_kick Fluffy_Pillow 41.7/130: 32% energy | 2.0/5: 40% chi hit_combo(8), chaotic_energy(20)
1:04.587 energizing_elixir Fluffy_Pillow 53.0/130: 41% energy | 0.0/5: 0% chi hit_combo(8), chaotic_energy(20)
1:04.587 blackout_kick Fluffy_Pillow 130.0/130: 100% energy | 5.0/5: 100% chi hit_combo(8), chaotic_energy(20)
1:05.592 Waiting 0.400 sec 130.0/130: 100% energy | 4.0/5: 80% chi hit_combo(8), chaotic_energy(20)
1:05.992 whirling_dragon_punch Fluffy_Pillow 130.0/130: 100% energy | 4.0/5: 80% chi hit_combo(8), chaotic_energy(20)
1:07.987 blackout_kick Fluffy_Pillow 130.0/130: 100% energy | 4.0/5: 80% chi hit_combo(8), chaotic_energy(20)
1:08.992 Waiting 3.300 sec 130.0/130: 100% energy | 3.0/5: 60% chi hit_combo(8), chaotic_energy(20)
1:12.292 rising_sun_kick Fluffy_Pillow 130.0/130: 100% energy | 3.0/5: 60% chi hit_combo(8), chaotic_energy(20)
1:13.468 tiger_palm Fluffy_Pillow 130.0/130: 100% energy | 1.0/5: 20% chi hit_combo(8), chaotic_energy(20)
1:14.472 blackout_kick Fluffy_Pillow 91.3/130: 70% energy | 3.0/5: 60% chi hit_combo(8), chaotic_energy(20)
1:15.477 tiger_palm Fluffy_Pillow 102.6/130: 79% energy | 2.0/5: 40% chi hit_combo(8), chaotic_energy(20)
1:16.481 chi_wave Fluffy_Pillow 63.9/130: 49% energy | 4.0/5: 80% chi hit_combo(8), chaotic_energy(20)
1:17.574 blackout_kick Fluffy_Pillow 76.2/130: 59% energy | 4.0/5: 80% chi hit_combo(8), chaotic_energy(20)
1:18.578 Waiting 0.100 sec 87.5/130: 67% energy | 3.0/5: 60% chi hit_combo(8), chaotic_energy(20)
1:18.678 fists_of_fury Fluffy_Pillow 88.7/130: 68% energy | 3.0/5: 60% chi hit_combo(8), chaotic_energy(20)
1:22.720 tiger_palm Fluffy_Pillow 130.0/130: 100% energy | 0.0/5: 0% chi hit_combo(8), chaotic_energy(20)
1:23.724 strike_of_the_windlord Fluffy_Pillow 91.3/130: 70% energy | 2.0/5: 40% chi hit_combo(8), chaotic_energy(20)
1:25.227 tiger_palm Fluffy_Pillow 108.2/130: 83% energy | 0.0/5: 0% chi hit_combo(8), chaotic_energy(20)
1:26.230 rising_sun_kick Fluffy_Pillow 69.5/130: 53% energy | 2.0/5: 40% chi hit_combo(8), chaotic_energy(20)
1:27.236 whirling_dragon_punch Fluffy_Pillow 80.8/130: 62% energy | 0.0/5: 0% chi hit_combo(8), chaotic_energy(20)
1:29.409 tiger_palm Fluffy_Pillow 105.3/130: 81% energy | 0.0/5: 0% chi hit_combo(8), chaotic_energy(20)
1:30.412 blackout_kick Fluffy_Pillow 66.6/130: 51% energy | 2.0/5: 40% chi hit_combo(8), chaotic_energy(20)
1:31.416 chi_wave Fluffy_Pillow 77.9/130: 60% energy | 1.0/5: 20% chi hit_combo(8), chaotic_energy(20)
1:32.574 tiger_palm Fluffy_Pillow 90.9/130: 70% energy | 1.0/5: 20% chi hit_combo(8), chaotic_energy(20)
1:33.578 blackout_kick Fluffy_Pillow 52.2/130: 40% energy | 3.0/5: 60% chi hit_combo(8), chaotic_energy(20)
1:34.583 tiger_palm Fluffy_Pillow 63.6/130: 49% energy | 2.0/5: 40% chi hit_combo(8), chaotic_energy(20)
1:35.588 rising_sun_kick Fluffy_Pillow 24.9/130: 19% energy | 4.0/5: 80% chi hit_combo(8), chaotic_energy(20)
1:36.593 blackout_kick Fluffy_Pillow 36.2/130: 28% energy | 2.0/5: 40% chi hit_combo(8), chaotic_energy(20)
1:37.599 Waiting 0.300 sec 47.5/130: 37% energy | 1.0/5: 20% chi hit_combo(8), chaotic_energy(20)
1:37.899 tiger_palm Fluffy_Pillow 50.9/130: 39% energy | 1.0/5: 20% chi hit_combo(8), chaotic_energy(20)
1:38.905 Waiting 0.500 sec 12.2/130: 9% energy | 3.0/5: 60% chi hit_combo(8), chaotic_energy(20)
1:39.405 blackout_kick Fluffy_Pillow 17.8/130: 14% energy | 3.0/5: 60% chi hit_combo(8), chaotic_energy(20)
1:40.598 Waiting 1.700 sec 31.3/130: 24% energy | 2.0/5: 40% chi hit_combo(8), chaotic_energy(20)
1:42.298 tiger_palm Fluffy_Pillow 50.4/130: 39% energy | 2.0/5: 40% chi hit_combo(8), chaotic_energy(20)
1:43.303 fists_of_fury Fluffy_Pillow 11.7/130: 9% energy | 4.0/5: 80% chi hit_combo(8), chaotic_energy(20)
1:47.061 chi_wave Fluffy_Pillow 54.0/130: 42% energy | 1.0/5: 20% chi hit_combo(8), chaotic_energy(20)
1:48.065 tiger_palm Fluffy_Pillow 65.3/130: 50% energy | 1.0/5: 20% chi hit_combo(8), chaotic_energy(20)
1:49.069 rising_sun_kick Fluffy_Pillow 26.6/130: 20% energy | 3.0/5: 60% chi hit_combo(8), chaotic_energy(20)
1:50.075 whirling_dragon_punch Fluffy_Pillow 38.0/130: 29% energy | 1.0/5: 20% chi hit_combo(8), chaotic_energy(20)
1:51.823 tiger_palm Fluffy_Pillow 57.6/130: 44% energy | 1.0/5: 20% chi hit_combo(8), chaotic_energy(20)
1:52.827 blackout_kick Fluffy_Pillow 18.9/130: 15% energy | 3.0/5: 60% chi hit_combo(8), chaotic_energy(20)
1:53.832 Waiting 1.800 sec 30.3/130: 23% energy | 2.0/5: 40% chi hit_combo(8), chaotic_energy(20)
1:55.632 storm_earth_and_fire Fluffy_Pillow 50.5/130: 39% energy | 2.0/5: 40% chi hit_combo(8), chaotic_energy(20)
1:55.632 potion Fluffy_Pillow 50.5/130: 39% energy | 2.0/5: 40% chi hit_combo(8), storm_earth_and_fire(2), chaotic_energy(20)
1:55.632 tiger_palm Fluffy_Pillow 50.5/130: 39% energy | 2.0/5: 40% chi hit_combo(8), storm_earth_and_fire(2), chaotic_energy(20), potion_of_deadly_grace
1:56.638 blackout_kick Fluffy_Pillow 11.9/130: 9% energy | 4.0/5: 80% chi hit_combo(8), storm_earth_and_fire(2), chaotic_energy(20), potion_of_deadly_grace
1:57.641 Waiting 0.100 sec 23.1/130: 18% energy | 3.0/5: 60% chi hit_combo(8), storm_earth_and_fire(2), chaotic_energy(20), potion_of_deadly_grace
1:57.741 rising_sun_kick Fluffy_Pillow 24.3/130: 19% energy | 3.0/5: 60% chi hit_combo(8), storm_earth_and_fire(2), chaotic_energy(20), potion_of_deadly_grace
1:58.956 Waiting 1.100 sec 38.0/130: 29% energy | 1.0/5: 20% chi hit_combo(8), storm_earth_and_fire(2), chaotic_energy(20), potion_of_deadly_grace
2:00.056 tiger_palm Fluffy_Pillow 50.3/130: 39% energy | 1.0/5: 20% chi hit_combo(8), storm_earth_and_fire(2), chaotic_energy(20), potion_of_deadly_grace
2:01.060 blackout_kick Fluffy_Pillow 11.6/130: 9% energy | 3.0/5: 60% chi hit_combo(8), storm_earth_and_fire(2), chaotic_energy(20), potion_of_deadly_grace
2:02.066 touch_of_death Fluffy_Pillow 23.0/130: 18% energy | 2.0/5: 40% chi hit_combo(8), storm_earth_and_fire(2), chaotic_energy(20), potion_of_deadly_grace
2:03.070 chi_wave Fluffy_Pillow 34.3/130: 26% energy | 2.0/5: 40% chi hit_combo(8), storm_earth_and_fire(2), chaotic_energy(20), potion_of_deadly_grace
2:04.075 strike_of_the_windlord Fluffy_Pillow 45.6/130: 35% energy | 2.0/5: 40% chi hit_combo(8), storm_earth_and_fire(2), chaotic_energy(20), potion_of_deadly_grace
2:05.580 energizing_elixir Fluffy_Pillow 62.5/130: 48% energy | 0.0/5: 0% chi hit_combo(8), storm_earth_and_fire(2), chaotic_energy(20), potion_of_deadly_grace
2:05.580 fists_of_fury Fluffy_Pillow 130.0/130: 100% energy | 5.0/5: 100% chi hit_combo(8), storm_earth_and_fire(2), chaotic_energy(20), potion_of_deadly_grace
2:09.354 rising_sun_kick Fluffy_Pillow 130.0/130: 100% energy | 2.0/5: 40% chi hit_combo(8), storm_earth_and_fire(2), chaotic_energy(20), potion_of_deadly_grace
2:10.358 tiger_palm Fluffy_Pillow 130.0/130: 100% energy | 0.0/5: 0% chi hit_combo(8), storm_earth_and_fire(2), chaotic_energy(20), potion_of_deadly_grace
2:11.363 whirling_dragon_punch Fluffy_Pillow 91.3/130: 70% energy | 2.0/5: 40% chi hit_combo(8), chaotic_energy(20), potion_of_deadly_grace
2:13.207 blackout_kick Fluffy_Pillow 112.1/130: 86% energy | 2.0/5: 40% chi hit_combo(8), chaotic_energy(20), potion_of_deadly_grace
2:14.211 tiger_palm Fluffy_Pillow 123.4/130: 95% energy | 1.0/5: 20% chi hit_combo(8), chaotic_energy(20), potion_of_deadly_grace
2:15.217 Waiting 0.800 sec 84.7/130: 65% energy | 3.0/5: 60% chi hit_combo(8), chaotic_energy(20), potion_of_deadly_grace
2:16.017 blackout_kick Fluffy_Pillow 93.7/130: 72% energy | 3.0/5: 60% chi hit_combo(8), chaotic_energy(20), potion_of_deadly_grace
2:17.213 tiger_palm Fluffy_Pillow 107.2/130: 82% energy | 2.0/5: 40% chi hit_combo(8), chaotic_energy(20), potion_of_deadly_grace
2:18.216 rising_sun_kick Fluffy_Pillow 68.5/130: 53% energy | 4.0/5: 80% chi hit_combo(8), chaotic_energy(20), potion_of_deadly_grace
2:19.240 chi_wave Fluffy_Pillow 80.0/130: 62% energy | 2.0/5: 40% chi hit_combo(8), chaotic_energy(20), potion_of_deadly_grace
2:20.245 blackout_kick Fluffy_Pillow 91.3/130: 70% energy | 2.0/5: 40% chi hit_combo(8), chaotic_energy(20), potion_of_deadly_grace
2:21.249 tiger_palm Fluffy_Pillow 102.6/130: 79% energy | 1.0/5: 20% chi hit_combo(8), chaotic_energy(20)
2:22.254 Waiting 0.800 sec 63.9/130: 49% energy | 3.0/5: 60% chi hit_combo(8), chaotic_energy(20)
2:23.054 blackout_kick Fluffy_Pillow 72.9/130: 56% energy | 3.0/5: 60% chi hit_combo(8), chaotic_energy(20)
2:24.249 tiger_palm Fluffy_Pillow 86.4/130: 66% energy | 2.0/5: 40% chi hit_combo(8), chaotic_energy(20)
2:25.254 Waiting 0.800 sec 47.7/130: 37% energy | 4.0/5: 80% chi hit_combo(8), chaotic_energy(20)
2:26.054 blackout_kick Fluffy_Pillow 56.7/130: 44% energy | 4.0/5: 80% chi hit_combo(8), chaotic_energy(20)
2:27.249 fists_of_fury Fluffy_Pillow 70.2/130: 54% energy | 3.0/5: 60% chi hit_combo(8), chaotic_energy(20)
2:31.023 tiger_palm Fluffy_Pillow 112.6/130: 87% energy | 0.0/5: 0% chi hit_combo(8), chaotic_energy(20)
2:32.027 rising_sun_kick Fluffy_Pillow 74.0/130: 57% energy | 2.0/5: 40% chi hit_combo(8), chaotic_energy(20)
2:33.030 whirling_dragon_punch Fluffy_Pillow 85.2/130: 66% energy | 0.0/5: 0% chi hit_combo(8), chaotic_energy(20)
2:34.814 chi_wave Fluffy_Pillow 105.3/130: 81% energy | 0.0/5: 0% chi hit_combo(8), chaotic_energy(20)
2:35.820 tiger_palm Fluffy_Pillow 116.7/130: 90% energy | 0.0/5: 0% chi hit_combo(8), chaotic_energy(20)
2:36.827 blackout_kick Fluffy_Pillow 78.0/130: 60% energy | 2.0/5: 40% chi hit_combo(8), chaotic_energy(20)
2:37.832 tiger_palm Fluffy_Pillow 89.3/130: 69% energy | 1.0/5: 20% chi hit_combo(8), chaotic_energy(20)
2:38.835 Waiting 0.800 sec 50.6/130: 39% energy | 3.0/5: 60% chi hit_combo(8), chaotic_energy(20)
2:39.635 blackout_kick Fluffy_Pillow 59.6/130: 46% energy | 3.0/5: 60% chi hit_combo(8), chaotic_energy(20)
2:40.831 rising_sun_kick Fluffy_Pillow 73.1/130: 56% energy | 2.0/5: 40% chi hit_combo(8), chaotic_energy(20)
2:41.914 tiger_palm Fluffy_Pillow 85.3/130: 66% energy | 0.0/5: 0% chi hit_combo(8), chaotic_energy(20)
2:42.920 blackout_kick Fluffy_Pillow 46.6/130: 36% energy | 2.0/5: 40% chi hit_combo(8), chaotic_energy(20)
2:43.926 tiger_palm Fluffy_Pillow 57.9/130: 45% energy | 1.0/5: 20% chi hit_combo(8), chaotic_energy(20)
2:44.932 strike_of_the_windlord Fluffy_Pillow 19.2/130: 15% energy | 3.0/5: 60% chi hit_combo(8), chaotic_energy(20)
2:46.437 Waiting 1.300 sec 36.2/130: 28% energy | 1.0/5: 20% chi hit_combo(8), chaotic_energy(20)
2:47.737 tiger_palm Fluffy_Pillow 50.8/130: 39% energy | 1.0/5: 20% chi hit_combo(8), chaotic_energy(20)
2:48.742 fists_of_fury Fluffy_Pillow 12.1/130: 9% energy | 3.0/5: 60% chi hit_combo(8), chaotic_energy(20)
2:52.597 chi_wave Fluffy_Pillow 55.5/130: 43% energy | 0.0/5: 0% chi hit_combo(8), chaotic_energy(20)
2:53.603 tiger_palm Fluffy_Pillow 66.9/130: 51% energy | 0.0/5: 0% chi hit_combo(8), chaotic_energy(20)
2:54.607 rising_sun_kick Fluffy_Pillow 28.2/130: 22% energy | 2.0/5: 40% chi hit_combo(8), chaotic_energy(20)
2:55.611 whirling_dragon_punch Fluffy_Pillow 39.5/130: 30% energy | 0.0/5: 0% chi hit_combo(8), chaotic_energy(20)
2:57.393 tiger_palm Fluffy_Pillow 59.5/130: 46% energy | 0.0/5: 0% chi hit_combo(8), chaotic_energy(20)
2:58.396 blackout_kick Fluffy_Pillow 20.8/130: 16% energy | 2.0/5: 40% chi hit_combo(8), chaotic_energy(20)
2:59.400 Waiting 1.600 sec 32.1/130: 25% energy | 1.0/5: 20% chi hit_combo(8), chaotic_energy(20)
3:01.000 tiger_palm Fluffy_Pillow 50.1/130: 39% energy | 1.0/5: 20% chi hit_combo(8), chaotic_energy(20)
3:02.004 blackout_kick Fluffy_Pillow 11.4/130: 9% energy | 3.0/5: 60% chi hit_combo(8), chaotic_energy(20)
3:03.010 Waiting 0.300 sec 22.8/130: 18% energy | 2.0/5: 40% chi hit_combo(8), chaotic_energy(20)
3:03.310 rising_sun_kick Fluffy_Pillow 26.1/130: 20% energy | 2.0/5: 40% chi hit_combo(8), chaotic_energy(20)
3:04.494 Waiting 0.900 sec 39.5/130: 30% energy | 0.0/5: 0% chi hit_combo(8), chaotic_energy(20)
3:05.394 energizing_elixir Fluffy_Pillow 49.6/130: 38% energy | 0.0/5: 0% chi hit_combo(8), chaotic_energy(20)
3:05.580 blackout_kick Fluffy_Pillow 130.0/130: 100% energy | 5.0/5: 100% chi hit_combo(8), chaotic_energy(20)
3:06.585 Waiting 0.800 sec 130.0/130: 100% energy | 4.0/5: 80% chi hit_combo(8), chaotic_energy(20)
3:07.385 chi_wave Fluffy_Pillow 130.0/130: 100% energy | 4.0/5: 80% chi hit_combo(8), chaotic_energy(20)
3:08.600 blackout_kick Fluffy_Pillow 130.0/130: 100% energy | 4.0/5: 80% chi hit_combo(8), chaotic_energy(20)
3:09.605 Waiting 0.300 sec 130.0/130: 100% energy | 3.0/5: 60% chi hit_combo(8), chaotic_energy(20)
3:09.905 fists_of_fury Fluffy_Pillow 130.0/130: 100% energy | 3.0/5: 60% chi hit_combo(8), chaotic_energy(20)
3:13.873 tiger_palm Fluffy_Pillow 130.0/130: 100% energy | 0.0/5: 0% chi hit_combo(8), chaotic_energy(20)
3:14.878 rising_sun_kick Fluffy_Pillow 91.3/130: 70% energy | 2.0/5: 40% chi hit_combo(8), chaotic_energy(20)
3:15.882 tiger_palm Fluffy_Pillow 102.6/130: 79% energy | 0.0/5: 0% chi hit_combo(8), chaotic_energy(20)
3:16.887 whirling_dragon_punch Fluffy_Pillow 63.9/130: 49% energy | 2.0/5: 40% chi hit_combo(8), chaotic_energy(20)
3:18.734 blackout_kick Fluffy_Pillow 84.7/130: 65% energy | 2.0/5: 40% chi hit_combo(8), chaotic_energy(20)
3:19.738 tiger_palm Fluffy_Pillow 96.0/130: 74% energy | 1.0/5: 20% chi hit_combo(8), chaotic_energy(20)
3:20.741 Waiting 0.800 sec 57.3/130: 44% energy | 3.0/5: 60% chi hit_combo(8), chaotic_energy(20)
3:21.541 blackout_kick Fluffy_Pillow 66.3/130: 51% energy | 3.0/5: 60% chi hit_combo(8), chaotic_energy(20)
3:22.739 storm_earth_and_fire Fluffy_Pillow 79.8/130: 61% energy | 2.0/5: 40% chi hit_combo(8), chaotic_energy(20)
3:22.739 chi_wave Fluffy_Pillow 79.8/130: 61% energy | 2.0/5: 40% chi hit_combo(8), storm_earth_and_fire(2), chaotic_energy(20)
3:23.744 rising_sun_kick Fluffy_Pillow 91.1/130: 70% energy | 2.0/5: 40% chi hit_combo(8), storm_earth_and_fire(2), chaotic_energy(20)
3:24.765 tiger_palm Fluffy_Pillow 102.6/130: 79% energy | 0.0/5: 0% chi hit_combo(8), storm_earth_and_fire(2), chaotic_energy(20)
3:25.768 strike_of_the_windlord Fluffy_Pillow 63.9/130: 49% energy | 2.0/5: 40% chi hit_combo(8), storm_earth_and_fire(2), chaotic_energy(20)
3:27.272 tiger_palm Fluffy_Pillow 80.8/130: 62% energy | 0.0/5: 0% chi hit_combo(8), storm_earth_and_fire(2), chaotic_energy(20)
3:28.277 blackout_kick Fluffy_Pillow 42.2/130: 32% energy | 2.0/5: 40% chi hit_combo(8), storm_earth_and_fire(2), chaotic_energy(20)
3:29.281 tiger_palm Fluffy_Pillow 53.5/130: 41% energy | 1.0/5: 20% chi hit_combo(8), storm_earth_and_fire(2), chaotic_energy(20)
3:30.285 Waiting 0.800 sec 14.8/130: 11% energy | 3.0/5: 60% chi hit_combo(8), storm_earth_and_fire(2), chaotic_energy(20)
3:31.085 blackout_kick Fluffy_Pillow 23.8/130: 18% energy | 3.0/5: 60% chi hit_combo(8), storm_earth_and_fire(2), chaotic_energy(20)
3:32.281 Waiting 0.200 sec 37.2/130: 29% energy | 2.0/5: 40% chi hit_combo(8), storm_earth_and_fire(2), chaotic_energy(20)
3:32.481 rising_sun_kick Fluffy_Pillow 39.5/130: 30% energy | 2.0/5: 40% chi hit_combo(8), storm_earth_and_fire(2), chaotic_energy(20)
3:33.647 tiger_palm Fluffy_Pillow 52.6/130: 40% energy | 0.0/5: 0% chi hit_combo(8), storm_earth_and_fire(2), chaotic_energy(20)
3:34.649 blackout_kick Fluffy_Pillow 13.9/130: 11% energy | 2.0/5: 40% chi hit_combo(8), storm_earth_and_fire(2), chaotic_energy(20)
3:35.653 Waiting 1.900 sec 25.2/130: 19% energy | 1.0/5: 20% chi hit_combo(8), storm_earth_and_fire(2), chaotic_energy(20)
3:37.553 chi_wave Fluffy_Pillow 46.6/130: 36% energy | 1.0/5: 20% chi hit_combo(8), storm_earth_and_fire(2), chaotic_energy(20)
3:38.744 tiger_palm Fluffy_Pillow 60.0/130: 46% energy | 1.0/5: 20% chi hit_combo(8), chaotic_energy(20)
3:39.749 fists_of_fury Fluffy_Pillow 21.3/130: 16% energy | 3.0/5: 60% chi bok_proc, hit_combo(8), chaotic_energy(20)
3:43.619 blackout_kick Fluffy_Pillow 64.9/130: 50% energy | 0.0/5: 0% chi bok_proc, hit_combo(8), chaotic_energy(20)
3:44.623 tiger_palm Fluffy_Pillow 76.2/130: 59% energy | 0.0/5: 0% chi hit_combo(8), chaotic_energy(20)
3:45.629 rising_sun_kick Fluffy_Pillow 37.5/130: 29% energy | 2.0/5: 40% chi hit_combo(8), chaotic_energy(20)
3:46.633 whirling_dragon_punch Fluffy_Pillow 48.8/130: 38% energy | 0.0/5: 0% chi hit_combo(8), chaotic_energy(20)
3:48.348 tiger_palm Fluffy_Pillow 68.1/130: 52% energy | 0.0/5: 0% chi hit_combo(8), chaotic_energy(20)
3:49.353 blackout_kick Fluffy_Pillow 29.4/130: 23% energy | 2.0/5: 40% chi hit_combo(8), chaotic_energy(20)
3:50.359 Waiting 0.900 sec 40.8/130: 31% energy | 1.0/5: 20% chi hit_combo(8), chaotic_energy(20)
3:51.259 tiger_palm Fluffy_Pillow 50.9/130: 39% energy | 1.0/5: 20% chi hit_combo(8), chaotic_energy(20)
3:52.264 blackout_kick Fluffy_Pillow 12.2/130: 9% energy | 3.0/5: 60% chi hit_combo(8), chaotic_energy(20)
3:53.358 chi_wave Fluffy_Pillow 24.5/130: 19% energy | 2.0/5: 40% chi hit_combo(8), chaotic_energy(20)
3:54.362 rising_sun_kick Fluffy_Pillow 35.8/130: 28% energy | 2.0/5: 40% chi hit_combo(8), chaotic_energy(20)
3:55.516 Waiting 0.200 sec 48.8/130: 38% energy | 0.0/5: 0% chi hit_combo(8), chaotic_energy(20)
3:55.716 tiger_palm Fluffy_Pillow 51.1/130: 39% energy | 0.0/5: 0% chi hit_combo(8), chaotic_energy(20)
3:56.720 blackout_kick Fluffy_Pillow 12.4/130: 10% energy | 2.0/5: 40% chi hit_combo(8), chaotic_energy(20)
3:57.724 Waiting 2.400 sec 23.7/130: 18% energy | 1.0/5: 20% chi hit_combo(8), chaotic_energy(20)
4:00.124 tiger_palm Fluffy_Pillow 50.7/130: 39% energy | 1.0/5: 20% chi hit_combo(8), chaotic_energy(20)
4:01.128 fists_of_fury Fluffy_Pillow 12.0/130: 9% energy | 3.0/5: 60% chi bok_proc, hit_combo(8), chaotic_energy(20)
4:04.949 blackout_kick Fluffy_Pillow 55.0/130: 42% energy | 0.0/5: 0% chi bok_proc, hit_combo(8), chaotic_energy(20)
4:05.954 energizing_elixir Fluffy_Pillow 66.3/130: 51% energy | 0.0/5: 0% chi hit_combo(8), chaotic_energy(20)
4:05.954 strike_of_the_windlord Fluffy_Pillow 130.0/130: 100% energy | 5.0/5: 100% chi hit_combo(8), chaotic_energy(20)
4:07.457 rising_sun_kick Fluffy_Pillow 130.0/130: 100% energy | 3.0/5: 60% chi hit_combo(8), chaotic_energy(20)
4:08.461 whirling_dragon_punch Fluffy_Pillow 130.0/130: 100% energy | 1.0/5: 20% chi hit_combo(8), chaotic_energy(20)
4:10.089 chi_wave Fluffy_Pillow 130.0/130: 100% energy | 1.0/5: 20% chi hit_combo(8), chaotic_energy(20)
4:11.093 tiger_palm Fluffy_Pillow 130.0/130: 100% energy | 1.0/5: 20% chi hit_combo(8), chaotic_energy(20)
4:12.097 blackout_kick Fluffy_Pillow 91.3/130: 70% energy | 3.0/5: 60% chi hit_combo(8), chaotic_energy(20)
4:13.101 tiger_palm Fluffy_Pillow 102.6/130: 79% energy | 2.0/5: 40% chi hit_combo(8), chaotic_energy(20)
4:14.106 Waiting 0.800 sec 63.9/130: 49% energy | 4.0/5: 80% chi hit_combo(8), chaotic_energy(20)
4:14.906 blackout_kick Fluffy_Pillow 72.9/130: 56% energy | 4.0/5: 80% chi hit_combo(8), chaotic_energy(20)
4:16.102 rising_sun_kick Fluffy_Pillow 86.4/130: 66% energy | 3.0/5: 60% chi hit_combo(8), chaotic_energy(20)
4:17.343 tiger_palm Fluffy_Pillow 100.4/130: 77% energy | 1.0/5: 20% chi hit_combo(8), chaotic_energy(20)
4:18.348 blackout_kick Fluffy_Pillow 61.7/130: 47% energy | 3.0/5: 60% chi hit_combo(8), chaotic_energy(20)
4:19.354 tiger_palm Fluffy_Pillow 73.0/130: 56% energy | 2.0/5: 40% chi hit_combo(8), chaotic_energy(20)
4:20.360 Waiting 0.800 sec 34.3/130: 26% energy | 4.0/5: 80% chi hit_combo(8), chaotic_energy(20)
4:21.160 blackout_kick Fluffy_Pillow 43.3/130: 33% energy | 4.0/5: 80% chi hit_combo(8), chaotic_energy(20)
4:22.353 fists_of_fury Fluffy_Pillow 56.8/130: 44% energy | 3.0/5: 60% chi hit_combo(8), chaotic_energy(20)
4:26.253 chi_wave Fluffy_Pillow 100.7/130: 77% energy | 0.0/5: 0% chi hit_combo(8), chaotic_energy(20)
4:27.258 tiger_palm Fluffy_Pillow 112.0/130: 86% energy | 0.0/5: 0% chi hit_combo(8), chaotic_energy(20)
4:28.263 rising_sun_kick Fluffy_Pillow 73.3/130: 56% energy | 2.0/5: 40% chi bok_proc, hit_combo(8), chaotic_energy(20)
4:29.267 blackout_kick Fluffy_Pillow 84.6/130: 65% energy | 0.0/5: 0% chi bok_proc, hit_combo(8), chaotic_energy(20)
4:30.273 whirling_dragon_punch Fluffy_Pillow 95.9/130: 74% energy | 0.0/5: 0% chi hit_combo(8), chaotic_energy(20)
4:32.101 tiger_palm Fluffy_Pillow 116.5/130: 90% energy | 0.0/5: 0% chi hit_combo(8), chaotic_energy(20)
4:33.105 blackout_kick Fluffy_Pillow 77.8/130: 60% energy | 2.0/5: 40% chi hit_combo(8), chaotic_energy(20)
4:34.111 tiger_palm Fluffy_Pillow 89.1/130: 69% energy | 1.0/5: 20% chi hit_combo(8), chaotic_energy(20)
4:35.116 storm_earth_and_fire Fluffy_Pillow 50.5/130: 39% energy | 3.0/5: 60% chi hit_combo(8), chaotic_energy(20)
4:35.116 Waiting 0.800 sec 50.5/130: 39% energy | 3.0/5: 60% chi hit_combo(8), storm_earth_and_fire(2), chaotic_energy(20)
4:35.916 blackout_kick Fluffy_Pillow 59.5/130: 46% energy | 3.0/5: 60% chi hit_combo(8), storm_earth_and_fire(2), chaotic_energy(20)
4:37.109 rising_sun_kick Fluffy_Pillow 72.9/130: 56% energy | 2.0/5: 40% chi hit_combo(8), storm_earth_and_fire(2), chaotic_energy(20)
4:38.148 tiger_palm Fluffy_Pillow 84.6/130: 65% energy | 0.0/5: 0% chi hit_combo(8), storm_earth_and_fire(2), chaotic_energy(20)
4:39.154 blackout_kick Fluffy_Pillow 45.9/130: 35% energy | 2.0/5: 40% chi hit_combo(8), storm_earth_and_fire(2), chaotic_energy(20)
4:40.159 tiger_palm Fluffy_Pillow 57.2/130: 44% energy | 1.0/5: 20% chi hit_combo(8), storm_earth_and_fire(2), chaotic_energy(20)
4:41.163 touch_of_death Fluffy_Pillow 18.5/130: 14% energy | 3.0/5: 60% chi hit_combo(8), storm_earth_and_fire(2), chaotic_energy(20)
4:42.168 chi_wave Fluffy_Pillow 29.8/130: 23% energy | 3.0/5: 60% chi hit_combo(8), storm_earth_and_fire(2), chaotic_energy(20)
4:43.173 blackout_kick Fluffy_Pillow 41.2/130: 32% energy | 3.0/5: 60% chi hit_combo(8), storm_earth_and_fire(2), chaotic_energy(20)
4:44.177 tiger_palm Fluffy_Pillow 52.5/130: 40% energy | 2.0/5: 40% chi hit_combo(8), storm_earth_and_fire(2), chaotic_energy(20)
4:45.182 fists_of_fury Fluffy_Pillow 13.8/130: 11% energy | 4.0/5: 80% chi hit_combo(8), storm_earth_and_fire(2), chaotic_energy(20)
4:48.906 tiger_palm Fluffy_Pillow 55.7/130: 43% energy | 1.0/5: 20% chi hit_combo(8), storm_earth_and_fire(2), chaotic_energy(20)
4:49.911 strike_of_the_windlord Fluffy_Pillow 17.0/130: 13% energy | 3.0/5: 60% chi hit_combo(8), storm_earth_and_fire(2), chaotic_energy(20)
4:51.414 Waiting 1.500 sec 33.9/130: 26% energy | 1.0/5: 20% chi hit_combo(8), chaotic_energy(20)
4:52.914 tiger_palm Fluffy_Pillow 50.8/130: 39% energy | 1.0/5: 20% chi hit_combo(8), chaotic_energy(20)
4:53.918 rising_sun_kick Fluffy_Pillow 12.1/130: 9% energy | 3.0/5: 60% chi hit_combo(8), chaotic_energy(20)
4:54.922 whirling_dragon_punch Fluffy_Pillow 23.4/130: 18% energy | 1.0/5: 20% chi hit_combo(8), chaotic_energy(20)
4:56.765 Waiting 0.200 sec 44.2/130: 34% energy | 1.0/5: 20% chi hit_combo(8), chaotic_energy(20)
4:56.965 chi_wave Fluffy_Pillow 46.4/130: 36% energy | 1.0/5: 20% chi hit_combo(8), chaotic_energy(20)
4:58.171 tiger_palm Fluffy_Pillow 60.0/130: 46% energy | 1.0/5: 20% chi hit_combo(8), chaotic_energy(20)
4:59.175 blackout_kick Fluffy_Pillow 21.3/130: 16% energy | 3.0/5: 60% chi hit_combo(8), chaotic_energy(20)
5:00.179 Waiting 1.600 sec 32.6/130: 25% energy | 2.0/5: 40% chi hit_combo(8), chaotic_energy(20)
5:01.779 tiger_palm Fluffy_Pillow 50.6/130: 39% energy | 2.0/5: 40% chi hit_combo(8), chaotic_energy(20)
5:02.782 rising_sun_kick Fluffy_Pillow 11.9/130: 9% energy | 4.0/5: 80% chi hit_combo(8), chaotic_energy(20)
5:03.804 blackout_kick Fluffy_Pillow 23.4/130: 18% energy | 2.0/5: 40% chi hit_combo(8), chaotic_energy(20)
5:04.808 Waiting 0.900 sec 34.7/130: 27% energy | 1.0/5: 20% chi hit_combo(8), chaotic_energy(20)
5:05.708 energizing_elixir Fluffy_Pillow 44.9/130: 35% energy | 1.0/5: 20% chi hit_combo(8), chaotic_energy(20)
5:05.954 Waiting 0.300 sec 130.0/130: 100% energy | 5.0/5: 100% chi hit_combo(8), chaotic_energy(20)
5:06.254 fists_of_fury Fluffy_Pillow 130.0/130: 100% energy | 5.0/5: 100% chi hit_combo(8), chaotic_energy(20)
5:10.293 blackout_kick Fluffy_Pillow 130.0/130: 100% energy | 2.0/5: 40% chi hit_combo(8), chaotic_energy(20)
5:11.298 tiger_palm Fluffy_Pillow 130.0/130: 100% energy | 1.0/5: 20% chi hit_combo(8), chaotic_energy(20)
5:12.303 rising_sun_kick Fluffy_Pillow 91.3/130: 70% energy | 3.0/5: 60% chi hit_combo(8), chaotic_energy(20)
5:13.309 chi_wave Fluffy_Pillow 102.6/130: 79% energy | 1.0/5: 20% chi hit_combo(8), chaotic_energy(20)
5:14.313 tiger_palm Fluffy_Pillow 113.9/130: 88% energy | 1.0/5: 20% chi hit_combo(8), chaotic_energy(20)
5:15.316 blackout_kick Fluffy_Pillow 75.2/130: 58% energy | 3.0/5: 60% chi hit_combo(8), chaotic_energy(20)
5:16.320 whirling_dragon_punch Fluffy_Pillow 86.5/130: 67% energy | 2.0/5: 40% chi hit_combo(8), chaotic_energy(20)
5:18.086 blackout_kick Fluffy_Pillow 106.4/130: 82% energy | 2.0/5: 40% chi hit_combo(8), chaotic_energy(20)
5:19.321 tiger_palm Fluffy_Pillow 120.3/130: 93% energy | 1.0/5: 20% chi hit_combo(8), chaotic_energy(20)
5:20.325 Waiting 0.700 sec 81.6/130: 63% energy | 3.0/5: 60% chi hit_combo(8), chaotic_energy(20)
5:21.025 rising_sun_kick Fluffy_Pillow 89.5/130: 69% energy | 3.0/5: 60% chi hit_combo(8), chaotic_energy(20)
5:22.190 tiger_palm Fluffy_Pillow 102.6/130: 79% energy | 1.0/5: 20% chi hit_combo(8), chaotic_energy(20)
5:23.195 blackout_kick Fluffy_Pillow 63.9/130: 49% energy | 3.0/5: 60% chi hit_combo(8), chaotic_energy(20)
5:24.199 tiger_palm Fluffy_Pillow 75.2/130: 58% energy | 2.0/5: 40% chi hit_combo(8), chaotic_energy(20)
5:25.203 Waiting 0.800 sec 36.5/130: 28% energy | 4.0/5: 80% chi hit_combo(8), chaotic_energy(20)
5:26.003 blackout_kick Fluffy_Pillow 45.6/130: 35% energy | 4.0/5: 80% chi hit_combo(8), chaotic_energy(20)
5:27.202 Waiting 0.400 sec 59.0/130: 45% energy | 3.0/5: 60% chi hit_combo(8), chaotic_energy(20)
5:27.602 fists_of_fury Fluffy_Pillow 63.6/130: 49% energy | 3.0/5: 60% chi hit_combo(8), chaotic_energy(20)
5:31.734 chi_wave Fluffy_Pillow 110.1/130: 85% energy | 0.0/5: 0% chi hit_combo(8), chaotic_energy(20)
5:32.740 tiger_palm Fluffy_Pillow 121.4/130: 93% energy | 0.0/5: 0% chi hit_combo(8), chaotic_energy(20)
5:33.743 strike_of_the_windlord Fluffy_Pillow 82.7/130: 64% energy | 2.0/5: 40% chi hit_combo(8), chaotic_energy(20)
5:35.249 tiger_palm Fluffy_Pillow 99.6/130: 77% energy | 0.0/5: 0% chi hit_combo(8), chaotic_energy(20)
5:36.253 rising_sun_kick Fluffy_Pillow 60.9/130: 47% energy | 2.0/5: 40% chi hit_combo(8), chaotic_energy(20)
5:37.258 tiger_palm Fluffy_Pillow 72.3/130: 56% energy | 0.0/5: 0% chi hit_combo(8), chaotic_energy(20)
5:38.263 whirling_dragon_punch Fluffy_Pillow 33.6/130: 26% energy | 2.0/5: 40% chi bok_proc, hit_combo(8), chaotic_energy(20)
5:39.956 blackout_kick Fluffy_Pillow 52.6/130: 40% energy | 2.0/5: 40% chi bok_proc, hit_combo(8), chaotic_energy(20)
5:40.960 tiger_palm Fluffy_Pillow 63.9/130: 49% energy | 2.0/5: 40% chi hit_combo(8), chaotic_energy(20)
5:41.963 Waiting 0.800 sec 25.2/130: 19% energy | 4.0/5: 80% chi hit_combo(8), chaotic_energy(20)
5:42.763 blackout_kick Fluffy_Pillow 34.2/130: 26% energy | 4.0/5: 80% chi hit_combo(8), chaotic_energy(20)
5:43.961 Waiting 1.000 sec 47.7/130: 37% energy | 3.0/5: 60% chi hit_combo(8), chaotic_energy(20)
5:44.961 rising_sun_kick Fluffy_Pillow 59.0/130: 45% energy | 3.0/5: 60% chi hit_combo(8), chaotic_energy(20)
5:46.139 tiger_palm Fluffy_Pillow 72.2/130: 56% energy | 1.0/5: 20% chi hit_combo(8), chaotic_energy(20)
5:47.143 chi_wave Fluffy_Pillow 33.5/130: 26% energy | 3.0/5: 60% chi hit_combo(8), chaotic_energy(20)
5:48.148 blackout_kick Fluffy_Pillow 44.9/130: 35% energy | 3.0/5: 60% chi hit_combo(8), chaotic_energy(20)
5:49.154 tiger_palm Fluffy_Pillow 56.2/130: 43% energy | 2.0/5: 40% chi hit_combo(8), chaotic_energy(20)
5:50.159 fists_of_fury Fluffy_Pillow 17.5/130: 13% energy | 4.0/5: 80% chi hit_combo(8), chaotic_energy(20)
5:53.894 tiger_palm Fluffy_Pillow 59.6/130: 46% energy | 1.0/5: 20% chi hit_combo(8), chaotic_energy(20)
5:54.899 rising_sun_kick Fluffy_Pillow 20.9/130: 16% energy | 3.0/5: 60% chi hit_combo(8), chaotic_energy(20)
5:55.905 Waiting 1.600 sec 32.2/130: 25% energy | 1.0/5: 20% chi hit_combo(8), chaotic_energy(20)
5:57.505 tiger_palm Fluffy_Pillow 50.2/130: 39% energy | 1.0/5: 20% chi hit_combo(8), chaotic_energy(20)
5:58.510 blackout_kick Fluffy_Pillow 11.5/130: 9% energy | 3.0/5: 60% chi hit_combo(8), chaotic_energy(20)
5:59.515 whirling_dragon_punch Fluffy_Pillow 22.8/130: 18% energy | 2.0/5: 40% chi hit_combo(8), chaotic_energy(20)
6:01.376 blackout_kick Fluffy_Pillow 43.8/130: 34% energy | 2.0/5: 40% chi hit_combo(8), chaotic_energy(20)
6:02.515 storm_earth_and_fire Fluffy_Pillow 56.6/130: 44% energy | 1.0/5: 20% chi hit_combo(8), chaotic_energy(20)
6:02.515 chi_wave Fluffy_Pillow 56.6/130: 44% energy | 1.0/5: 20% chi hit_combo(8), storm_earth_and_fire(2), chaotic_energy(20)
6:03.518 tiger_palm Fluffy_Pillow 67.9/130: 52% energy | 1.0/5: 20% chi hit_combo(8), storm_earth_and_fire(2), chaotic_energy(20)
6:04.522 rising_sun_kick Fluffy_Pillow 29.2/130: 22% energy | 3.0/5: 60% chi hit_combo(8), storm_earth_and_fire(2), chaotic_energy(20)
6:05.527 Waiting 0.200 sec 40.5/130: 31% energy | 1.0/5: 20% chi hit_combo(8), storm_earth_and_fire(2), chaotic_energy(20)
6:05.727 energizing_elixir Fluffy_Pillow 42.8/130: 33% energy | 1.0/5: 20% chi hit_combo(8), storm_earth_and_fire(2), chaotic_energy(20)
6:05.954 blackout_kick Fluffy_Pillow 130.0/130: 100% energy | 5.0/5: 100% chi hit_combo(8), storm_earth_and_fire(2), chaotic_energy(20)
6:06.957 Waiting 4.300 sec 130.0/130: 100% energy | 4.0/5: 80% chi hit_combo(8), storm_earth_and_fire(2), chaotic_energy(20)
6:11.257 fists_of_fury Fluffy_Pillow 130.0/130: 100% energy | 4.0/5: 80% chi hit_combo(8), storm_earth_and_fire(2), chaotic_energy(20)
6:15.316 tiger_palm Fluffy_Pillow 130.0/130: 100% energy | 1.0/5: 20% chi hit_combo(8), storm_earth_and_fire(2), chaotic_energy(20)
6:16.321 strike_of_the_windlord Fluffy_Pillow 91.3/130: 70% energy | 3.0/5: 60% chi hit_combo(8), storm_earth_and_fire(2), chaotic_energy(20)
6:17.825 chi_wave Fluffy_Pillow 108.2/130: 83% energy | 1.0/5: 20% chi hit_combo(8), chaotic_energy(20)
6:18.829 tiger_palm Fluffy_Pillow 119.5/130: 92% energy | 1.0/5: 20% chi hit_combo(8), chaotic_energy(20)
6:19.834 rising_sun_kick Fluffy_Pillow 80.9/130: 62% energy | 3.0/5: 60% chi hit_combo(8), chaotic_energy(20)
6:20.840 whirling_dragon_punch Fluffy_Pillow 92.2/130: 71% energy | 1.0/5: 20% chi hit_combo(8), chaotic_energy(20)
6:22.736 tiger_palm Fluffy_Pillow 113.5/130: 87% energy | 1.0/5: 20% chi hit_combo(8), chaotic_energy(20)
6:23.740 blackout_kick Fluffy_Pillow 74.8/130: 58% energy | 3.0/5: 60% chi hit_combo(8), chaotic_energy(20)
6:24.745 tiger_palm Fluffy_Pillow 86.2/130: 66% energy | 2.0/5: 40% chi hit_combo(8), chaotic_energy(20)
6:25.751 Waiting 0.800 sec 47.5/130: 37% energy | 4.0/5: 80% chi hit_combo(8), chaotic_energy(20)
6:26.551 blackout_kick Fluffy_Pillow 56.5/130: 43% energy | 4.0/5: 80% chi hit_combo(8), chaotic_energy(20)
6:27.743 Waiting 0.800 sec 69.9/130: 54% energy | 3.0/5: 60% chi hit_combo(8), chaotic_energy(20)
6:28.543 rising_sun_kick Fluffy_Pillow 78.9/130: 61% energy | 3.0/5: 60% chi hit_combo(8), chaotic_energy(20)
6:29.721 tiger_palm Fluffy_Pillow 92.2/130: 71% energy | 1.0/5: 20% chi hit_combo(8), chaotic_energy(20)
6:30.727 blackout_kick Fluffy_Pillow 53.5/130: 41% energy | 3.0/5: 60% chi hit_combo(8), chaotic_energy(20)
6:31.732 tiger_palm Fluffy_Pillow 64.8/130: 50% energy | 2.0/5: 40% chi hit_combo(8), chaotic_energy(20)
6:32.736 fists_of_fury Fluffy_Pillow 26.1/130: 20% energy | 4.0/5: 80% chi hit_combo(8), chaotic_energy(20)
6:36.577 chi_wave Fluffy_Pillow 69.4/130: 53% energy | 1.0/5: 20% chi hit_combo(8), chaotic_energy(20)
6:37.582 tiger_palm Fluffy_Pillow 80.7/130: 62% energy | 1.0/5: 20% chi hit_combo(8), chaotic_energy(20)
6:38.588 rising_sun_kick Fluffy_Pillow 42.0/130: 32% energy | 3.0/5: 60% chi hit_combo(8), chaotic_energy(20)
6:39.592 tiger_palm Fluffy_Pillow 53.3/130: 41% energy | 1.0/5: 20% chi hit_combo(8), chaotic_energy(20)
6:40.594 blackout_kick Fluffy_Pillow 14.6/130: 11% energy | 3.0/5: 60% chi hit_combo(8), chaotic_energy(20)
6:41.598 Waiting 0.400 sec 25.9/130: 20% energy | 2.0/5: 40% chi hit_combo(8), chaotic_energy(20)
6:41.998 whirling_dragon_punch Fluffy_Pillow 30.4/130: 23% energy | 2.0/5: 40% chi hit_combo(8), chaotic_energy(20)
6:43.921 blackout_kick Fluffy_Pillow 52.0/130: 40% energy | 2.0/5: 40% chi hit_combo(8), chaotic_energy(20)
6:44.924 tiger_palm Fluffy_Pillow 63.3/130: 49% energy | 1.0/5: 20% chi hit_combo(8), chaotic_energy(20)
6:45.929 Waiting 0.800 sec 24.6/130: 19% energy | 3.0/5: 60% chi hit_combo(8), chaotic_energy(20)
6:46.729 blackout_kick Fluffy_Pillow 33.7/130: 26% energy | 3.0/5: 60% chi hit_combo(8), chaotic_energy(20)
6:47.927 rising_sun_kick Fluffy_Pillow 47.1/130: 36% energy | 2.0/5: 40% chi hit_combo(8), chaotic_energy(20)
6:48.931 tiger_palm Fluffy_Pillow 58.4/130: 45% energy | 0.0/5: 0% chi hit_combo(8), chaotic_energy(20)
6:49.936 blackout_kick Fluffy_Pillow 19.8/130: 15% energy | 2.0/5: 40% chi bok_proc, hit_combo(8), chaotic_energy(20)
6:50.941 Waiting 0.200 sec 31.1/130: 24% energy | 2.0/5: 40% chi hit_combo(8), chaotic_energy(20)
6:51.141 touch_of_death Fluffy_Pillow 33.3/130: 26% energy | 2.0/5: 40% chi hit_combo(8), chaotic_energy(20)
6:52.147 chi_wave Fluffy_Pillow 44.6/130: 34% energy | 2.0/5: 40% chi hit_combo(8), chaotic_energy(20)
6:53.151 blackout_kick Fluffy_Pillow 56.0/130: 43% energy | 2.0/5: 40% chi hit_combo(8), chaotic_energy(20)
6:54.157 tiger_palm Fluffy_Pillow 67.3/130: 52% energy | 1.0/5: 20% chi hit_combo(8), chaotic_energy(20)
6:55.159 fists_of_fury Fluffy_Pillow 28.6/130: 22% energy | 3.0/5: 60% chi hit_combo(8), chaotic_energy(20)
6:58.955 tiger_palm Fluffy_Pillow 71.3/130: 55% energy | 0.0/5: 0% chi hit_combo(8), chaotic_energy(20)
6:59.959 strike_of_the_windlord Fluffy_Pillow 32.6/130: 25% energy | 2.0/5: 40% chi bok_proc, hit_combo(8), chaotic_energy(20)
7:01.463 blackout_kick Fluffy_Pillow 49.5/130: 38% energy | 0.0/5: 0% chi bok_proc, hit_combo(8), chaotic_energy(20)
7:02.466 tiger_palm Fluffy_Pillow 60.8/130: 47% energy | 0.0/5: 0% chi hit_combo(8), chaotic_energy(20)
7:03.469 rising_sun_kick Fluffy_Pillow 22.1/130: 17% energy | 2.0/5: 40% chi hit_combo(8), chaotic_energy(20)
7:04.475 whirling_dragon_punch Fluffy_Pillow 33.4/130: 26% energy | 0.0/5: 0% chi hit_combo(8), chaotic_energy(20)
7:06.317 energizing_elixir Fluffy_Pillow 54.2/130: 42% energy | 0.0/5: 0% chi hit_combo(8), chaotic_energy(20)
7:06.317 blackout_kick Fluffy_Pillow 130.0/130: 100% energy | 5.0/5: 100% chi hit_combo(8), chaotic_energy(20)
7:07.321 chi_wave Fluffy_Pillow 130.0/130: 100% energy | 4.0/5: 80% chi hit_combo(8), chaotic_energy(20)
7:08.325 Waiting 0.800 sec 130.0/130: 100% energy | 4.0/5: 80% chi hit_combo(8), chaotic_energy(20)
7:09.125 blackout_kick Fluffy_Pillow 130.0/130: 100% energy | 4.0/5: 80% chi hit_combo(8), chaotic_energy(20)
7:10.323 Waiting 1.800 sec 130.0/130: 100% energy | 3.0/5: 60% chi hit_combo(8), chaotic_energy(20)
7:12.123 rising_sun_kick Fluffy_Pillow 130.0/130: 100% energy | 3.0/5: 60% chi hit_combo(8), chaotic_energy(20)
7:13.354 tiger_palm Fluffy_Pillow 130.0/130: 100% energy | 1.0/5: 20% chi hit_combo(8), chaotic_energy(20)
7:14.357 blackout_kick Fluffy_Pillow 91.3/130: 70% energy | 3.0/5: 60% chi hit_combo(8), chaotic_energy(20)
7:15.362 tiger_palm Fluffy_Pillow 102.6/130: 79% energy | 2.0/5: 40% chi hit_combo(8), chaotic_energy(20)
7:16.367 fists_of_fury Fluffy_Pillow 63.9/130: 49% energy | 4.0/5: 80% chi hit_combo(8), chaotic_energy(20)
7:20.181 tiger_palm Fluffy_Pillow 106.9/130: 82% energy | 1.0/5: 20% chi hit_combo(8), chaotic_energy(20)
7:21.186 rising_sun_kick Fluffy_Pillow 68.2/130: 52% energy | 3.0/5: 60% chi hit_combo(8), chaotic_energy(20)
7:22.236 chi_wave Fluffy_Pillow 80.0/130: 62% energy | 1.0/5: 20% chi hit_combo(8), chaotic_energy(20)
7:23.328 tiger_palm Fluffy_Pillow 92.3/130: 71% energy | 1.0/5: 20% chi hit_combo(8), chaotic_energy(20)
7:24.333 blackout_kick Fluffy_Pillow 53.6/130: 41% energy | 3.0/5: 60% chi bok_proc, hit_combo(8), chaotic_energy(20)
7:25.338 Waiting 0.300 sec 64.9/130: 50% energy | 3.0/5: 60% chi hit_combo(8), chaotic_energy(20)
7:25.638 whirling_dragon_punch Fluffy_Pillow 68.3/130: 53% energy | 3.0/5: 60% chi hit_combo(8), chaotic_energy(20)
7:27.515 blackout_kick Fluffy_Pillow 89.4/130: 69% energy | 3.0/5: 60% chi hit_combo(8), chaotic_energy(20)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4723 4398 0
Agility 21584 19877 9898 (8594)
Stamina 28600 28600 17979
Intellect 7653 7328 0
Spirit 0 0 0
Health 1716000 1716000 0
Energy 130 130 0
Chi 5 5 0
Crit 27.67% 27.67% 4084
Haste 12.58% 12.58% 4089
Damage / Heal Versatility 4.27% 4.27% 1707
ManaReg per Second 8800 8800 0
Attack Power 21584 19877 0
Mastery 40.94% 39.60% 8289
Armor 1970 1970 1970
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 846.00
Local Head Steelgazer Hide Hood
ilevel: 840, stats: { 259 Armor, +1182 AgiInt, +1773 Sta, +899 Haste, +359 Vers }
Local Neck Lavadrip Pendant
ilevel: 840, stats: { +997 Sta, +1061 Mastery, +707 Haste }
Local Shoulders Brinewashed Leather Shoulderpads
ilevel: 840, stats: { 239 Armor, +886 AgiInt, +1329 Sta, +552 Mastery, +391 Vers }
Local Chest Tranquil Bough Vest
ilevel: 840, stats: { 318 Armor, +1182 AgiInt, +1773 Sta, +844 Haste, +413 Mastery }
Local Waist Raven's Veil Belt
ilevel: 850, stats: { 185 Armor, +973 AgiInt, +1459 Sta, +615 Crit, +363 Haste }, gems: { +150 Mastery }
Local Legs Grandmaster's Legguards
ilevel: 840, stats: { 279 Armor, +1772 Sta, +1182 AgiInt, +899 Crit, +359 Vers }
Local Feet Brinewashed Leather Boots
ilevel: 845, stats: { 223 Armor, +929 AgiInt, +1393 Sta, +645 Mastery, +315 Vers }
Local Wrists Thermal Bindings
ilevel: 835, stats: { 137 Armor, +635 AgiInt, +952 Sta, +466 Mastery, +228 Crit }, gems: { +150 Mastery }
Local Hands Swordsinger's Grips
ilevel: 845, stats: { 202 Armor, +929 AgiInt, +1393 Sta, +584 Mastery, +378 Haste }
Local Finger1 Empowered Ring of the Kirin Tor
ilevel: 850, stats: { +1094 Sta, +1180 Mastery, +655 Crit }, enchant: { +150 Mastery }
Local Finger2 Val'kyr Ascension Signet
ilevel: 845, stats: { +1045 Sta, +1081 Crit, +721 Mastery }, gems: { +150 Mastery }
Local Trinket1 Chaos Talisman
ilevel: 840, stats: { +898 Haste }, gems: { +150 Mastery }
Local Trinket2 Terrorbound Nexus
ilevel: 840, stats: { +898 Mastery }
Local Back Stole of Malefic Repose
ilevel: 845, stats: { 128 Armor, +696 StrAgiInt, +1045 Sta, +437 Mastery, +283 Vers }
Local Main Hand Fists of the Heavens
ilevel: 867, weapon: { 3861 - 7172, 2.6 }, stats: { +652 Agi, +977 Sta, +303 Crit, +291 Mastery }, relics: { +40 ilevels, +37 ilevels, +40 ilevels }
Local Off Hand Fists of the Heavens
ilevel: 867, weapon: { 3861 - 7172, 2.6 }, stats: { +652 Agi, +977 Sta, +303 Crit, +291 Mastery }

Talents

Level
15 Chi Burst Eye of the Tiger Chi Wave
30 Chi Torpedo Tiger's Lust Celerity
45 Energizing Elixir (Windwalker Monk) Ascension (Windwalker Monk) Power Strikes (Windwalker Monk)
60 Ring of Peace Dizzying Kicks (Windwalker Monk) Leg Sweep
75 Healing Elixir Diffuse Magic Dampen Harm
90 Rushing Jade Wind Invoke Xuen, the White Tiger (Windwalker Monk) Hit Combo (Windwalker Monk)
100 Chi Orbit (Windwalker Monk) Whirling Dragon Punch (Windwalker Monk) Serenity (Windwalker Monk)

Profile

monk="Ehöl"
origin="https://eu.api.battle.net/wow/character/hyjal/Ehöl/advanced"
thumbnail="http://eu.battle.net/static-render/eu/hyjal/6/114255878-avatar.jpg"
level=110
race=night_elf
timeofday=day
role=dps
position=back
professions=alchemy=600/enchanting=607
talents=http://eu.battle.net/wow/en/tool/talent-calculator#fb!2102021
artifact=50:0:0:0:0:800:3:801:3:820:3:822:3:825:3:827:1:830:1:831:1:1341:1
spec=windwalker

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=nightborne_delicacy_platter
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=deadly_grace

# Executed every time the actor is available.
actions=auto_attack
actions+=/invoke_xuen
actions+=/potion,name=deadly_grace,if=buff.serenity.up|buff.storm_earth_and_fire.up|(!talent.serenity.enabled&trinket.proc.agility.react)|buff.bloodlust.react|target.time_to_die<=60
actions+=/touch_of_death,if=!artifact.gale_burst.enabled
actions+=/touch_of_death,if=artifact.gale_burst.enabled&cooldown.strike_of_the_windlord.remains<8&cooldown.fists_of_fury.remains<=3&cooldown.rising_sun_kick.remains<8
actions+=/blood_fury
actions+=/berserking
actions+=/arcane_torrent,if=chi.max-chi>=1
actions+=/storm_earth_and_fire,if=artifact.strike_of_the_windlord.enabled&cooldown.strike_of_the_windlord.remains<14&cooldown.fists_of_fury.remains<=9&cooldown.rising_sun_kick.remains<=5
actions+=/storm_earth_and_fire,if=!artifact.strike_of_the_windlord.enabled&cooldown.fists_of_fury.remains<=9&cooldown.rising_sun_kick.remains<=5
actions+=/serenity,if=artifact.strike_of_the_windlord.enabled&cooldown.strike_of_the_windlord.remains<7&cooldown.fists_of_fury.remains<=3&cooldown.rising_sun_kick.remains<8
actions+=/serenity,if=!artifact.strike_of_the_windlord.enabled&cooldown.fists_of_fury.remains<=3&cooldown.rising_sun_kick.remains<8
actions+=/energizing_elixir,if=energy<energy.max&chi<=1&buff.serenity.down
actions+=/rushing_jade_wind,if=buff.serenity.up&!prev_gcd.rushing_jade_wind
actions+=/strike_of_the_windlord
actions+=/whirling_dragon_punch
actions+=/fists_of_fury
actions+=/call_action_list,name=st,if=active_enemies<3
actions+=/call_action_list,name=aoe,if=active_enemies>=3

actions.opener=blood_fury
actions.opener+=/berserking
actions.opener+=/arcane_torrent,if=chi.max-chi>=1
actions.opener+=/fists_of_fury,if=buff.serenity.up&buff.serenity.remains<1.5
actions.opener+=/rising_sun_kick
actions.opener+=/blackout_kick,if=chi.max-chi<=1&cooldown.chi_brew.up|buff.serenity.up
actions.opener+=/serenity,if=chi.max-chi<=2
actions.opener+=/tiger_palm,if=chi.max-chi>=2&!buff.serenity.up

actions.st=rising_sun_kick
actions.st+=/rushing_jade_wind,if=chi>1&!prev_gcd.rushing_jade_wind
actions.st+=/chi_wave,if=energy.time_to_max>2|buff.serenity.down
actions.st+=/chi_burst,if=energy.time_to_max>2|buff.serenity.down
actions.st+=/blackout_kick,if=(chi>1|buff.bok_proc.up)&buff.serenity.down&!prev_gcd.blackout_kick
actions.st+=/tiger_palm,if=(buff.serenity.down&chi<=2)&!prev_gcd.tiger_palm

actions.aoe=spinning_crane_kick,if=!prev_gcd.spinning_crane_kick
actions.aoe+=/rising_sun_kick,cycle_targets=1
actions.aoe+=/rushing_jade_wind,if=chi>1&!prev_gcd.rushing_jade_wind
actions.aoe+=/chi_wave,if=energy.time_to_max>2|buff.serenity.down
actions.aoe+=/chi_burst,if=energy.time_to_max>2|buff.serenity.down
actions.aoe+=/blackout_kick,if=(chi>1|buff.bok_proc.up)&!prev_gcd.blackout_kick,cycle_targets=1
actions.aoe+=/tiger_palm,if=(buff.serenity.down&chi.max-chi>1)&!prev_gcd.tiger_palm,cycle_targets=1

head=steelgazer_hide_hood,id=134152,bonus_id=1727/1502/1813
neck=lavadrip_pendant,id=137535,bonus_id=1727/1492/1813
shoulders=brinewashed_leather_shoulderpads,id=134242,bonus_id=3397/1502/3336
back=stole_of_malefic_repose,id=134404,bonus_id=1727/1497/3336
chest=tranquil_bough_vest,id=139071,bonus_id=1727/1502/1813
wrists=thermal_bindings,id=134461,bonus_id=1726/1808/1487/3339,gems=150mastery
hands=swordsingers_grips,id=134283,bonus_id=3397/1507/3337
waist=ravens_veil_belt,id=139243,bonus_id=1727/1808/1502/3336,gems=150mastery
legs=grandmasters_legguards,id=139735,bonus_id=3386/3384
feet=brinewashed_leather_boots,id=134237,bonus_id=1727/1507/3336
finger1=empowered_ring_of_the_kirin_tor,id=139599,enchant=150mastery
finger2=valkyr_ascension_signet,id=133679,bonus_id=1727/1808/1497/3336,gems=150mastery
trinket1=chaos_talisman,id=137459,bonus_id=1727/1808/1492/1813,gems=150mastery
trinket2=terrorbound_nexus,id=137406,bonus_id=1727/1492/1813
main_hand=fists_of_the_heavens,id=128940,bonus_id=734,gem_id=137365/141262/141258/0,relic_id=1727:1492:1813/3396:1492:3339/1825:1502:3337/0
off_hand=fists_of_the_heavens,id=133948

# Gear Summary
# gear_ilvl=845.56
# gear_agility=9898
# gear_stamina=17979
# gear_crit_rating=4084
# gear_haste_rating=4089
# gear_mastery_rating=8289
# gear_versatility_rating=1707
# gear_armor=1970

Malikoom

Malikoom : 5373 dps

  • Race: Pandaren Alliance
  • Class: Monk
  • Spec: Windwalker
  • Level: 100
  • Role: Dps
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
5372.7 5372.7 13.6 / 0.252% 2735.3 / 50.9% 653.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.0 8.0 Energy 37.10% 31.5 100.0% 100%
Origin https://eu.api.battle.net/wow/character/hyjal/Malikoom/advanced
Talents
  • 15: Chi Wave
  • 30: Tiger's Lust
  • 45: Energizing Elixir (Windwalker Monk)
  • 60: Leg Sweep
  • 75: Diffuse Magic
  • 90: Rushing Jade Wind
  • 100: Whirling Dragon Punch (Windwalker Monk)
  • Talent Calculator
Professions
  • mining: 585
  • jewelcrafting: 90

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% G% Up%
Malikoom 5373
Blackout Kick 518 9.6% 28.6 14.67sec 8152 8116 Direct 28.6 8999 17999 8153 20.6% 30.0% 0.0%  

Stats details: blackout_kick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.63 28.63 0.00 0.00 1.0045 0.0000 233392.83 457993.01 49.04 8116.04 8116.04
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.17 49.48% 8999.36 4422 12292 8992.62 4422 11059 127487 250171 49.04
crit 5.88 20.55% 17998.55 8844 24584 17908.33 0 24584 105906 207822 48.83
dodge 4.30 15.02% 0.00 0 0 0.00 0 0 0 0 0.00
miss 4.28 14.94% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: blackout_kick

Static Values
  • id:100784
  • school:physical
  • resource:chi
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:3.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:chi.max-chi<=1&cooldown.chi_brew.up|buff.serenity.up
Spelldata
  • id:100784
  • name:Blackout Kick
  • school:physical
  • tooltip:
  • description:Kick with a blast of Chi energy, dealing {$s1=0} Physical damage.
 
Fists of Fury 1806 33.6% 15.5 29.34sec 52602 13734 Periodic 77.0 11666 23336 10563 20.6% 30.1% 0.0% 12.3%

Stats details: fists_of_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.47 0.00 77.04 77.04 3.8302 0.7186 813756.30 1596855.86 49.04 13733.59 13733.59
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.0 49.32% 11666.43 6030 16762 11670.76 8425 13835 443246 869793 49.04
crit 15.9 20.61% 23336.31 12061 33524 23337.64 14745 28722 370510 727062 49.04
dodge 11.6 15.06% 0.00 0 0 0.00 0 0 0 0 0.00
miss 11.6 15.01% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: fists_of_fury

Static Values
  • id:113656
  • school:physical
  • resource:chi
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3.0
  • secondary_cost:0.0
  • cooldown:24.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:113656
  • name:Fists of Fury
  • school:physical
  • tooltip:$w3 damage every $t3 sec. $?s125671[Parrying all attacks.][]
  • description:Pummels all targets in front of you, dealing ${5*{$s5=0}} damage over {$113656d=4 seconds}. Can be channeled while moving.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: fists_of_fury_tick

Static Values
  • id:117418
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:117418
  • name:Fists of Fury
  • school:physical
  • tooltip:
  • description:{$@spelldesc113656=Pummels all targets in front of you, dealing ${5*{$s5=0}} damage over {$113656d=4 seconds}. Can be channeled while moving.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:5.250000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
melee_main_hand 36 0.7% 167.1 2.71sec 98 42

Stats details: melee_main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 167.08 167.08 0.00 0.00 2.3244 0.0000 16296.00 31978.07 49.04 41.96 41.96
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
glance 85.10 50.93% 191.49 96 257 191.42 174 207 16296 31978 49.04
dodge 25.10 15.02% 0.00 0 0 0.00 0 0 0 0 0.00
miss 56.88 34.04% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
melee_off_hand 18 0.3% 166.1 2.71sec 49 21

Stats details: melee_off_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 166.08 166.08 0.00 0.00 2.3312 0.0000 8087.07 15869.47 49.04 20.89 20.89
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
glance 84.64 50.96% 95.55 48 129 95.51 86 104 8087 15869 49.04
dodge 24.88 14.98% 0.00 0 0 0.00 0 0 0 0 0.00
miss 56.56 34.06% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: melee_off_hand

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Rising Sun Kick 1112 20.7% 26.7 16.68sec 18738 18654 Direct 26.7 20666 41278 18738 20.7% 30.0% 0.0%  

Stats details: rising_sun_kick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.75 26.75 0.00 0.00 1.0045 0.0000 501162.84 983445.31 49.04 18654.17 18654.17
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.18 49.30% 20665.93 10452 29053 20659.73 13874 25169 272467 534669 49.04
crit 5.54 20.72% 41277.81 20904 58106 41098.22 0 58106 228696 448777 48.88
dodge 4.02 15.04% 0.00 0 0 0.00 0 0 0 0 0.00
miss 4.00 14.95% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: rising_sun_kick

Static Values
  • id:107428
  • school:physical
  • resource:chi
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:107428
  • name:Rising Sun Kick
  • school:physical
  • tooltip:
  • description:Kick upwards, dealing {$185099s1=0} damage{$?s128595=false}[, and reducing the effectiveness of healing on the target for {$115804d=10 seconds}][].
 
Rushing Jade Wind 838 15.6% 29.5 14.92sec 12798 12741 Periodic 262.9 1586 3171 1437 20.6% 30.0% 0.0% 38.8%

Stats details: rushing_jade_wind

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.52 0.00 262.92 262.92 1.0045 0.6654 377785.80 741339.22 49.04 1846.48 12740.65
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 129.8 49.35% 1585.98 7 2203 1585.09 1327 1795 205791 403829 49.04
crit 54.2 20.63% 3171.32 61 4406 3169.62 2336 3596 171995 337510 49.04
dodge 39.5 15.03% 0.00 0 0 0.00 0 0 0 0 0.00
miss 39.4 14.99% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: rushing_jade_wind

Static Values
  • id:116847
  • school:nature
  • resource:chi
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.serenity.up&!prev_gcd.rushing_jade_wind
Spelldata
  • id:116847
  • name:Rushing Jade Wind
  • school:nature
  • tooltip:Dealing physical damage to nearby enemies every $116847t1 sec.
  • description:Summons a whirling tornado around you, causing ${{$148187s1=0}*9} damage over {$d=6 seconds} to enemies within $107270A1 yards.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:6.00
  • base_tick_time:0.75
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: rushing_jade_wind_tick

Static Values
  • id:148187
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:148187
  • name:Rushing Jade Wind
  • school:physical
  • tooltip:
  • description:{$@spelldesc116847=Summons a whirling tornado around you, causing ${{$148187s1=0}*9} damage over {$d=6 seconds} to enemies within $107270A1 yards.}
 
Tiger Palm 349 6.5% 72.3 6.24sec 2176 2167 Direct 72.3 2405 4810 2176 20.6% 30.1% 0.0%  

Stats details: tiger_palm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 72.30 72.30 0.00 0.00 1.0045 0.0000 157353.72 308779.44 49.04 2166.69 2166.69
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.64 49.30% 2405.34 1206 3353 2404.20 1962 2730 85726 168223 49.04
crit 14.89 20.59% 4810.46 2413 6706 4808.81 3106 5809 71627 140556 49.04
dodge 10.89 15.06% 0.00 0 0 0.00 0 0 0 0 0.00
miss 10.88 15.05% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: tiger_palm

Static Values
  • id:100780
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:chi.max-chi>=2&!buff.serenity.up
Spelldata
  • id:100780
  • name:Tiger Palm
  • school:physical
  • tooltip:
  • description:Attack with the palm of your hand, dealing {$s1=1} damage.$?a137025[ Tiger Palm has an $137384m1% chance to make your next Blackout Kick cost no Chi.][]$?a137023[ Reduces the remaining cooldown on your Brews by {$s3=1} sec.][]$?a137025[ |cFFFFFFFFGenerates {$s2=1} Chi.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.050000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Whirling Dragon Punch 564 10.5% 13.9 32.42sec 18242 10428 Periodic 29.2 9597 19170 8712 20.8% 29.9% 0.0% 1.5%

Stats details: whirling_dragon_punch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.93 4.20 29.16 29.16 1.7494 0.2243 254017.17 498464.72 49.04 10427.63 10427.63
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
dodge 2.10 50.14% 0.00 0 0 0.00 0 0 0 0 0.00
miss 2.09 49.86% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.4 49.31% 9597.40 4767 13250 9585.32 4767 11731 137984 270770 49.04
crit 6.1 20.76% 19170.38 9533 26499 19073.29 0 26499 116033 227694 48.85
dodge 4.4 14.97% 0.00 0 0 0.00 0 0 0 0 0.00
miss 4.4 14.96% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: whirling_dragon_punch

Static Values
  • id:152175
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:24.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:152175
  • name:Whirling Dragon Punch
  • school:physical
  • tooltip:
  • description:Performs a devastating whirling upward strike, dealing ${3*{$158221s1=0}} damage to all nearby enemies. Only usable while Fists of Fury and Rising Sun Kick are on cooldown.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:1.00
  • base_tick_time:0.25
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: whirling_dragon_punch_tick

Static Values
  • id:158221
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:158221
  • name:Whirling Dragon Punch
  • school:physical
  • tooltip:
  • description:{$@spelldesc152175=Performs a devastating whirling upward strike, dealing ${3*{$158221s1=0}} damage to all nearby enemies. Only usable while Fists of Fury and Rising Sun Kick are on cooldown.}
 
pet - fire_spirit 308 / 65
auto_attack_mh 25 0.1% 42.1 10.06sec 56 26

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.08 42.08 0.00 0.00 2.1910 0.0000 2374.56 4659.67 49.04 25.75 25.75
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
glance 21.44 50.94% 110.76 103 122 110.83 104 118 2375 4660 49.04
dodge 6.32 15.01% 0.00 0 0 0.00 0 0 0 0 0.00
miss 14.33 34.04% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 12 0.0% 42.1 10.06sec 28 13

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.08 42.08 0.00 0.00 2.1910 0.0000 1188.19 2331.61 49.04 12.89 12.89
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
glance 21.45 50.98% 55.39 51 61 55.42 52 60 1188 2332 49.04
dodge 6.34 15.07% 0.00 0 0 0.00 0 0 0 0 0.00
miss 14.29 33.95% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Blackout Kick 19 0.1% 5.0 68.28sec 353 0

Stats details: blackout_kick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.04 5.04 0.00 0.00 0.0000 0.0000 1782.63 3498.10 49.04 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
glance 3.52 69.81% 506.19 464 581 488.72 0 581 1783 3498 47.29
dodge 0.76 15.13% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.76 15.06% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: blackout_kick

Static Values
  • id:100784
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:100784
  • name:Blackout Kick
  • school:physical
  • tooltip:
  • description:Kick with a blast of Chi energy, dealing {$s1=0} Physical damage.
 
Fists of Fury 104 0.4% 4.2 108.64sec 2331 720

Stats details: fists_of_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.25 0.00 20.30 20.30 3.2381 0.6776 9900.37 19427.76 49.04 719.97 719.97
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
glance 14.2 70.11% 695.74 633 792 697.12 0 792 9900 19428 48.99
dodge 3.0 14.96% 0.00 0 0 0.00 0 0 0 0 0.00
miss 3.0 14.93% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: fists_of_fury

Static Values
  • id:113656
  • school:physical
  • resource:chi
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:113656
  • name:Fists of Fury
  • school:physical
  • tooltip:$w3 damage every $t3 sec. $?s125671[Parrying all attacks.][]
  • description:Pummels all targets in front of you, dealing ${5*{$s5=0}} damage over {$113656d=4 seconds}. Can be channeled while moving.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:4.00
  • base_tick_time:0.17
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: fists_of_fury_tick

Static Values
  • id:117418
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:117418
  • name:Fists of Fury
  • school:physical
  • tooltip:
  • description:{$@spelldesc113656=Pummels all targets in front of you, dealing ${5*{$s5=0}} damage over {$113656d=4 seconds}. Can be channeled while moving.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Rising Sun Kick 56 0.2% 6.3 67.88sec 855 0

Stats details: rising_sun_kick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.27 6.27 0.00 0.00 0.0000 0.0000 5359.28 10516.67 49.04 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
glance 4.39 69.98% 1221.82 1097 1373 1216.27 0 1373 5359 10517 48.81
dodge 0.93 14.89% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.95 15.14% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: rising_sun_kick

Static Values
  • id:107428
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:107428
  • name:Rising Sun Kick
  • school:physical
  • tooltip:
  • description:Kick upwards, dealing {$185099s1=0} damage{$?s128595=false}[, and reducing the effectiveness of healing on the target for {$115804d=10 seconds}][].
 
Rushing Jade Wind 42 0.2% 6.1 66.19sec 651 0

Stats details: rushing_jade_wind

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.08 0.00 53.74 53.74 0.0000 0.6637 3958.66 7768.19 49.04 110.99 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
glance 37.6 69.88% 105.42 1 231 105.08 0 185 3959 7768 48.99
dodge 8.1 15.10% 0.00 0 0 0.00 0 0 0 0 0.00
miss 8.1 15.03% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: rushing_jade_wind

Static Values
  • id:116847
  • school:physical
  • resource:chi
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:116847
  • name:Rushing Jade Wind
  • school:nature
  • tooltip:Dealing physical damage to nearby enemies every $116847t1 sec.
  • description:Summons a whirling tornado around you, causing ${{$148187s1=0}*9} damage over {$d=6 seconds} to enemies within $107270A1 yards.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:6.00
  • base_tick_time:0.75
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 

Action details: rushing_jade_wind_tick

Static Values
  • id:148187
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:148187
  • name:Rushing Jade Wind
  • school:physical
  • tooltip:
  • description:{$@spelldesc116847=Summons a whirling tornado around you, causing ${{$148187s1=0}*9} damage over {$d=6 seconds} to enemies within $107270A1 yards.}
 
Tiger Palm 16 0.1% 15.6 27.95sec 97 0

Stats details: tiger_palm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.62 15.62 0.00 0.00 0.0000 0.0000 1521.78 2986.23 49.04 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
glance 10.91 69.83% 139.51 127 158 139.62 127 158 1522 2986 49.04
dodge 2.35 15.04% 0.00 0 0 0.00 0 0 0 0 0.00
miss 2.36 15.13% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: tiger_palm

Static Values
  • id:100780
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:100780
  • name:Tiger Palm
  • school:physical
  • tooltip:
  • description:Attack with the palm of your hand, dealing {$s1=1} damage.$?a137025[ Tiger Palm has an $137384m1% chance to make your next Blackout Kick cost no Chi.][]$?a137023[ Reduces the remaining cooldown on your Brews by {$s3=1} sec.][]$?a137025[ |cFFFFFFFFGenerates {$s2=1} Chi.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.050000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Whirling Dragon Punch 34 0.1% 2.9 134.38sec 1130 1873

Stats details: whirling_dragon_punch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.86 0.00 8.32 8.32 0.6037 0.2073 3228.40 6335.18 49.04 1872.62 1872.62
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
glance 5.8 69.87% 555.44 500 626 551.93 0 626 3228 6335 48.24
dodge 1.2 15.01% 0.00 0 0 0.00 0 0 0 0 0.00
miss 1.3 15.11% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: whirling_dragon_punch

Static Values
  • id:152175
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:152175
  • name:Whirling Dragon Punch
  • school:physical
  • tooltip:
  • description:Performs a devastating whirling upward strike, dealing ${3*{$158221s1=0}} damage to all nearby enemies. Only usable while Fists of Fury and Rising Sun Kick are on cooldown.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:1.00
  • base_tick_time:0.25
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: whirling_dragon_punch_tick

Static Values
  • id:158221
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:158221
  • name:Whirling Dragon Punch
  • school:physical
  • tooltip:
  • description:{$@spelldesc152175=Performs a devastating whirling upward strike, dealing ${3*{$158221s1=0}} damage to all nearby enemies. Only usable while Fists of Fury and Rising Sun Kick are on cooldown.}
 
pet - earth_spirit 308 / 65
auto_attack_mh 25 0.1% 42.1 10.06sec 56 26

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.08 42.08 0.00 0.00 2.1910 0.0000 2376.06 4662.61 49.04 25.77 25.77
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
glance 21.45 50.96% 110.79 103 122 110.86 105 120 2376 4663 49.04
dodge 6.31 15.00% 0.00 0 0 0.00 0 0 0 0 0.00
miss 14.32 34.03% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 12 0.0% 42.1 10.06sec 28 13

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.08 42.08 0.00 0.00 2.1910 0.0000 1188.74 2332.69 49.04 12.89 12.89
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
glance 21.47 51.01% 55.38 51 61 55.41 52 59 1189 2333 49.04
dodge 6.31 14.99% 0.00 0 0 0.00 0 0 0 0 0.00
miss 14.31 34.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Blackout Kick 19 0.1% 5.0 68.28sec 355 0

Stats details: blackout_kick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.04 5.04 0.00 0.00 0.0000 0.0000 1790.69 3513.92 49.04 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
glance 3.54 70.11% 506.33 464 581 488.76 0 581 1791 3514 47.25
dodge 0.76 15.15% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.74 14.75% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: blackout_kick

Static Values
  • id:100784
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:100784
  • name:Blackout Kick
  • school:physical
  • tooltip:
  • description:Kick with a blast of Chi energy, dealing {$s1=0} Physical damage.
 
Fists of Fury 104 0.4% 4.2 108.64sec 2330 720

Stats details: fists_of_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.25 0.00 20.30 20.30 3.2381 0.6776 9895.92 19419.04 49.04 719.65 719.65
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
glance 14.2 70.06% 695.91 633 792 697.42 0 792 9896 19419 49.00
dodge 3.0 15.00% 0.00 0 0 0.00 0 0 0 0 0.00
miss 3.0 14.93% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: fists_of_fury

Static Values
  • id:113656
  • school:physical
  • resource:chi
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:113656
  • name:Fists of Fury
  • school:physical
  • tooltip:$w3 damage every $t3 sec. $?s125671[Parrying all attacks.][]
  • description:Pummels all targets in front of you, dealing ${5*{$s5=0}} damage over {$113656d=4 seconds}. Can be channeled while moving.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:4.00
  • base_tick_time:0.17
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: fists_of_fury_tick

Static Values
  • id:117418
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:117418
  • name:Fists of Fury
  • school:physical
  • tooltip:
  • description:{$@spelldesc113656=Pummels all targets in front of you, dealing ${5*{$s5=0}} damage over {$113656d=4 seconds}. Can be channeled while moving.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Rising Sun Kick 56 0.2% 6.3 67.88sec 852 0

Stats details: rising_sun_kick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.27 6.27 0.00 0.00 0.0000 0.0000 5342.54 10483.80 49.04 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
glance 4.37 69.77% 1221.63 1097 1373 1215.90 0 1373 5343 10484 48.80
dodge 0.95 15.16% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.94 15.07% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: rising_sun_kick

Static Values
  • id:107428
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:107428
  • name:Rising Sun Kick
  • school:physical
  • tooltip:
  • description:Kick upwards, dealing {$185099s1=0} damage{$?s128595=false}[, and reducing the effectiveness of healing on the target for {$115804d=10 seconds}][].
 
Rushing Jade Wind 42 0.2% 6.1 66.19sec 653 0

Stats details: rushing_jade_wind

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.08 0.00 53.74 53.74 0.0000 0.6637 3967.99 7786.49 49.04 111.25 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
glance 37.6 70.04% 105.43 1 231 105.10 0 170 3968 7786 48.99
dodge 8.0 14.96% 0.00 0 0 0.00 0 0 0 0 0.00
miss 8.1 15.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: rushing_jade_wind

Static Values
  • id:116847
  • school:physical
  • resource:chi
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:116847
  • name:Rushing Jade Wind
  • school:nature
  • tooltip:Dealing physical damage to nearby enemies every $116847t1 sec.
  • description:Summons a whirling tornado around you, causing ${{$148187s1=0}*9} damage over {$d=6 seconds} to enemies within $107270A1 yards.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:6.00
  • base_tick_time:0.75
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 

Action details: rushing_jade_wind_tick

Static Values
  • id:148187
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:148187
  • name:Rushing Jade Wind
  • school:physical
  • tooltip:
  • description:{$@spelldesc116847=Summons a whirling tornado around you, causing ${{$148187s1=0}*9} damage over {$d=6 seconds} to enemies within $107270A1 yards.}
 
Tiger Palm 16 0.1% 15.6 27.95sec 98 0

Stats details: tiger_palm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.62 15.62 0.00 0.00 0.0000 0.0000 1525.00 2992.55 49.04 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
glance 10.93 69.97% 139.53 127 158 139.65 127 158 1525 2993 49.04
dodge 2.36 15.08% 0.00 0 0 0.00 0 0 0 0 0.00
miss 2.34 14.95% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: tiger_palm

Static Values
  • id:100780
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:100780
  • name:Tiger Palm
  • school:physical
  • tooltip:
  • description:Attack with the palm of your hand, dealing {$s1=1} damage.$?a137025[ Tiger Palm has an $137384m1% chance to make your next Blackout Kick cost no Chi.][]$?a137023[ Reduces the remaining cooldown on your Brews by {$s3=1} sec.][]$?a137025[ |cFFFFFFFFGenerates {$s2=1} Chi.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.050000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Whirling Dragon Punch 34 0.1% 2.9 134.38sec 1133 1878

Stats details: whirling_dragon_punch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.86 0.00 8.32 8.32 0.6037 0.2073 3237.17 6352.38 49.04 1877.71 1877.71
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
glance 5.8 70.04% 555.61 500 626 553.15 0 626 3237 6352 48.34
dodge 1.2 14.96% 0.00 0 0 0.00 0 0 0 0 0.00
miss 1.2 14.99% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: whirling_dragon_punch

Static Values
  • id:152175
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:152175
  • name:Whirling Dragon Punch
  • school:physical
  • tooltip:
  • description:Performs a devastating whirling upward strike, dealing ${3*{$158221s1=0}} damage to all nearby enemies. Only usable while Fists of Fury and Rising Sun Kick are on cooldown.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:1.00
  • base_tick_time:0.25
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: whirling_dragon_punch_tick

Static Values
  • id:158221
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:158221
  • name:Whirling Dragon Punch
  • school:physical
  • tooltip:
  • description:{$@spelldesc152175=Performs a devastating whirling upward strike, dealing ${3*{$158221s1=0}} damage to all nearby enemies. Only usable while Fists of Fury and Rising Sun Kick are on cooldown.}
 
Simple Action Stats Execute Interval
Malikoom
Chi Wave 29.6 15.43sec

Stats details: chi_wave

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.63 29.62 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
miss 29.62 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: chi_wave

Static Values
  • id:115098
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:energy.time_to_max>2|buff.serenity.down
Spelldata
  • id:115098
  • name:Chi Wave
  • school:nature
  • tooltip:
  • description:A wave of Chi energy flows through friends and foes, dealing $<damage> Nature damage or $<healing> healing. Bounces up to {$115098s1=7} times to targets within $132466a2 yards.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:7.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Energizing Elixir 6.7 70.60sec

Stats details: energizing_elixir

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.71 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: energizing_elixir

Static Values
  • id:115288
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:energy<energy.max&chi<=1&buff.serenity.down
Spelldata
  • id:115288
  • name:Energizing Elixir
  • school:physical
  • tooltip:
  • description:Chug an Energizing Elixir, refilling all your Energy and Chi.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Malikoom
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Malikoom
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Storm, Earth, and Fire 7.5 62.66sec

Stats details: storm_earth_and_fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.46 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: storm_earth_and_fire

Static Values
  • id:137639
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:artifact.strike_of_the_windlord.enabled&cooldown.strike_of_the_windlord.remains<14&cooldown.fists_of_fury.remains<=9&cooldown.rising_sun_kick.remains<=5
Spelldata
  • id:137639
  • name:Storm, Earth, and Fire
  • school:nature
  • tooltip:Elemental spirits summoned, mirroring all of the Monk's attacks. The Monk and spirits each do ${100+$m1}% of normal damage and healing.
  • description:Split into 3 elemental spirits for {$d=15 seconds}, each spirit dealing ${100+$m1}% of normal damage and healing. You directly control the Storm spirit, while Earth and Fire spirits mimic your attacks on nearby enemies. While active, casting Storm, Earth, and Fire again will cause the spirits to fixate on your target.
 
Touch of Death 4.3 120.36sec

Stats details: touch_of_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.32 4.32 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
miss 4.32 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: touch_of_death

Static Values
  • id:115080
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!artifact.gale_burst.enabled
Spelldata
  • id:115080
  • name:Touch of Death
  • school:physical
  • tooltip:Taking $w1 damage when this effect expires.
  • description:Use ancient Pandaren knowledge of anatomy to inflict mortal damage on an enemy. After {$d=8 seconds}, the target will take damage equal to your maximum health, reduced against players.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:8.00
  • base_tick_time:8.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
pet - fire_spirit
Chi Wave 6.1 78.02sec

Stats details: chi_wave

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.10 0.00 24.27 0.00 0.0000 0.7486 0.00 0.00 0.00 0.00 0.00
 
 

Action details: chi_wave

Static Values
  • id:115098
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:115098
  • name:Chi Wave
  • school:nature
  • tooltip:
  • description:A wave of Chi energy flows through friends and foes, dealing $<damage> Nature damage or $<healing> healing. Bounces up to {$115098s1=7} times to targets within $132466a2 yards.
 
pet - earth_spirit
Chi Wave 6.1 78.02sec

Stats details: chi_wave

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.10 0.00 24.27 0.00 0.0000 0.7486 0.00 0.00 0.00 0.00 0.00
 
 

Action details: chi_wave

Static Values
  • id:115098
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:115098
  • name:Chi Wave
  • school:nature
  • tooltip:
  • description:A wave of Chi energy flows through friends and foes, dealing $<damage> Nature damage or $<healing> healing. Bounces up to {$115098s1=7} times to targets within $132466a2 yards.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 9.44% 0.0(0.0) 1.0

Buff details

  • buff initial source:Malikoom
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Blackout Kick! (bok_proc) 4.0 0.0 78.7sec 78.7sec 3.06% 0.65% 0.0(0.0) 0.0

Buff details

  • buff initial source:Malikoom
  • cooldown name:buff_bok_proc
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:8.00%
  • default_value:-0.00

Stack Uptimes

  • bok_proc_1:3.06%

Trigger Attempt Success

  • trigger_pct:8.02%

Spelldata details

  • id:116768
  • name:Blackout Kick!
  • tooltip:Your next Blackout Kick costs no Chi.
  • description:{$@spelldesc137384=You have a $m1% chance when you Tiger Palm to cause your next Blackout Kick to cost no Chi within {$116768d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Draenic Agility Potion 2.0 0.0 93.8sec 0.0sec 10.83% 10.89% 0.0(0.0) 2.0

Buff details

  • buff initial source:Malikoom
  • cooldown name:buff_draenic_agility_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1000.00

Stack Uptimes

  • draenic_agility_potion_1:10.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156423
  • name:Draenic Agility Potion
  • tooltip:Agility increased by {$s1=1000}.
  • description:Increases your Agility by {$s1=1000} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Rushing Jade Wind 21.4 8.1 20.6sec 14.8sec 38.86% 38.90% 229.4(229.4) 21.0

Buff details

  • buff initial source:Malikoom
  • cooldown name:buff_rushing_jade_wind
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • rushing_jade_wind_1:38.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:116847
  • name:Rushing Jade Wind
  • tooltip:Dealing physical damage to nearby enemies every $116847t1 sec.
  • description:Summons a whirling tornado around you, causing ${{$148187s1=0}*9} damage over {$d=6 seconds} to enemies within $107270A1 yards.
  • max_stacks:0
  • duration:6.00
  • cooldown:6.00
  • default_chance:0.00%
Storm, Earth, and Fire 6.5 6.5 74.1sec 34.0sec 21.27% 27.72% 0.0(0.0) 6.3

Buff details

  • buff initial source:Malikoom
  • cooldown name:buff_storm_earth_and_fire
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • storm_earth_and_fire_2:21.27%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:137639
  • name:Storm, Earth, and Fire
  • tooltip:Elemental spirits summoned, mirroring all of the Monk's attacks. The Monk and spirits each do ${100+$m1}% of normal damage and healing.
  • description:Split into 3 elemental spirits for {$d=15 seconds}, each spirit dealing ${100+$m1}% of normal damage and healing. You directly control the Storm spirit, while Earth and Fire spirits mimic your attacks on nearby enemies. While active, casting Storm, Earth, and Fire again will cause the spirits to fixate on your target.
  • max_stacks:2
  • duration:15.00
  • cooldown:1.00
  • default_chance:100.00%
Constant Buffs
Greater Draenic Agility Flask

Buff details

  • buff initial source:Malikoom
  • cooldown name:buff_greater_draenic_agility_flask
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:250.00

Stack Uptimes

  • greater_draenic_agility_flask_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156064
  • name:Greater Draenic Agility Flask
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=250} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (salty_squid_roll)

Buff details

  • buff initial source:Malikoom
  • cooldown name:buff_salty_squid_roll
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:250.00

Stack Uptimes

  • salty_squid_roll_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:180749
  • name:Well Fed
  • tooltip:Critical Strike increased by $w1.
  • description:Increases critical strike by {$s1=125} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Windwalking (_movement_aura)

Buff details

  • buff initial source:Malikoom
  • cooldown name:buff_windwalking_movement_aura
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • windwalking_movement_aura_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:166646
  • name:Windwalking
  • tooltip:Movement speed increased by {$s1=10}%.
  • description:
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Malikoom
blackout_kick Chi 28.6 24.6 0.9 0.9 9481.0
fists_of_fury Chi 15.5 46.4 3.0 3.0 17534.1
rising_sun_kick Chi 26.7 53.5 2.0 2.0 9368.8
rushing_jade_wind Chi 29.5 29.5 1.0 1.0 12797.9
tiger_palm Energy 72.3 3615.0 50.0 50.0 43.5
Resource Gains Type Count Total Average Overflow
tiger_palm Chi 50.53 101.06 (63.44%) 2.00 0.00 0.00%
energy_regen Energy 2421.63 2545.46 (70.85%) 1.05 2459.48 49.14%
mp5_regen Mana 2421.63 0.00 (0.00%) 0.00 288120.84 100.00%
chi_refund Chi 15.39 23.41 (14.70%) 1.52 0.00 0.00%
blackout_kick_proc Chi 4.01 4.01 (2.52%) 1.00 0.00 0.00%
energizing_elixir_energy Energy 6.71 176.74 (4.92%) 26.32 1166.10 86.84%
energizing_elixir_chi Chi 6.71 30.82 (19.35%) 4.59 36.32 54.10%
energy_refund Energy 21.77 870.73 (24.23%) 40.00 0.00 0.00%
pet - fire_spirit
tiger_palm Chi 10.91 0.00 (0.00%) 0.00 10.91 100.00%
pet - earth_spirit
tiger_palm Chi 10.93 0.00 (0.00%) 0.00 10.93 100.00%
Resource RPS-Gain RPS-Loss
Energy 7.98 8.03
Chi 0.34 0.34
Combat End Resource Mean Min Max
Energy 76.48 0.01 100.00
Chi 1.26 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 47.3%

Procs

Count Interval
bok_proc 4.0 78.7sec

Statistics & Data Analysis

Fight Length
Sample Data Malikoom Fight Length
Count 9999
Mean 450.42
Minimum 350.15
Maximum 555.44
Spread ( max - min ) 205.29
Range [ ( max - min ) / 2 * 100% ] 22.79%
DPS
Sample Data Malikoom Damage Per Second
Count 9999
Mean 5372.71
Minimum 2875.56
Maximum 8315.60
Spread ( max - min ) 5440.04
Range [ ( max - min ) / 2 * 100% ] 50.63%
Standard Deviation 691.5814
5th Percentile 4213.44
95th Percentile 6490.61
( 95th Percentile - 5th Percentile ) 2277.17
Mean Distribution
Standard Deviation 6.9162
95.00% Confidence Intervall ( 5359.15 - 5386.26 )
Normalized 95.00% Confidence Intervall ( 99.75% - 100.25% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 636
0.1% Error 63649
0.1 Scale Factor Error with Delta=300 4082
0.05 Scale Factor Error with Delta=300 16331
0.01 Scale Factor Error with Delta=300 408291
Priority Target DPS
Sample Data Malikoom Priority Target Damage Per Second
Count 9999
Mean 5372.71
Minimum 2875.56
Maximum 8315.60
Spread ( max - min ) 5440.04
Range [ ( max - min ) / 2 * 100% ] 50.63%
Standard Deviation 691.5814
5th Percentile 4213.44
95th Percentile 6490.61
( 95th Percentile - 5th Percentile ) 2277.17
Mean Distribution
Standard Deviation 6.9162
95.00% Confidence Intervall ( 5359.15 - 5386.26 )
Normalized 95.00% Confidence Intervall ( 99.75% - 100.25% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 636
0.1% Error 63649
0.1 Scale Factor Error with Delta=300 4082
0.05 Scale Factor Error with Delta=300 16331
0.01 Scale Factor Error with Delta=300 408291
DPS(e)
Sample Data Malikoom Damage Per Second (Effective)
Count 9999
Mean 5372.71
Minimum 2875.56
Maximum 8315.60
Spread ( max - min ) 5440.04
Range [ ( max - min ) / 2 * 100% ] 50.63%
Damage
Sample Data Malikoom Damage
Count 9999
Mean 2361851.72
Minimum 1013208.22
Maximum 3979376.46
Spread ( max - min ) 2966168.23
Range [ ( max - min ) / 2 * 100% ] 62.79%
DTPS
Sample Data Malikoom Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Malikoom Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Malikoom Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Malikoom Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Malikoom Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Malikoom Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data MalikoomTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Malikoom Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Total Stagger damage generated
Sample Data Total Stagger damage generated
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Stagger damage that was not purified
Sample Data Stagger damage that was not purified
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Stagger damage that was purified
Sample Data Stagger damage that was purified
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Amount of damage purified while at light stagger
Sample Data Amount of damage purified while at light stagger
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Amount of damage purified while at moderate stagger
Sample Data Amount of damage purified while at moderate stagger
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Amount of damage purified while at heavy stagger
Sample Data Amount of damage purified while at heavy stagger
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=greater_draenic_agility_flask
1 0.00 food,type=salty_squid_roll
2 0.00 snapshot_stats
3 0.00 potion,name=draenic_agility
Default action list Executed every time the actor is available.
# count action,conditions
4 1.00 auto_attack
0.00 invoke_xuen
5 1.00 potion,name=draenic_agility,if=buff.serenity.up|buff.storm_earth_and_fire.up|(!talent.serenity.enabled&trinket.proc.agility.react)|buff.bloodlust.react|target.time_to_die<=60
6 4.32 touch_of_death,if=!artifact.gale_burst.enabled
0.00 touch_of_death,if=artifact.gale_burst.enabled&cooldown.strike_of_the_windlord.remains<8&cooldown.fists_of_fury.remains<=3&cooldown.rising_sun_kick.remains<8
0.00 blood_fury
0.00 berserking
0.00 arcane_torrent,if=chi.max-chi>=1
0.00 storm_earth_and_fire,if=artifact.strike_of_the_windlord.enabled&cooldown.strike_of_the_windlord.remains<14&cooldown.fists_of_fury.remains<=9&cooldown.rising_sun_kick.remains<=5
7 7.46 storm_earth_and_fire,if=!artifact.strike_of_the_windlord.enabled&cooldown.fists_of_fury.remains<=9&cooldown.rising_sun_kick.remains<=5
0.00 serenity,if=artifact.strike_of_the_windlord.enabled&cooldown.strike_of_the_windlord.remains<7&cooldown.fists_of_fury.remains<=3&cooldown.rising_sun_kick.remains<8
0.00 serenity,if=!artifact.strike_of_the_windlord.enabled&cooldown.fists_of_fury.remains<=3&cooldown.rising_sun_kick.remains<8
8 6.71 energizing_elixir,if=energy<energy.max&chi<=1&buff.serenity.down
0.00 rushing_jade_wind,if=buff.serenity.up&!prev_gcd.rushing_jade_wind
0.00 strike_of_the_windlord
9 13.93 whirling_dragon_punch
A 15.47 fists_of_fury
B 0.00 call_action_list,name=st,if=active_enemies<3
C 0.00 call_action_list,name=aoe,if=active_enemies>=3
actions.st
# count action,conditions
D 26.75 rising_sun_kick
E 29.52 rushing_jade_wind,if=chi>1&!prev_gcd.rushing_jade_wind
F 29.64 chi_wave,if=energy.time_to_max>2|buff.serenity.down
0.00 chi_burst,if=energy.time_to_max>2|buff.serenity.down
G 28.63 blackout_kick,if=(chi>1|buff.bok_proc.up)&buff.serenity.down&!prev_gcd.blackout_kick
H 72.30 tiger_palm,if=(buff.serenity.down&chi<=2)&!prev_gcd.tiger_palm

Sample Sequence

013467F7HF7HD8A9EHDGEHGFEDHFHFHDHFHDE8A9EHFH75FHAGHD9EHG6FEDHGHEHFHFHAHD89EGFEDH7FHDHEHA9HFHDHEHFHFHAH6FHD89EGAHDFH7FHFHFHD8A9EHGDHFHEHGDGEHFHAHD9HFHDEHGEGHA6FHD89EG7EDGHFEGHAHD9HEGFHGHFHAHD9HEHGFDEG8EGAHFHD9H

Sample Sequence Table

time name target resources buffs
Pre flask Malikoom 100.0/100: 100% energy | 5.0/5: 100% chi
Pre food Malikoom 100.0/100: 100% energy | 5.0/5: 100% chi
Pre potion Fluffy_Pillow 100.0/100: 100% energy | 5.0/5: 100% chi draenic_agility_potion
0:00.000 auto_attack Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% chi draenic_agility_potion
0:00.000 touch_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% chi draenic_agility_potion
0:01.003 storm_earth_and_fire Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% chi bloodlust, draenic_agility_potion
0:01.003 chi_wave Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% chi bloodlust, storm_earth_and_fire(2), draenic_agility_potion
0:02.008 storm_earth_and_fire Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% chi bloodlust, storm_earth_and_fire(2), draenic_agility_potion
0:02.008 tiger_palm Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% chi bloodlust, storm_earth_and_fire(2), draenic_agility_potion
0:03.013 Waiting 12.800 sec 100.0/100: 100% energy | 0.0/5: 0% chi bloodlust, storm_earth_and_fire(2), draenic_agility_potion
0:15.813 chi_wave Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% chi bloodlust, storm_earth_and_fire(2), draenic_agility_potion
0:17.006 storm_earth_and_fire Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% chi bloodlust, draenic_agility_potion
0:17.006 tiger_palm Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% chi bloodlust, storm_earth_and_fire(2), draenic_agility_potion
0:18.012 rising_sun_kick Fluffy_Pillow 64.2/100: 64% energy | 2.0/5: 40% chi bloodlust, storm_earth_and_fire(2), draenic_agility_potion
0:19.016 energizing_elixir Fluffy_Pillow 78.3/100: 78% energy | 0.0/5: 0% chi bloodlust, storm_earth_and_fire(2), draenic_agility_potion
0:19.016 fists_of_fury Fluffy_Pillow 100.0/100: 100% energy | 5.0/5: 100% chi bloodlust, storm_earth_and_fire(2), draenic_agility_potion
0:22.016 whirling_dragon_punch Fluffy_Pillow 100.0/100: 100% energy | 2.0/5: 40% chi bloodlust, storm_earth_and_fire(2), draenic_agility_potion
0:23.611 rushing_jade_wind Fluffy_Pillow 100.0/100: 100% energy | 2.0/5: 40% chi bloodlust, storm_earth_and_fire(2)
0:24.617 tiger_palm Fluffy_Pillow 100.0/100: 100% energy | 1.0/5: 20% chi bloodlust, rushing_jade_wind, storm_earth_and_fire(2)
0:25.623 rising_sun_kick Fluffy_Pillow 64.2/100: 64% energy | 3.0/5: 60% chi bloodlust, rushing_jade_wind, storm_earth_and_fire(2)
0:26.628 blackout_kick Fluffy_Pillow 78.3/100: 78% energy | 3.0/5: 60% chi bloodlust, rushing_jade_wind, storm_earth_and_fire(2)
0:27.632 rushing_jade_wind Fluffy_Pillow 92.4/100: 92% energy | 2.0/5: 40% chi bloodlust, rushing_jade_wind, storm_earth_and_fire(2)
0:28.880 tiger_palm Fluffy_Pillow 100.0/100: 100% energy | 1.0/5: 20% chi bloodlust, rushing_jade_wind, storm_earth_and_fire(2)
0:29.883 blackout_kick Fluffy_Pillow 64.1/100: 64% energy | 3.0/5: 60% chi bloodlust, rushing_jade_wind, storm_earth_and_fire(2)
0:30.891 chi_wave Fluffy_Pillow 78.3/100: 78% energy | 3.0/5: 60% chi bloodlust, rushing_jade_wind, storm_earth_and_fire(2)
0:32.008 rushing_jade_wind Fluffy_Pillow 94.0/100: 94% energy | 3.0/5: 60% chi bloodlust, rushing_jade_wind
0:33.143 rising_sun_kick Fluffy_Pillow 100.0/100: 100% energy | 2.0/5: 40% chi bloodlust, rushing_jade_wind
0:34.148 tiger_palm Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% chi bloodlust, rushing_jade_wind
0:35.152 Waiting 10.700 sec 100.0/100: 100% energy | 0.0/5: 0% chi bloodlust, rushing_jade_wind
0:45.852 chi_wave Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% chi
0:47.007 tiger_palm Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% chi
0:48.012 Waiting 12.800 sec 100.0/100: 100% energy | 0.0/5: 0% chi
1:00.812 chi_wave Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% chi
1:02.007 tiger_palm Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% chi
1:03.012 rising_sun_kick Fluffy_Pillow 60.9/100: 61% energy | 2.0/5: 40% chi
1:04.017 tiger_palm Fluffy_Pillow 71.8/100: 72% energy | 0.0/5: 0% chi
1:05.023 Waiting 10.800 sec 72.6/100: 73% energy | 0.0/5: 0% chi
1:15.823 chi_wave Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% chi
1:17.008 tiger_palm Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% chi
1:18.012 rising_sun_kick Fluffy_Pillow 60.9/100: 61% energy | 2.0/5: 40% chi
1:19.016 rushing_jade_wind Fluffy_Pillow 71.7/100: 72% energy | 2.0/5: 40% chi
1:20.021 energizing_elixir Fluffy_Pillow 82.6/100: 83% energy | 1.0/5: 20% chi rushing_jade_wind
1:20.021 fists_of_fury Fluffy_Pillow 100.0/100: 100% energy | 5.0/5: 100% chi rushing_jade_wind
1:24.002 whirling_dragon_punch Fluffy_Pillow 100.0/100: 100% energy | 2.0/5: 40% chi rushing_jade_wind
1:25.794 rushing_jade_wind Fluffy_Pillow 100.0/100: 100% energy | 2.0/5: 40% chi
1:26.799 tiger_palm Fluffy_Pillow 100.0/100: 100% energy | 1.0/5: 20% chi rushing_jade_wind
1:27.805 Waiting 3.000 sec 100.0/100: 100% energy | 1.0/5: 20% chi rushing_jade_wind
1:30.805 chi_wave Fluffy_Pillow 100.0/100: 100% energy | 1.0/5: 20% chi rushing_jade_wind
1:32.008 tiger_palm Fluffy_Pillow 100.0/100: 100% energy | 1.0/5: 20% chi
1:33.014 Waiting 0.200 sec 100.0/100: 100% energy | 1.0/5: 20% chi
1:33.214 storm_earth_and_fire Fluffy_Pillow 100.0/100: 100% energy | 1.0/5: 20% chi
1:33.214 potion Fluffy_Pillow 100.0/100: 100% energy | 1.0/5: 20% chi storm_earth_and_fire(2)
1:33.214 Waiting 12.600 sec 100.0/100: 100% energy | 1.0/5: 20% chi storm_earth_and_fire(2), draenic_agility_potion
1:45.814 chi_wave Fluffy_Pillow 100.0/100: 100% energy | 1.0/5: 20% chi storm_earth_and_fire(2), draenic_agility_potion
1:47.007 tiger_palm Fluffy_Pillow 100.0/100: 100% energy | 1.0/5: 20% chi storm_earth_and_fire(2), draenic_agility_potion
1:48.011 fists_of_fury Fluffy_Pillow 60.9/100: 61% energy | 3.0/5: 60% chi bok_proc, storm_earth_and_fire(2), draenic_agility_potion
1:51.966 blackout_kick Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% chi bok_proc, draenic_agility_potion
1:52.971 tiger_palm Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% chi draenic_agility_potion
1:53.975 rising_sun_kick Fluffy_Pillow 60.9/100: 61% energy | 2.0/5: 40% chi draenic_agility_potion
1:54.980 whirling_dragon_punch Fluffy_Pillow 71.7/100: 72% energy | 2.0/5: 40% chi draenic_agility_potion
1:56.632 rushing_jade_wind Fluffy_Pillow 89.6/100: 90% energy | 2.0/5: 40% chi draenic_agility_potion
1:57.637 tiger_palm Fluffy_Pillow 100.0/100: 100% energy | 1.0/5: 20% chi rushing_jade_wind, draenic_agility_potion
1:58.641 blackout_kick Fluffy_Pillow 60.9/100: 61% energy | 3.0/5: 60% chi rushing_jade_wind
1:59.645 Waiting 0.200 sec 71.7/100: 72% energy | 3.0/5: 60% chi rushing_jade_wind
1:59.845 touch_of_death Fluffy_Pillow 73.9/100: 74% energy | 3.0/5: 60% chi rushing_jade_wind
2:01.005 chi_wave Fluffy_Pillow 86.5/100: 86% energy | 3.0/5: 60% chi rushing_jade_wind
2:02.010 rushing_jade_wind Fluffy_Pillow 97.3/100: 97% energy | 3.0/5: 60% chi rushing_jade_wind
2:03.178 rising_sun_kick Fluffy_Pillow 100.0/100: 100% energy | 2.0/5: 40% chi rushing_jade_wind
2:04.218 tiger_palm Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% chi rushing_jade_wind
2:05.224 blackout_kick Fluffy_Pillow 60.9/100: 61% energy | 2.0/5: 40% chi rushing_jade_wind
2:06.227 tiger_palm Fluffy_Pillow 71.7/100: 72% energy | 2.0/5: 40% chi rushing_jade_wind
2:07.231 Waiting 0.300 sec 72.6/100: 73% energy | 2.0/5: 40% chi rushing_jade_wind
2:07.531 rushing_jade_wind Fluffy_Pillow 75.9/100: 76% energy | 2.0/5: 40% chi rushing_jade_wind
2:08.722 tiger_palm Fluffy_Pillow 88.7/100: 89% energy | 1.0/5: 20% chi rushing_jade_wind
2:09.725 Waiting 6.100 sec 89.6/100: 90% energy | 1.0/5: 20% chi rushing_jade_wind
2:15.825 chi_wave Fluffy_Pillow 100.0/100: 100% energy | 1.0/5: 20% chi
2:17.010 tiger_palm Fluffy_Pillow 100.0/100: 100% energy | 1.0/5: 20% chi
2:18.014 Waiting 12.800 sec 100.0/100: 100% energy | 1.0/5: 20% chi
2:30.814 chi_wave Fluffy_Pillow 100.0/100: 100% energy | 1.0/5: 20% chi
2:32.009 tiger_palm Fluffy_Pillow 100.0/100: 100% energy | 1.0/5: 20% chi
2:33.014 fists_of_fury Fluffy_Pillow 60.9/100: 61% energy | 3.0/5: 60% chi
2:37.066 tiger_palm Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% chi
2:38.069 rising_sun_kick Fluffy_Pillow 60.9/100: 61% energy | 2.0/5: 40% chi
2:39.072 energizing_elixir Fluffy_Pillow 71.7/100: 72% energy | 0.0/5: 0% chi
2:39.072 whirling_dragon_punch Fluffy_Pillow 100.0/100: 100% energy | 5.0/5: 100% chi
2:40.804 rushing_jade_wind Fluffy_Pillow 100.0/100: 100% energy | 5.0/5: 100% chi
2:41.806 blackout_kick Fluffy_Pillow 100.0/100: 100% energy | 4.0/5: 80% chi rushing_jade_wind
2:42.811 Waiting 3.000 sec 100.0/100: 100% energy | 3.0/5: 60% chi rushing_jade_wind
2:45.811 chi_wave Fluffy_Pillow 100.0/100: 100% energy | 3.0/5: 60% chi rushing_jade_wind
2:47.009 rushing_jade_wind Fluffy_Pillow 100.0/100: 100% energy | 3.0/5: 60% chi
2:48.013 rising_sun_kick Fluffy_Pillow 100.0/100: 100% energy | 2.0/5: 40% chi rushing_jade_wind
2:49.016 tiger_palm Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% chi rushing_jade_wind
2:50.021 Waiting 10.800 sec 100.0/100: 100% energy | 0.0/5: 0% chi rushing_jade_wind
3:00.821 storm_earth_and_fire Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% chi
3:01.004 chi_wave Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% chi storm_earth_and_fire(2)
3:02.009 tiger_palm Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% chi storm_earth_and_fire(2)
3:03.014 rising_sun_kick Fluffy_Pillow 60.9/100: 61% energy | 2.0/5: 40% chi storm_earth_and_fire(2)
3:04.018 tiger_palm Fluffy_Pillow 71.7/100: 72% energy | 0.0/5: 0% chi storm_earth_and_fire(2)
3:05.024 rushing_jade_wind Fluffy_Pillow 32.6/100: 33% energy | 2.0/5: 40% chi storm_earth_and_fire(2)
3:06.031 Waiting 0.600 sec 43.5/100: 44% energy | 1.0/5: 20% chi rushing_jade_wind, storm_earth_and_fire(2)
3:06.631 tiger_palm Fluffy_Pillow 50.0/100: 50% energy | 1.0/5: 20% chi rushing_jade_wind, storm_earth_and_fire(2)
3:07.634 fists_of_fury Fluffy_Pillow 10.9/100: 11% energy | 3.0/5: 60% chi rushing_jade_wind, storm_earth_and_fire(2)
3:11.580 whirling_dragon_punch Fluffy_Pillow 53.6/100: 54% energy | 0.0/5: 0% chi storm_earth_and_fire(2)
3:13.451 tiger_palm Fluffy_Pillow 73.8/100: 74% energy | 0.0/5: 0% chi storm_earth_and_fire(2)
3:14.455 Waiting 1.300 sec 74.7/100: 75% energy | 0.0/5: 0% chi storm_earth_and_fire(2)
3:15.755 chi_wave Fluffy_Pillow 88.8/100: 89% energy | 0.0/5: 0% chi storm_earth_and_fire(2)
3:17.009 tiger_palm Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% chi
3:18.012 rising_sun_kick Fluffy_Pillow 60.9/100: 61% energy | 2.0/5: 40% chi
3:19.018 tiger_palm Fluffy_Pillow 71.7/100: 72% energy | 0.0/5: 0% chi
3:20.025 rushing_jade_wind Fluffy_Pillow 32.6/100: 33% energy | 2.0/5: 40% chi
3:21.031 Waiting 0.600 sec 43.5/100: 44% energy | 1.0/5: 20% chi rushing_jade_wind
3:21.631 tiger_palm Fluffy_Pillow 50.0/100: 50% energy | 1.0/5: 20% chi rushing_jade_wind
3:22.634 Waiting 8.200 sec 50.9/100: 51% energy | 1.0/5: 20% chi rushing_jade_wind
3:30.834 chi_wave Fluffy_Pillow 100.0/100: 100% energy | 1.0/5: 20% chi
3:32.010 tiger_palm Fluffy_Pillow 100.0/100: 100% energy | 1.0/5: 20% chi
3:33.015 Waiting 12.800 sec 100.0/100: 100% energy | 1.0/5: 20% chi
3:45.815 chi_wave Fluffy_Pillow 100.0/100: 100% energy | 1.0/5: 20% chi
3:47.009 tiger_palm Fluffy_Pillow 100.0/100: 100% energy | 1.0/5: 20% chi
3:48.014 fists_of_fury Fluffy_Pillow 60.9/100: 61% energy | 3.0/5: 60% chi
3:52.008 tiger_palm Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% chi
3:53.012 Waiting 6.800 sec 100.0/100: 100% energy | 0.0/5: 0% chi
3:59.812 touch_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% chi
4:01.005 chi_wave Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% chi
4:02.009 tiger_palm Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% chi
4:03.011 rising_sun_kick Fluffy_Pillow 60.8/100: 61% energy | 2.0/5: 40% chi
4:04.016 energizing_elixir Fluffy_Pillow 71.7/100: 72% energy | 0.0/5: 0% chi
4:04.016 whirling_dragon_punch Fluffy_Pillow 100.0/100: 100% energy | 5.0/5: 100% chi
4:05.738 rushing_jade_wind Fluffy_Pillow 100.0/100: 100% energy | 5.0/5: 100% chi
4:06.743 blackout_kick Fluffy_Pillow 100.0/100: 100% energy | 4.0/5: 80% chi rushing_jade_wind
4:07.748 Waiting 2.200 sec 100.0/100: 100% energy | 3.0/5: 60% chi rushing_jade_wind
4:09.948 fists_of_fury Fluffy_Pillow 100.0/100: 100% energy | 3.0/5: 60% chi rushing_jade_wind
4:14.101 tiger_palm Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% chi
4:15.105 rising_sun_kick Fluffy_Pillow 60.9/100: 61% energy | 2.0/5: 40% chi
4:16.110 chi_wave Fluffy_Pillow 71.7/100: 72% energy | 0.0/5: 0% chi
4:17.115 tiger_palm Fluffy_Pillow 82.6/100: 83% energy | 0.0/5: 0% chi
4:18.119 Waiting 12.700 sec 83.5/100: 83% energy | 0.0/5: 0% chi
4:30.819 storm_earth_and_fire Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% chi
4:31.004 chi_wave Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% chi storm_earth_and_fire(2)
4:32.116 tiger_palm Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% chi storm_earth_and_fire(2)
4:33.122 Waiting 12.800 sec 100.0/100: 100% energy | 0.0/5: 0% chi storm_earth_and_fire(2)
4:45.922 chi_wave Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% chi storm_earth_and_fire(2)
4:47.116 tiger_palm Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% chi
4:48.121 Waiting 12.800 sec 100.0/100: 100% energy | 0.0/5: 0% chi
5:00.921 chi_wave Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% chi
5:02.114 tiger_palm Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% chi
5:03.117 rising_sun_kick Fluffy_Pillow 60.9/100: 61% energy | 2.0/5: 40% chi
5:04.123 energizing_elixir Fluffy_Pillow 71.7/100: 72% energy | 0.0/5: 0% chi
5:04.123 fists_of_fury Fluffy_Pillow 100.0/100: 100% energy | 5.0/5: 100% chi
5:08.042 whirling_dragon_punch Fluffy_Pillow 100.0/100: 100% energy | 2.0/5: 40% chi
5:09.701 rushing_jade_wind Fluffy_Pillow 100.0/100: 100% energy | 2.0/5: 40% chi
5:10.705 tiger_palm Fluffy_Pillow 100.0/100: 100% energy | 1.0/5: 20% chi rushing_jade_wind
5:11.711 blackout_kick Fluffy_Pillow 60.9/100: 61% energy | 3.0/5: 60% chi rushing_jade_wind
5:12.716 rising_sun_kick Fluffy_Pillow 71.8/100: 72% energy | 2.0/5: 40% chi rushing_jade_wind
5:13.720 tiger_palm Fluffy_Pillow 82.6/100: 83% energy | 0.0/5: 0% chi rushing_jade_wind
5:14.725 Waiting 1.200 sec 83.5/100: 84% energy | 0.0/5: 0% chi rushing_jade_wind
5:15.925 chi_wave Fluffy_Pillow 96.5/100: 96% energy | 0.0/5: 0% chi
5:17.114 tiger_palm Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% chi
5:18.119 rushing_jade_wind Fluffy_Pillow 60.9/100: 61% energy | 2.0/5: 40% chi
5:19.124 tiger_palm Fluffy_Pillow 71.8/100: 72% energy | 1.0/5: 20% chi rushing_jade_wind
5:20.130 blackout_kick Fluffy_Pillow 32.6/100: 33% energy | 3.0/5: 60% chi rushing_jade_wind
5:21.133 Waiting 0.600 sec 43.5/100: 43% energy | 2.0/5: 40% chi rushing_jade_wind
5:21.733 rising_sun_kick Fluffy_Pillow 50.0/100: 50% energy | 2.0/5: 40% chi rushing_jade_wind
5:22.961 blackout_kick Fluffy_Pillow 63.3/100: 63% energy | 2.0/5: 40% chi rushing_jade_wind
5:24.138 rushing_jade_wind Fluffy_Pillow 76.0/100: 76% energy | 2.0/5: 40% chi
5:25.143 tiger_palm Fluffy_Pillow 86.9/100: 87% energy | 1.0/5: 20% chi rushing_jade_wind
5:26.147 Waiting 4.800 sec 87.8/100: 88% energy | 1.0/5: 20% chi rushing_jade_wind
5:30.947 chi_wave Fluffy_Pillow 100.0/100: 100% energy | 1.0/5: 20% chi
5:32.114 tiger_palm Fluffy_Pillow 100.0/100: 100% energy | 1.0/5: 20% chi
5:33.118 fists_of_fury Fluffy_Pillow 60.9/100: 61% energy | 3.0/5: 60% chi
5:37.109 tiger_palm Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% chi
5:38.113 rising_sun_kick Fluffy_Pillow 60.9/100: 61% energy | 2.0/5: 40% chi
5:39.118 whirling_dragon_punch Fluffy_Pillow 71.7/100: 72% energy | 0.0/5: 0% chi
5:40.775 tiger_palm Fluffy_Pillow 89.7/100: 90% energy | 0.0/5: 0% chi
5:41.780 Waiting 4.100 sec 90.6/100: 91% energy | 0.0/5: 0% chi
5:45.880 chi_wave Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% chi
5:47.116 tiger_palm Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% chi
5:48.120 rising_sun_kick Fluffy_Pillow 60.9/100: 61% energy | 2.0/5: 40% chi
5:49.126 rushing_jade_wind Fluffy_Pillow 71.8/100: 72% energy | 2.0/5: 40% chi
5:50.130 tiger_palm Fluffy_Pillow 82.6/100: 83% energy | 1.0/5: 20% chi rushing_jade_wind
5:51.134 blackout_kick Fluffy_Pillow 43.5/100: 43% energy | 3.0/5: 60% chi rushing_jade_wind, bok_proc
5:52.141 Waiting 2.300 sec 54.4/100: 54% energy | 3.0/5: 60% chi rushing_jade_wind
5:54.441 rushing_jade_wind Fluffy_Pillow 79.3/100: 79% energy | 3.0/5: 60% chi rushing_jade_wind
5:55.676 blackout_kick Fluffy_Pillow 92.6/100: 93% energy | 2.0/5: 40% chi rushing_jade_wind
5:56.680 tiger_palm Fluffy_Pillow 100.0/100: 100% energy | 1.0/5: 20% chi rushing_jade_wind
5:57.685 fists_of_fury Fluffy_Pillow 60.9/100: 61% energy | 3.0/5: 60% chi rushing_jade_wind
6:01.610 touch_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% chi
6:02.616 chi_wave Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% chi
6:03.621 tiger_palm Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% chi
6:04.627 rising_sun_kick Fluffy_Pillow 60.9/100: 61% energy | 2.0/5: 40% chi
6:05.632 energizing_elixir Fluffy_Pillow 71.8/100: 72% energy | 0.0/5: 0% chi
6:05.632 whirling_dragon_punch Fluffy_Pillow 100.0/100: 100% energy | 5.0/5: 100% chi
6:07.484 rushing_jade_wind Fluffy_Pillow 100.0/100: 100% energy | 5.0/5: 100% chi
6:08.488 blackout_kick Fluffy_Pillow 100.0/100: 100% energy | 4.0/5: 80% chi rushing_jade_wind
6:09.492 Waiting 1.400 sec 100.0/100: 100% energy | 3.0/5: 60% chi rushing_jade_wind
6:10.892 storm_earth_and_fire Fluffy_Pillow 100.0/100: 100% energy | 3.0/5: 60% chi rushing_jade_wind
6:10.892 Waiting 1.900 sec 100.0/100: 100% energy | 3.0/5: 60% chi rushing_jade_wind, storm_earth_and_fire(2)
6:12.792 rushing_jade_wind Fluffy_Pillow 100.0/100: 100% energy | 3.0/5: 60% chi rushing_jade_wind, storm_earth_and_fire(2)
6:14.031 rising_sun_kick Fluffy_Pillow 100.0/100: 100% energy | 2.0/5: 40% chi rushing_jade_wind, storm_earth_and_fire(2)
6:15.034 blackout_kick Fluffy_Pillow 100.0/100: 100% energy | 2.0/5: 40% chi rushing_jade_wind, storm_earth_and_fire(2)
6:16.038 tiger_palm Fluffy_Pillow 100.0/100: 100% energy | 1.0/5: 20% chi rushing_jade_wind, storm_earth_and_fire(2)
6:17.044 Waiting 0.400 sec 60.9/100: 61% energy | 3.0/5: 60% chi rushing_jade_wind, storm_earth_and_fire(2)
6:17.444 chi_wave Fluffy_Pillow 65.2/100: 65% energy | 3.0/5: 60% chi rushing_jade_wind, storm_earth_and_fire(2)
6:18.621 rushing_jade_wind Fluffy_Pillow 78.0/100: 78% energy | 3.0/5: 60% chi rushing_jade_wind, storm_earth_and_fire(2)
6:19.625 blackout_kick Fluffy_Pillow 88.8/100: 89% energy | 2.0/5: 40% chi rushing_jade_wind, storm_earth_and_fire(2)
6:20.630 tiger_palm Fluffy_Pillow 99.7/100: 100% energy | 2.0/5: 40% chi rushing_jade_wind, storm_earth_and_fire(2)
6:21.634 fists_of_fury Fluffy_Pillow 60.6/100: 61% energy | 4.0/5: 80% chi rushing_jade_wind, storm_earth_and_fire(2)
6:25.582 tiger_palm Fluffy_Pillow 100.0/100: 100% energy | 1.0/5: 20% chi storm_earth_and_fire(2)
6:26.587 rising_sun_kick Fluffy_Pillow 60.9/100: 61% energy | 3.0/5: 60% chi
6:27.592 whirling_dragon_punch Fluffy_Pillow 71.8/100: 72% energy | 1.0/5: 20% chi
6:29.591 tiger_palm Fluffy_Pillow 93.4/100: 93% energy | 1.0/5: 20% chi
6:30.596 rushing_jade_wind Fluffy_Pillow 54.3/100: 54% energy | 3.0/5: 60% chi bok_proc
6:31.601 blackout_kick Fluffy_Pillow 65.1/100: 65% energy | 2.0/5: 40% chi rushing_jade_wind, bok_proc
6:32.604 chi_wave Fluffy_Pillow 76.0/100: 76% energy | 2.0/5: 40% chi rushing_jade_wind
6:33.621 tiger_palm Fluffy_Pillow 87.0/100: 87% energy | 2.0/5: 40% chi rushing_jade_wind
6:34.625 blackout_kick Fluffy_Pillow 87.9/100: 88% energy | 2.0/5: 40% chi rushing_jade_wind
6:35.629 tiger_palm Fluffy_Pillow 98.7/100: 99% energy | 1.0/5: 20% chi rushing_jade_wind
6:36.634 Waiting 10.800 sec 99.6/100: 100% energy | 1.0/5: 20% chi
6:47.434 chi_wave Fluffy_Pillow 100.0/100: 100% energy | 1.0/5: 20% chi
6:48.621 tiger_palm Fluffy_Pillow 100.0/100: 100% energy | 1.0/5: 20% chi
6:49.624 fists_of_fury Fluffy_Pillow 60.9/100: 61% energy | 3.0/5: 60% chi
6:53.612 tiger_palm Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% chi
6:54.616 rising_sun_kick Fluffy_Pillow 60.9/100: 61% energy | 2.0/5: 40% chi
6:55.621 whirling_dragon_punch Fluffy_Pillow 71.7/100: 72% energy | 0.0/5: 0% chi
6:57.409 tiger_palm Fluffy_Pillow 91.1/100: 91% energy | 0.0/5: 0% chi
6:58.413 rushing_jade_wind Fluffy_Pillow 52.0/100: 52% energy | 2.0/5: 40% chi
6:59.419 tiger_palm Fluffy_Pillow 62.8/100: 63% energy | 1.0/5: 20% chi rushing_jade_wind
7:00.424 blackout_kick Fluffy_Pillow 23.7/100: 24% energy | 3.0/5: 60% chi rushing_jade_wind
7:01.428 Waiting 1.000 sec 34.6/100: 35% energy | 3.0/5: 60% chi rushing_jade_wind
7:02.428 chi_wave Fluffy_Pillow 45.4/100: 45% energy | 3.0/5: 60% chi rushing_jade_wind
7:03.622 rising_sun_kick Fluffy_Pillow 58.3/100: 58% energy | 3.0/5: 60% chi rushing_jade_wind
7:04.860 rushing_jade_wind Fluffy_Pillow 71.7/100: 72% energy | 3.0/5: 60% chi
7:05.864 blackout_kick Fluffy_Pillow 82.6/100: 83% energy | 2.0/5: 40% chi rushing_jade_wind
7:06.870 energizing_elixir Fluffy_Pillow 93.5/100: 93% energy | 1.0/5: 20% chi rushing_jade_wind
7:06.870 Waiting 3.300 sec 100.0/100: 100% energy | 5.0/5: 100% chi rushing_jade_wind
7:10.170 rushing_jade_wind Fluffy_Pillow 100.0/100: 100% energy | 5.0/5: 100% chi rushing_jade_wind
7:11.406 blackout_kick Fluffy_Pillow 100.0/100: 100% energy | 4.0/5: 80% chi rushing_jade_wind
7:12.412 fists_of_fury Fluffy_Pillow 100.0/100: 100% energy | 3.0/5: 60% chi rushing_jade_wind
7:16.209 tiger_palm Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% chi rushing_jade_wind
7:17.214 Waiting 0.200 sec 100.0/100: 100% energy | 0.0/5: 0% chi
7:17.414 chi_wave Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% chi
7:18.620 tiger_palm Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% chi
7:19.624 rising_sun_kick Fluffy_Pillow 60.9/100: 61% energy | 2.0/5: 40% chi
7:20.628 whirling_dragon_punch Fluffy_Pillow 71.7/100: 72% energy | 0.0/5: 0% chi
7:22.431 tiger_palm Fluffy_Pillow 91.2/100: 91% energy | 0.0/5: 0% chi
7:23.436 Waiting 4.200 sec 92.1/100: 92% energy | 0.0/5: 0% chi

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 626 626 0
Agility 4186 3923 2455 (1596)
Stamina 4039 4039 3148
Intellect 1041 1041 0
Spirit 784 784 0
Health 242340 242340 0
Energy 100 100 0
Chi 5 5 0
Crit 29.48% 27.21% 1343
Haste 8.23% 8.23% 823
Damage / Heal Versatility 3.24% 3.24% 421
ManaReg per Second 640 640 0
Attack Power 4186 3923 0
Mastery 15.90% 15.90% 519
Armor 952 952 952
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 654.00
Local Head Primal Gladiator's Ironskin Helm
ilevel: 660, stats: { 127 Armor, +221 AgiInt, +331 Sta, +147 Haste, +147 Crit }
Local Neck Flechette-Riddled Chain
ilevel: 670, stats: { +136 Agi, +204 Sta, +99 Haste, +77 Vers }
Local Shoulders Deep Walker Paulders
ilevel: 676, stats: { 127 Armor, +192 AgiInt, +289 Sta, +145 Crit, +100 Haste }
Local Chest Vest of Forceful Fury
ilevel: 670, stats: { 164 Armor, +242 AgiInt, +364 Sta, +158 Crit, +164 Mastery }
Local Waist Belt of Bloody Guts
ilevel: 655, stats: { 85 Armor, +158 AgiInt, +237 Sta, +115 Crit, +90 Mastery }
Local Legs Primal Gladiator's Legguards
ilevel: 660, stats: { 136 Armor, +221 AgiInt, +331 Sta, +147 Mastery, +147 Crit }
Local Feet Sandals of Mycoid Musing
ilevel: 655, stats: { 104 Armor, +158 AgiInt, +237 Sta, +118 Mastery, +85 Vers }
Local Wrists Bracers of Spare Skin
ilevel: 655, stats: { 66 Armor, +119 AgiInt, +178 Sta, +88 Crit, +64 Haste }
Local Hands Treacherous Palms
ilevel: 670, stats: { 103 Armor, +182 AgiInt, +273 Sta, +121 Crit, +121 Haste }
Local Finger1 Ring of Enfeebling Accusations
ilevel: 640, stats: { +103 StrAgi, +155 Sta, +77 Vers, +54 Haste }
Local Finger2 Solium Band of Dexterity
ilevel: 640, stats: { +103 Agi, +155 Sta, +72 Crit, +64 Vers }
Local Trinket1 Grandiose Plans
ilevel: 645, stats: { +183 Agi, +183 Haste }
Local Trinket2 Bloodmaw's Tooth
ilevel: 640, stats: { +175 Agi, +175 Crit }
Local Back Cloak of Cascading Blades
ilevel: 615, stats: { 40 Armor, +82 Agi, +122 Sta, +55 Haste, +53 Crit }
Local Main Hand The Bladefist
ilevel: 655, weapon: { 535 - 996, 2.6 }, stats: { +90 Agi, +136 Sta, +61 Crit, +59 Vers }
Local Off Hand The Bladefist
ilevel: 655, weapon: { 535 - 996, 2.6 }, stats: { +90 Agi, +136 Sta, +61 Crit, +59 Vers }
Local Tabard Order of the Cloud Serpent Tabard
ilevel: 1

Talents

Level
15 Chi Burst Eye of the Tiger Chi Wave
30 Chi Torpedo Tiger's Lust Celerity
45 Energizing Elixir (Windwalker Monk) Ascension (Windwalker Monk) Power Strikes (Windwalker Monk)
60 Ring of Peace Dizzying Kicks (Windwalker Monk) Leg Sweep
75 Healing Elixir Diffuse Magic Dampen Harm
90 Rushing Jade Wind Invoke Xuen, the White Tiger (Windwalker Monk) Hit Combo (Windwalker Monk)
100 Chi Orbit (Windwalker Monk) Whirling Dragon Punch (Windwalker Monk) Serenity (Windwalker Monk)

Profile

monk="Malikoom"
origin="https://eu.api.battle.net/wow/character/hyjal/Malikoom/advanced"
thumbnail="http://eu.battle.net/static-render/eu/hyjal/85/114737493-avatar.jpg"
level=100
race=pandaren_alliance
role=dps
position=back
professions=mining=585/jewelcrafting=90
talents=http://eu.battle.net/wow/en/tool/talent-calculator#fb!2102101
spec=windwalker

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=greater_draenic_agility_flask
actions.precombat+=/food,type=salty_squid_roll
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=draenic_agility

# Executed every time the actor is available.
actions=auto_attack
actions+=/invoke_xuen
actions+=/potion,name=draenic_agility,if=buff.serenity.up|buff.storm_earth_and_fire.up|(!talent.serenity.enabled&trinket.proc.agility.react)|buff.bloodlust.react|target.time_to_die<=60
actions+=/touch_of_death,if=!artifact.gale_burst.enabled
actions+=/touch_of_death,if=artifact.gale_burst.enabled&cooldown.strike_of_the_windlord.remains<8&cooldown.fists_of_fury.remains<=3&cooldown.rising_sun_kick.remains<8
actions+=/blood_fury
actions+=/berserking
actions+=/arcane_torrent,if=chi.max-chi>=1
actions+=/storm_earth_and_fire,if=artifact.strike_of_the_windlord.enabled&cooldown.strike_of_the_windlord.remains<14&cooldown.fists_of_fury.remains<=9&cooldown.rising_sun_kick.remains<=5
actions+=/storm_earth_and_fire,if=!artifact.strike_of_the_windlord.enabled&cooldown.fists_of_fury.remains<=9&cooldown.rising_sun_kick.remains<=5
actions+=/serenity,if=artifact.strike_of_the_windlord.enabled&cooldown.strike_of_the_windlord.remains<7&cooldown.fists_of_fury.remains<=3&cooldown.rising_sun_kick.remains<8
actions+=/serenity,if=!artifact.strike_of_the_windlord.enabled&cooldown.fists_of_fury.remains<=3&cooldown.rising_sun_kick.remains<8
actions+=/energizing_elixir,if=energy<energy.max&chi<=1&buff.serenity.down
actions+=/rushing_jade_wind,if=buff.serenity.up&!prev_gcd.rushing_jade_wind
actions+=/strike_of_the_windlord
actions+=/whirling_dragon_punch
actions+=/fists_of_fury
actions+=/call_action_list,name=st,if=active_enemies<3
actions+=/call_action_list,name=aoe,if=active_enemies>=3

actions.opener=blood_fury
actions.opener+=/berserking
actions.opener+=/arcane_torrent,if=chi.max-chi>=1
actions.opener+=/fists_of_fury,if=buff.serenity.up&buff.serenity.remains<1.5
actions.opener+=/rising_sun_kick
actions.opener+=/blackout_kick,if=chi.max-chi<=1&cooldown.chi_brew.up|buff.serenity.up
actions.opener+=/serenity,if=chi.max-chi<=2
actions.opener+=/tiger_palm,if=chi.max-chi>=2&!buff.serenity.up

actions.st=rising_sun_kick
actions.st+=/rushing_jade_wind,if=chi>1&!prev_gcd.rushing_jade_wind
actions.st+=/chi_wave,if=energy.time_to_max>2|buff.serenity.down
actions.st+=/chi_burst,if=energy.time_to_max>2|buff.serenity.down
actions.st+=/blackout_kick,if=(chi>1|buff.bok_proc.up)&buff.serenity.down&!prev_gcd.blackout_kick
actions.st+=/tiger_palm,if=(buff.serenity.down&chi<=2)&!prev_gcd.tiger_palm

actions.aoe=spinning_crane_kick,if=!prev_gcd.spinning_crane_kick
actions.aoe+=/rising_sun_kick,cycle_targets=1
actions.aoe+=/rushing_jade_wind,if=chi>1&!prev_gcd.rushing_jade_wind
actions.aoe+=/chi_wave,if=energy.time_to_max>2|buff.serenity.down
actions.aoe+=/chi_burst,if=energy.time_to_max>2|buff.serenity.down
actions.aoe+=/blackout_kick,if=(chi>1|buff.bok_proc.up)&!prev_gcd.blackout_kick,cycle_targets=1
actions.aoe+=/tiger_palm,if=(buff.serenity.down&chi.max-chi>1)&!prev_gcd.tiger_palm,cycle_targets=1

head=primal_gladiators_ironskin_helm,id=115692
neck=flechetteriddled_chain,id=113647,bonus_id=566
shoulders=deep_walker_paulders,id=113661,bonus_id=561/566
back=cloak_of_cascading_blades,id=109904,bonus_id=522
chest=vest_of_forceful_fury,id=113870
tabard=order_of_the_cloud_serpent_tabard,id=89796
wrists=bracers_of_spare_skin,id=113634
hands=treacherous_palms,id=113832,bonus_id=566
waist=belt_of_bloody_guts,id=113636
legs=primal_gladiators_legguards,id=115776
feet=sandals_of_mycoid_musing,id=113664
finger1=ring_of_enfeebling_accusations,id=116283
finger2=solium_band_of_dexterity,id=118292
trinket1=grandiose_plans,id=114549
trinket2=bloodmaws_tooth,id=116289
main_hand=the_bladefist,id=113591
off_hand=the_bladefist,id=113591

# Gear Summary
# gear_ilvl=653.81
# gear_agility=2455
# gear_stamina=3148
# gear_crit_rating=1343
# gear_haste_rating=823
# gear_mastery_rating=519
# gear_versatility_rating=421
# gear_armor=952

Müjnir

Müjnir : 98668 dps

  • Race: Pandaren Alliance
  • Class: Monk
  • Spec: Mistweaver
  • Level: 110
  • Role: Hybrid
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
98667.7 98667.7 37.4 / 0.038% 7466.5 / 7.6% 37.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
2627.0 2627.0 Mana 0.00% 46.8 100.0% 100%
Origin https://eu.api.battle.net/wow/character/hyjal/Müjnir/advanced
Talents
  • 15: Chi Burst
  • 30: Tiger's Lust
  • 45: Lifecycles (Mistweaver Monk)
  • 60: Leg Sweep
  • 75: Diffuse Magic
  • 90: Invoke Chi-Ji, the Red Crane (Mistweaver Monk)
  • 100: Focused Thunder (Mistweaver Monk)
  • Talent Calculator
Artifact
Professions
  • herbalism: 785
  • inscription: 717

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Müjnir 98668
Blackout Kick 23350 (46707) 23.7% (47.4%) 120.2 3.72sec 174948 136149 Direct 120.2 72871 145741 87462 20.0%  

Stats details: blackout_kick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 120.19 120.19 0.00 0.00 1.2850 0.0000 10512354.77 15454157.26 31.98 136148.51 136148.51
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 96.13 79.98% 72870.73 72871 72871 72870.73 72871 72871 7005027 10298054 31.98
crit 24.07 20.02% 145741.45 145741 145741 145741.45 145741 145741 3507327 5156103 31.98
 
 

Action details: blackout_kick

Static Values
  • id:228649
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.teachings_of_the_monastery.up
Spelldata
  • id:228649
  • name:Blackout Kick
  • school:physical
  • tooltip:
  • description:Kick with a blast of Chi energy, dealing {$s1=0} Physical damage.
 
    Blackout Kick (_totm_proc) 23357 23.7% 0.0 0.00sec 0 0 Direct 120.2 72871 145741 87487 20.1%  

Stats details: blackout_kick_totm_proc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 120.19 0.00 0.00 0.0000 0.0000 10515510.38 15458796.32 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 96.09 79.94% 72870.73 72871 72871 72870.73 72871 72871 7001872 10293415 31.98
crit 24.11 20.06% 145741.45 145741 145741 145741.45 145741 145741 3513639 5165381 31.98
 
 

Action details: blackout_kick_totm_proc

Static Values
  • id:228649
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:228649
  • name:Blackout Kick
  • school:physical
  • tooltip:
  • description:Kick with a blast of Chi energy, dealing {$s1=0} Physical damage.
 
Chi Burst (_damage) 4925 5.0% 14.2 32.90sec 156421 0 Direct 14.2 130432 260864 156429 19.9%  

Stats details: chi_burst_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.17 14.17 0.00 0.00 0.0000 0.0000 2216713.82 2216713.82 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.35 80.07% 130431.76 130432 130432 130431.76 130432 130432 1480092 1480092 0.00
crit 2.82 19.93% 260863.52 260864 260864 248653.89 0 260864 736622 736622 0.00
 
 

Action details: chi_burst_damage

Static Values
  • id:148135
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:148135
  • name:Chi Burst
  • school:nature
  • tooltip:
  • description:{$@spelldesc123986=Hurls a torrent of Chi energy up to 40 yds forward, dealing $<damage> Nature damage to all enemies, and $<healing> healing to the Monk and all allies in its path.$?c1[ Casting Chi Burst does not prevent avoiding attacks.][]}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:4.125000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Deadly Grace 2761 2.8% 13.0 1.80sec 94204 0 Direct 13.0 78452 156904 94203 20.1%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.99 12.99 0.00 0.00 0.0000 0.0000 1223499.30 1223499.30 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.38 79.92% 78451.77 78452 78452 78451.77 78452 78452 814332 814332 0.00
crit 2.61 20.08% 156903.55 156904 156904 146813.64 0 156904 409167 409167 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:5.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=47572 to 71358} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:47572.00
  • base_dd_max:71358.00
 
melee_main_hand 10376 10.5% 144.4 3.14sec 32348 10612 Direct 144.4 26937 53874 32348 20.1%  

Stats details: melee_main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 144.40 144.40 0.00 0.00 3.0483 0.0000 4671087.36 6866940.88 31.98 10611.65 10611.65
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 115.40 79.91% 26937.22 26937 26937 26937.22 26937 26937 3108524 4569825 31.98
crit 29.00 20.09% 53874.44 53874 53874 53874.44 53874 53874 1562563 2297116 31.98
 
 

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Rising Sun Kick 24967 25.3% 47.8 9.48sec 235154 182937 Direct 47.8 195727 391454 235152 20.1%  

Stats details: rising_sun_kick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.81 47.81 0.00 0.00 1.2855 0.0000 11242185.07 16527076.95 31.98 182936.59 182936.59
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.18 79.86% 195727.16 195727 195727 195727.16 195727 195727 7472338 10985045 31.98
crit 9.63 20.14% 391454.32 391454 391454 391454.32 391454 391454 3769847 5542032 31.98
 
 

Action details: rising_sun_kick

Static Values
  • id:107428
  • school:physical
  • resource:mana
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:24750.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.teachings_of_the_monastery.up
Spelldata
  • id:107428
  • name:Rising Sun Kick
  • school:physical
  • tooltip:
  • description:Kick upwards, dealing {$185099s1=0} damage{$?s128595=false}[, and reducing the effectiveness of healing on the target for {$115804d=10 seconds}][].
 
Tiger Palm 8932 9.1% 168.5 2.67sec 23868 18597 Direct 168.5 19875 39749 23868 20.1%  

Stats details: tiger_palm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 168.47 168.47 0.00 0.00 1.2834 0.0000 4021088.28 5911380.66 31.98 18597.21 18597.21
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 134.62 79.91% 19874.62 19875 19875 19874.62 19875 19875 2675597 3933381 31.98
crit 33.85 20.09% 39749.25 39749 39749 39749.25 39749 39749 1345492 1978000 31.98
 
 

Action details: tiger_palm

Static Values
  • id:100780
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.teachings_of_the_monastery.down
Spelldata
  • id:100780
  • name:Tiger Palm
  • school:physical
  • tooltip:
  • description:Attack with the palm of your hand, dealing {$s1=1} damage.$?a137025[ Tiger Palm has an $137384m1% chance to make your next Blackout Kick cost no Chi.][]$?a137023[ Reduces the remaining cooldown on your Brews by {$s3=1} sec.][]$?a137025[ |cFFFFFFFFGenerates {$s2=1} Chi.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.050000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Simple Action Stats Execute Interval
Müjnir
Chi Burst 14.2 32.90sec

Stats details: chi_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.17 0.00 0.00 0.00 1.2981 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: chi_burst

Static Values
  • id:123986
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:30.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:123986
  • name:Chi Burst
  • school:nature
  • tooltip:
  • description:Hurls a torrent of Chi energy up to 40 yds forward, dealing $<damage> Nature damage to all enemies, and $<healing> healing to the Monk and all allies in its path.$?c1[ Casting Chi Burst does not prevent avoiding attacks.][]
 
Chi Burst (_heal) 14.2 32.90sec

Stats details: chi_burst_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 14.17 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: chi_burst_heal

Static Values
  • id:130654
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Müjnir
  • harmful:false
  • if_expr:
Spelldata
  • id:130654
  • name:Chi Burst
  • school:nature
  • tooltip:
  • description:{$@spelldesc123986=Hurls a torrent of Chi energy up to 40 yds forward, dealing $<damage> Nature damage to all enemies, and $<healing> healing to the Monk and all allies in its path.$?c1[ Casting Chi Burst does not prevent avoiding attacks.][]}
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Müjnir
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Müjnir
  • harmful:false
  • if_expr:
 
potion 1.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Pulse 13.7 32.95sec

Stats details: pulse

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 13.74 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: pulse

Static Values
  • id:215263
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Müjnir
  • harmful:true
  • if_expr:
Spelldata
  • id:215263
  • name:Pulse
  • school:arcane
  • tooltip:
  • description:{$@spelldesc215264=Your healing spells have a chance to launch a Pulse at your target, healing them for {$215263s1=21636 to 23914} and bouncing to up to ${$215263x1-1} additional targets.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:21636.27
  • base_dd_max:23913.77
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 11.28% 0.0(0.0) 1.0

Buff details

  • buff initial source:Müjnir
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Potion of Deadly Grace 1.0 0.0 0.0sec 0.0sec 5.19% 5.26% 0.0(0.0) 1.0

Buff details

  • buff initial source:Müjnir
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:5.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Teachings of the Monastery 168.5 0.0 2.7sec 2.7sec 48.07% 49.93% 0.0(0.0) 0.0

Buff details

  • buff initial source:Müjnir
  • cooldown name:buff_teachings_of_the_monastery
  • max_stacks:3
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.01

Stack Uptimes

  • teachings_of_the_monastery_1:48.07%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202090
  • name:Teachings of the Monastery
  • tooltip:Your next Blackout Kick strikes an additional $m1 $Ltime:times;{$?s210802=false}[ and restores ${$210803m~1*$m1/100}.2% mana][].
  • description:{$@spelldesc116645=Tiger Palm causes your next Blackout Kick to strike an additional time, stacking up to {$202090u=3}. Blackout Kick has a {$s1=15}% chance to reset the remaining cooldown on Rising Sun Kick.}
  • max_stacks:3
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Flask of the Whispered Pact

Buff details

  • buff initial source:Müjnir
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (nightborne_delicacy_platter)

Buff details

  • buff initial source:Müjnir
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:750.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Windwalking (_movement_aura)

Buff details

  • buff initial source:Müjnir
  • cooldown name:buff_windwalking_movement_aura
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • windwalking_movement_aura_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:166646
  • name:Windwalking
  • tooltip:Movement speed increased by {$s1=10}%.
  • description:
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Müjnir
rising_sun_kick Mana 47.8 1183224.1 24750.0 24749.7 9.5
Resource Gains Type Count Total Average Overflow
mp5_regen Mana 512.13 1177993.40 (100.00%) 2300.18 2780976.27 70.24%
Resource RPS-Gain RPS-Loss
Mana 2615.35 2626.97
Combat End Resource Mean Min Max
Mana 1094620.38 1075250.00 1100000.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 60.5%

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Müjnir Fight Length
Count 9999
Mean 450.42
Minimum 350.15
Maximum 555.44
Spread ( max - min ) 205.29
Range [ ( max - min ) / 2 * 100% ] 22.79%
DPS
Sample Data Müjnir Damage Per Second
Count 9999
Mean 98667.65
Minimum 92539.88
Maximum 107547.48
Spread ( max - min ) 15007.59
Range [ ( max - min ) / 2 * 100% ] 7.61%
Standard Deviation 1910.2018
5th Percentile 95644.28
95th Percentile 101941.07
( 95th Percentile - 5th Percentile ) 6296.79
Mean Distribution
Standard Deviation 19.1030
95.00% Confidence Intervall ( 98630.21 - 98705.09 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 14
0.1% Error 1439
0.1 Scale Factor Error with Delta=300 31148
0.05 Scale Factor Error with Delta=300 124595
0.01 Scale Factor Error with Delta=300 3114886
Priority Target DPS
Sample Data Müjnir Priority Target Damage Per Second
Count 9999
Mean 98667.65
Minimum 92539.88
Maximum 107547.48
Spread ( max - min ) 15007.59
Range [ ( max - min ) / 2 * 100% ] 7.61%
Standard Deviation 1910.2018
5th Percentile 95644.28
95th Percentile 101941.07
( 95th Percentile - 5th Percentile ) 6296.79
Mean Distribution
Standard Deviation 19.1030
95.00% Confidence Intervall ( 98630.21 - 98705.09 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 14
0.1% Error 1439
0.1 Scale Factor Error with Delta=300 31148
0.05 Scale Factor Error with Delta=300 124595
0.01 Scale Factor Error with Delta=300 3114886
DPS(e)
Sample Data Müjnir Damage Per Second (Effective)
Count 9999
Mean 98667.65
Minimum 92539.88
Maximum 107547.48
Spread ( max - min ) 15007.59
Range [ ( max - min ) / 2 * 100% ] 7.61%
Damage
Sample Data Müjnir Damage
Count 9999
Mean 44402438.99
Minimum 33792336.29
Maximum 55899542.59
Spread ( max - min ) 22107206.30
Range [ ( max - min ) / 2 * 100% ] 24.89%
DTPS
Sample Data Müjnir Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Müjnir Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Müjnir Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Müjnir Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Müjnir Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Müjnir Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data MüjnirTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Müjnir Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Total Stagger damage generated
Sample Data Total Stagger damage generated
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Stagger damage that was not purified
Sample Data Stagger damage that was not purified
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Stagger damage that was purified
Sample Data Stagger damage that was purified
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Amount of damage purified while at light stagger
Sample Data Amount of damage purified while at light stagger
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Amount of damage purified while at moderate stagger
Sample Data Amount of damage purified while at moderate stagger
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Amount of damage purified while at heavy stagger
Sample Data Amount of damage purified while at heavy stagger
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_whispered_pact
1 0.00 food,type=nightborne_delicacy_platter
2 0.00 snapshot_stats
3 0.00 potion,name=deadly_grace
Default action list Executed every time the actor is available.
# count action,conditions
4 1.00 auto_attack
0.00 invoke_xuen
0.00 blood_fury,if=target.time_to_die<18
0.00 berserking,if=target.time_to_die<18
0.00 arcane_torrent,if=chi.max-chi>=1&target.time_to_die<18
0.00 potion,name=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=60
5 0.00 run_action_list,name=aoe,if=active_enemies>=3
6 0.00 call_action_list,name=st,if=active_enemies<3
actions.st
# count action,conditions
7 47.81 rising_sun_kick,if=buff.teachings_of_the_monastery.up
8 120.20 blackout_kick,if=buff.teachings_of_the_monastery.up
9 14.20 chi_burst
A 168.47 tiger_palm,if=buff.teachings_of_the_monastery.down

Sample Sequence

01349A7A8A8A7A8A7A8A8A8A7A8A7A8A7A89A7A8A7A8A8A8A8A7A8A8A8A8A79A8A8A8A7A8A8A8A8A7A8A7A89A8A7A8A7A8A7A8A8A8A7A8A89A8A7A8A7A8A8A8A7A8A8A8A79A8A8A8A7A8A7A8A8A8A8A7A89A8A7A8A8A8A8A7A8A8A8A8A79A8A8A7A8A7A8A7A8A8A8A7A89A8A7A8A8A8A8A7A8A7A8A8A89A7A8A8A7A8A8A7A8A8A7A8A89A8A7A8A8A7A8A8A7A8A7A8A89A8A7A8A7A8A8A8A7A8A8A7A89A8A7A8A8A7A8A8A8A7A8A8A79A8A8A8A7A8A8A8

Sample Sequence Table

time name target resources buffs
Pre flask Müjnir 1100000.0/1100000: 100% mana
Pre food Müjnir 1100000.0/1100000: 100% mana
Pre potion Fluffy_Pillow 1100000.0/1100000: 100% mana potion_of_deadly_grace
0:00.000 auto_attack Fluffy_Pillow 1100000.0/1100000: 100% mana potion_of_deadly_grace
0:00.000 chi_burst Fluffy_Pillow 1100000.0/1100000: 100% mana potion_of_deadly_grace
0:01.246 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana bloodlust, potion_of_deadly_grace
0:02.262 rising_sun_kick Fluffy_Pillow 1100000.0/1100000: 100% mana bloodlust, teachings_of_the_monastery, potion_of_deadly_grace
0:03.278 tiger_palm Fluffy_Pillow 1084190.8/1100000: 99% mana bloodlust, potion_of_deadly_grace
0:04.294 blackout_kick Fluffy_Pillow 1093131.6/1100000: 99% mana bloodlust, teachings_of_the_monastery, potion_of_deadly_grace
0:05.309 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana bloodlust, potion_of_deadly_grace
0:06.325 blackout_kick Fluffy_Pillow 1100000.0/1100000: 100% mana bloodlust, teachings_of_the_monastery, potion_of_deadly_grace
0:07.340 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana bloodlust, potion_of_deadly_grace
0:08.357 rising_sun_kick Fluffy_Pillow 1100000.0/1100000: 100% mana bloodlust, teachings_of_the_monastery, potion_of_deadly_grace
0:09.372 tiger_palm Fluffy_Pillow 1084182.0/1100000: 99% mana bloodlust, potion_of_deadly_grace
0:10.386 blackout_kick Fluffy_Pillow 1093105.2/1100000: 99% mana bloodlust, teachings_of_the_monastery, potion_of_deadly_grace
0:11.401 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana bloodlust, potion_of_deadly_grace
0:12.418 rising_sun_kick Fluffy_Pillow 1100000.0/1100000: 100% mana bloodlust, teachings_of_the_monastery, potion_of_deadly_grace
0:13.434 tiger_palm Fluffy_Pillow 1084190.8/1100000: 99% mana bloodlust, potion_of_deadly_grace
0:14.450 blackout_kick Fluffy_Pillow 1093131.6/1100000: 99% mana bloodlust, teachings_of_the_monastery, potion_of_deadly_grace
0:15.465 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana bloodlust, potion_of_deadly_grace
0:16.480 blackout_kick Fluffy_Pillow 1100000.0/1100000: 100% mana bloodlust, teachings_of_the_monastery, potion_of_deadly_grace
0:17.494 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana bloodlust, potion_of_deadly_grace
0:18.511 blackout_kick Fluffy_Pillow 1100000.0/1100000: 100% mana bloodlust, teachings_of_the_monastery, potion_of_deadly_grace
0:19.528 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana bloodlust, potion_of_deadly_grace
0:20.543 rising_sun_kick Fluffy_Pillow 1100000.0/1100000: 100% mana bloodlust, teachings_of_the_monastery, potion_of_deadly_grace
0:21.559 tiger_palm Fluffy_Pillow 1084190.8/1100000: 99% mana bloodlust, potion_of_deadly_grace
0:22.573 blackout_kick Fluffy_Pillow 1093114.0/1100000: 99% mana bloodlust, teachings_of_the_monastery, potion_of_deadly_grace
0:23.588 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana bloodlust
0:24.602 rising_sun_kick Fluffy_Pillow 1100000.0/1100000: 100% mana bloodlust, teachings_of_the_monastery
0:25.619 tiger_palm Fluffy_Pillow 1084199.6/1100000: 99% mana bloodlust
0:26.634 blackout_kick Fluffy_Pillow 1093131.6/1100000: 99% mana bloodlust, teachings_of_the_monastery
0:27.651 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana bloodlust
0:28.668 rising_sun_kick Fluffy_Pillow 1100000.0/1100000: 100% mana bloodlust, teachings_of_the_monastery
0:29.683 tiger_palm Fluffy_Pillow 1084182.0/1100000: 99% mana bloodlust
0:30.699 blackout_kick Fluffy_Pillow 1093122.8/1100000: 99% mana bloodlust, teachings_of_the_monastery
0:31.715 chi_burst Fluffy_Pillow 1100000.0/1100000: 100% mana bloodlust
0:32.729 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana bloodlust
0:33.745 rising_sun_kick Fluffy_Pillow 1100000.0/1100000: 100% mana bloodlust, teachings_of_the_monastery
0:34.759 tiger_palm Fluffy_Pillow 1084173.2/1100000: 99% mana bloodlust
0:35.774 blackout_kick Fluffy_Pillow 1093105.2/1100000: 99% mana bloodlust, teachings_of_the_monastery
0:36.789 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana bloodlust
0:37.804 rising_sun_kick Fluffy_Pillow 1100000.0/1100000: 100% mana bloodlust, teachings_of_the_monastery
0:38.819 tiger_palm Fluffy_Pillow 1084182.0/1100000: 99% mana bloodlust
0:39.835 blackout_kick Fluffy_Pillow 1093122.8/1100000: 99% mana bloodlust, teachings_of_the_monastery
0:40.852 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana bloodlust
0:41.867 blackout_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
0:43.188 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
0:44.507 blackout_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
0:45.826 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
0:47.144 blackout_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
0:48.464 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
0:49.785 rising_sun_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
0:51.123 tiger_palm Fluffy_Pillow 1086857.2/1100000: 99% mana
0:52.442 blackout_kick Fluffy_Pillow 1098464.4/1100000: 100% mana teachings_of_the_monastery
0:53.761 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
0:55.080 blackout_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
0:56.399 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
0:57.719 blackout_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
0:59.039 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
1:00.359 blackout_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
1:01.679 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
1:03.002 rising_sun_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
1:04.321 chi_burst Fluffy_Pillow 1086857.2/1100000: 99% mana
1:05.639 tiger_palm Fluffy_Pillow 1098455.6/1100000: 100% mana
1:06.959 blackout_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
1:08.278 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
1:09.598 blackout_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
1:10.918 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
1:12.236 blackout_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
1:13.555 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
1:14.872 rising_sun_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
1:16.322 tiger_palm Fluffy_Pillow 1086866.0/1100000: 99% mana
1:17.641 blackout_kick Fluffy_Pillow 1098473.2/1100000: 100% mana teachings_of_the_monastery
1:18.960 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
1:20.280 blackout_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
1:21.600 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
1:22.921 blackout_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
1:24.241 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
1:25.560 blackout_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
1:26.880 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
1:28.200 rising_sun_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
1:29.520 tiger_palm Fluffy_Pillow 1086866.0/1100000: 99% mana
1:30.839 blackout_kick Fluffy_Pillow 1098473.2/1100000: 100% mana teachings_of_the_monastery
1:32.158 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
1:33.477 rising_sun_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
1:34.796 tiger_palm Fluffy_Pillow 1086857.2/1100000: 99% mana
1:36.116 blackout_kick Fluffy_Pillow 1098473.2/1100000: 100% mana teachings_of_the_monastery
1:37.436 chi_burst Fluffy_Pillow 1100000.0/1100000: 100% mana
1:38.753 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
1:40.073 blackout_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
1:41.392 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
1:42.713 rising_sun_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
1:44.034 tiger_palm Fluffy_Pillow 1086874.8/1100000: 99% mana
1:45.352 blackout_kick Fluffy_Pillow 1098473.2/1100000: 100% mana teachings_of_the_monastery
1:46.673 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
1:47.992 rising_sun_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
1:49.311 tiger_palm Fluffy_Pillow 1086857.2/1100000: 99% mana
1:50.631 blackout_kick Fluffy_Pillow 1098473.2/1100000: 100% mana teachings_of_the_monastery
1:51.949 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
1:53.270 rising_sun_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
1:54.590 tiger_palm Fluffy_Pillow 1086866.0/1100000: 99% mana
1:55.911 blackout_kick Fluffy_Pillow 1098490.8/1100000: 100% mana teachings_of_the_monastery
1:57.232 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
1:58.552 blackout_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
1:59.873 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
2:01.192 blackout_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
2:02.511 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
2:03.830 rising_sun_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
2:05.151 tiger_palm Fluffy_Pillow 1086874.8/1100000: 99% mana
2:06.470 blackout_kick Fluffy_Pillow 1098482.0/1100000: 100% mana teachings_of_the_monastery
2:07.790 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
2:09.110 blackout_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
2:10.430 chi_burst Fluffy_Pillow 1100000.0/1100000: 100% mana
2:11.750 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
2:13.070 blackout_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
2:14.391 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
2:15.712 rising_sun_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
2:17.147 tiger_palm Fluffy_Pillow 1086839.6/1100000: 99% mana
2:18.466 blackout_kick Fluffy_Pillow 1098446.8/1100000: 100% mana teachings_of_the_monastery
2:19.787 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
2:21.106 rising_sun_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
2:22.426 tiger_palm Fluffy_Pillow 1086866.0/1100000: 99% mana
2:23.745 blackout_kick Fluffy_Pillow 1098473.2/1100000: 100% mana teachings_of_the_monastery
2:25.065 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
2:26.384 blackout_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
2:27.702 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
2:29.020 blackout_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
2:30.338 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
2:31.658 rising_sun_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
2:32.977 tiger_palm Fluffy_Pillow 1086857.2/1100000: 99% mana
2:34.296 blackout_kick Fluffy_Pillow 1098464.4/1100000: 100% mana teachings_of_the_monastery
2:35.616 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
2:36.936 blackout_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
2:38.256 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
2:39.573 blackout_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
2:40.890 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
2:42.209 rising_sun_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
2:43.529 chi_burst Fluffy_Pillow 1086866.0/1100000: 99% mana
2:44.849 tiger_palm Fluffy_Pillow 1098482.0/1100000: 100% mana
2:46.169 blackout_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
2:47.489 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
2:48.809 blackout_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
2:50.129 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
2:51.447 blackout_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
2:52.766 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
2:54.085 rising_sun_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
2:55.406 tiger_palm Fluffy_Pillow 1086874.8/1100000: 99% mana
2:56.726 blackout_kick Fluffy_Pillow 1098490.8/1100000: 100% mana teachings_of_the_monastery
2:58.046 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
2:59.366 rising_sun_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
3:00.686 tiger_palm Fluffy_Pillow 1086866.0/1100000: 99% mana
3:02.007 blackout_kick Fluffy_Pillow 1098490.8/1100000: 100% mana teachings_of_the_monastery
3:03.325 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
3:04.643 blackout_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
3:05.963 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
3:07.283 blackout_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
3:08.604 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
3:09.924 blackout_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
3:11.244 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
3:12.564 rising_sun_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
3:13.882 tiger_palm Fluffy_Pillow 1086848.4/1100000: 99% mana
3:15.202 blackout_kick Fluffy_Pillow 1098464.4/1100000: 100% mana teachings_of_the_monastery
3:16.522 chi_burst Fluffy_Pillow 1100000.0/1100000: 100% mana
3:17.840 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
3:19.161 blackout_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
3:20.480 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
3:21.799 rising_sun_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
3:23.118 tiger_palm Fluffy_Pillow 1086857.2/1100000: 99% mana
3:24.438 blackout_kick Fluffy_Pillow 1098473.2/1100000: 100% mana teachings_of_the_monastery
3:25.758 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
3:27.075 blackout_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
3:28.395 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
3:29.714 blackout_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
3:31.034 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
3:32.355 blackout_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
3:33.676 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
3:34.995 rising_sun_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
3:36.317 tiger_palm Fluffy_Pillow 1086883.6/1100000: 99% mana
3:37.636 blackout_kick Fluffy_Pillow 1098490.8/1100000: 100% mana teachings_of_the_monastery
3:38.954 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
3:40.273 blackout_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
3:41.592 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
3:42.911 blackout_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
3:44.229 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
3:45.549 blackout_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
3:46.870 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
3:48.190 rising_sun_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
3:49.511 chi_burst Fluffy_Pillow 1086874.8/1100000: 99% mana
3:50.831 tiger_palm Fluffy_Pillow 1098490.8/1100000: 100% mana
3:52.150 blackout_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
3:53.470 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
3:54.788 blackout_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
3:56.108 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
3:57.428 rising_sun_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
3:58.746 tiger_palm Fluffy_Pillow 1086848.4/1100000: 99% mana
4:00.067 blackout_kick Fluffy_Pillow 1098473.2/1100000: 100% mana teachings_of_the_monastery
4:01.387 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
4:02.706 rising_sun_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
4:04.027 tiger_palm Fluffy_Pillow 1086874.8/1100000: 99% mana
4:05.347 blackout_kick Fluffy_Pillow 1098490.8/1100000: 100% mana teachings_of_the_monastery
4:06.665 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
4:07.985 rising_sun_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
4:09.304 tiger_palm Fluffy_Pillow 1086857.2/1100000: 99% mana
4:10.622 blackout_kick Fluffy_Pillow 1098455.6/1100000: 100% mana teachings_of_the_monastery
4:11.942 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
4:13.263 blackout_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
4:14.582 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
4:15.903 blackout_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
4:17.224 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
4:18.542 rising_sun_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
4:19.861 tiger_palm Fluffy_Pillow 1086857.2/1100000: 99% mana
4:21.181 blackout_kick Fluffy_Pillow 1098473.2/1100000: 100% mana teachings_of_the_monastery
4:22.502 chi_burst Fluffy_Pillow 1100000.0/1100000: 100% mana
4:23.822 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
4:25.141 blackout_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
4:26.459 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
4:27.779 rising_sun_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
4:29.099 tiger_palm Fluffy_Pillow 1086866.0/1100000: 99% mana
4:30.418 blackout_kick Fluffy_Pillow 1098473.2/1100000: 100% mana teachings_of_the_monastery
4:31.739 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
4:33.059 blackout_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
4:34.380 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
4:35.699 blackout_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
4:37.020 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
4:38.340 blackout_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
4:39.660 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
4:40.979 rising_sun_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
4:42.299 tiger_palm Fluffy_Pillow 1086866.0/1100000: 99% mana
4:43.620 blackout_kick Fluffy_Pillow 1098490.8/1100000: 100% mana teachings_of_the_monastery
4:44.940 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
4:46.258 rising_sun_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
4:47.579 tiger_palm Fluffy_Pillow 1086874.8/1100000: 99% mana
4:48.899 blackout_kick Fluffy_Pillow 1098490.8/1100000: 100% mana teachings_of_the_monastery
4:50.218 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
4:51.538 blackout_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
4:52.855 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
4:54.175 blackout_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
4:55.495 chi_burst Fluffy_Pillow 1100000.0/1100000: 100% mana
4:56.814 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
4:58.134 rising_sun_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
4:59.577 tiger_palm Fluffy_Pillow 1086857.2/1100000: 99% mana
5:00.896 blackout_kick Fluffy_Pillow 1098464.4/1100000: 100% mana teachings_of_the_monastery
5:02.214 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
5:03.535 blackout_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
5:04.854 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
5:06.173 rising_sun_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
5:07.492 tiger_palm Fluffy_Pillow 1086857.2/1100000: 99% mana
5:08.812 blackout_kick Fluffy_Pillow 1098473.2/1100000: 100% mana teachings_of_the_monastery
5:10.131 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
5:11.451 blackout_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
5:12.770 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
5:14.090 rising_sun_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
5:15.410 tiger_palm Fluffy_Pillow 1086866.0/1100000: 99% mana
5:16.729 blackout_kick Fluffy_Pillow 1098473.2/1100000: 100% mana teachings_of_the_monastery
5:18.048 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
5:19.367 blackout_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
5:20.685 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
5:22.003 rising_sun_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
5:23.323 tiger_palm Fluffy_Pillow 1086866.0/1100000: 99% mana
5:24.642 blackout_kick Fluffy_Pillow 1098473.2/1100000: 100% mana teachings_of_the_monastery
5:25.962 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
5:27.282 blackout_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
5:28.601 chi_burst Fluffy_Pillow 1100000.0/1100000: 100% mana
5:29.919 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
5:31.238 blackout_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
5:32.556 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
5:33.874 rising_sun_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
5:35.322 tiger_palm Fluffy_Pillow 1086857.2/1100000: 99% mana
5:36.643 blackout_kick Fluffy_Pillow 1098482.0/1100000: 100% mana teachings_of_the_monastery
5:37.962 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
5:39.282 blackout_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
5:40.600 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
5:41.919 rising_sun_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
5:43.239 tiger_palm Fluffy_Pillow 1086866.0/1100000: 99% mana
5:44.557 blackout_kick Fluffy_Pillow 1098464.4/1100000: 100% mana teachings_of_the_monastery
5:45.878 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
5:47.198 blackout_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
5:48.519 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
5:49.837 rising_sun_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
5:51.158 tiger_palm Fluffy_Pillow 1086874.8/1100000: 99% mana
5:52.477 blackout_kick Fluffy_Pillow 1098482.0/1100000: 100% mana teachings_of_the_monastery
5:53.798 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
5:55.118 rising_sun_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
5:56.438 tiger_palm Fluffy_Pillow 1086866.0/1100000: 99% mana
5:57.757 blackout_kick Fluffy_Pillow 1098473.2/1100000: 100% mana teachings_of_the_monastery
5:59.078 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
6:00.398 blackout_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
6:01.716 chi_burst Fluffy_Pillow 1100000.0/1100000: 100% mana
6:03.035 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
6:04.353 blackout_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
6:05.671 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
6:06.990 rising_sun_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
6:08.309 tiger_palm Fluffy_Pillow 1086857.2/1100000: 99% mana
6:09.628 blackout_kick Fluffy_Pillow 1098464.4/1100000: 100% mana teachings_of_the_monastery
6:10.949 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
6:12.268 rising_sun_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
6:13.586 tiger_palm Fluffy_Pillow 1086848.4/1100000: 99% mana
6:14.905 blackout_kick Fluffy_Pillow 1098455.6/1100000: 100% mana teachings_of_the_monastery
6:16.224 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
6:17.544 blackout_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
6:18.862 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
6:20.182 blackout_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
6:21.502 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
6:22.821 rising_sun_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
6:24.141 tiger_palm Fluffy_Pillow 1086866.0/1100000: 99% mana
6:25.460 blackout_kick Fluffy_Pillow 1098473.2/1100000: 100% mana teachings_of_the_monastery
6:26.778 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
6:28.098 blackout_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
6:29.417 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
6:30.738 rising_sun_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
6:32.058 tiger_palm Fluffy_Pillow 1086866.0/1100000: 99% mana
6:33.378 blackout_kick Fluffy_Pillow 1098482.0/1100000: 100% mana teachings_of_the_monastery
6:34.697 chi_burst Fluffy_Pillow 1100000.0/1100000: 100% mana
6:36.017 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
6:37.335 blackout_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
6:38.655 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
6:39.977 rising_sun_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
6:41.297 tiger_palm Fluffy_Pillow 1086866.0/1100000: 99% mana
6:42.617 blackout_kick Fluffy_Pillow 1098482.0/1100000: 100% mana teachings_of_the_monastery
6:43.936 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
6:45.256 blackout_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
6:46.575 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
6:47.895 rising_sun_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
6:49.214 tiger_palm Fluffy_Pillow 1086857.2/1100000: 99% mana
6:50.533 blackout_kick Fluffy_Pillow 1098464.4/1100000: 100% mana teachings_of_the_monastery
6:51.853 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
6:53.174 blackout_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
6:54.494 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
6:55.812 blackout_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
6:57.133 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
6:58.454 rising_sun_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
6:59.772 tiger_palm Fluffy_Pillow 1086848.4/1100000: 99% mana
7:01.092 blackout_kick Fluffy_Pillow 1098464.4/1100000: 100% mana teachings_of_the_monastery
7:02.414 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
7:03.733 blackout_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
7:05.053 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
7:06.372 rising_sun_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
7:07.692 chi_burst Fluffy_Pillow 1086866.0/1100000: 99% mana
7:09.011 tiger_palm Fluffy_Pillow 1098473.2/1100000: 100% mana
7:10.331 blackout_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
7:11.650 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
7:12.971 blackout_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
7:14.291 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
7:15.610 blackout_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
7:16.928 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
7:18.249 rising_sun_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
7:19.692 tiger_palm Fluffy_Pillow 1086866.0/1100000: 99% mana
7:21.011 blackout_kick Fluffy_Pillow 1098473.2/1100000: 100% mana teachings_of_the_monastery
7:22.331 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
7:23.651 blackout_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery
7:24.969 tiger_palm Fluffy_Pillow 1100000.0/1100000: 100% mana
7:26.288 blackout_kick Fluffy_Pillow 1100000.0/1100000: 100% mana teachings_of_the_monastery

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4402 4402 0
Agility 9028 9028 0
Stamina 25299 25299 15597
Intellect 23967 22602 14200 (7774)
Spirit 2 2 0
Health 1517940 1517940 0
Mana 1100000 1100000 0
Spell Power 23967 22602 0
Crit 20.07% 20.07% 5275
Haste 14.06% 14.06% 4568
Damage / Heal Versatility 9.03% 9.03% 3613
ManaReg per Second 8800 8800 0
Attack Power 23967 22602 0
Mastery 189.00% 167.50% 3064
Armor 1899 1899 1899
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 828.00
Local Head Grandmaster's Crown
ilevel: 830, stats: { 250 Armor, +1614 Sta, +1077 AgiInt, +787 Haste, +424 Crit }
Local Neck Breathless Choker
ilevel: 840, stats: { +997 Sta, +1263 Crit, +505 Haste }
Local Shoulders Brinewashed Leather Shoulderpads
ilevel: 825, stats: { 227 Armor, +771 AgiInt, +1157 Sta, +522 Mastery, +369 Vers }
Local Shirt White Tuxedo Shirt
ilevel: 1
Local Chest Tranquil Bough Vest
ilevel: 830, stats: { 308 Armor, +1077 AgiInt, +1615 Sta, +813 Haste, +398 Mastery }
Local Waist Steelgazer Hide Belt
ilevel: 815, stats: { 165 Armor, +702 AgiInt, +1053 Sta, +558 Haste, +300 Vers }
Local Legs Grandmaster's Legguards
ilevel: 830, stats: { 269 Armor, +1614 Sta, +1077 AgiInt, +866 Crit, +345 Vers }
Local Feet Bleak Underworld Treads
ilevel: 850, stats: { 226 Armor, +1459 Sta, +973 AgiInt, +678 Haste, +301 Crit }
Local Wrists Compact Trifold Wristbands
ilevel: 845, stats: { 142 Armor, +696 AgiInt, +1045 Sta, +468 Vers, +252 Haste }
Local Hands Haustvelt Gloves of the Quickblade
ilevel: 820, stats: { 186 Armor, +736 AgiInt, +1104 Sta, +375 Avoidance, +500 Crit, +375 Vers }
Local Finger1 Rough-Hammered Silver Ring
ilevel: 830, stats: { +908 Sta, +1119 Crit, +584 Mastery }
Local Finger2 Thunder Totem Band of the Harmonious
ilevel: 815, stats: { +790 Sta, +736 Mastery, +874 Vers }
Local Trinket1 Bloom of New Growth
ilevel: 835, stats: { +1073 Int, +882 Vers }
Local Trinket2 Concave Reflecting Lens
ilevel: 810, stats: { +802 Crit }
Local Back Rugged Marauder Cape
ilevel: 840, stats: { 126 Armor, +665 StrAgiInt, +997 Sta, +429 Haste, +278 Mastery }
Local Main Hand Sheilun, Staff of the Mists
ilevel: 802, weapon: { 4291 - 6438, 3.6 }, stats: { +829 Int, +1244 Sta, +546 Haste, +546 Mastery, +4524 Int }, relics: { +28 ilevels, +24 ilevels }

Talents

Level
15 Chi Burst Zen Pulse (Mistweaver Monk) Mistwalk (Mistweaver Monk)
30 Chi Torpedo Tiger's Lust Celerity
45 Lifecycles (Mistweaver Monk) Spirit of the Crane (Mistweaver Monk) Mist Wrap (Mistweaver Monk)
60 Ring of Peace Song of Chi-Ji (Mistweaver Monk) Leg Sweep
75 Healing Elixir Diffuse Magic Dampen Harm
90 Refreshing Jade Wind (Mistweaver Monk) Invoke Chi-Ji, the Red Crane (Mistweaver Monk) Summon Jade Serpent Statue (Mistweaver Monk)
100 Mana Tea (Mistweaver Monk) Focused Thunder (Mistweaver Monk) Rising Thunder (Mistweaver Monk)

Profile

monk="Müjnir"
origin="https://eu.api.battle.net/wow/character/hyjal/Müjnir/advanced"
thumbnail="http://eu.battle.net/static-render/eu/hyjal/61/114238781-avatar.jpg"
level=110
race=pandaren_alliance
role=hybrid
position=back
professions=inscription=717/herbalism=785
talents=http://eu.battle.net/wow/en/tool/talent-calculator#fZ!0102111
artifact=51:0:0:0:0:931:1:932:1:936:1:940:3:941:1:942:2:945:3:946:3:1295:1
spec=mistweaver

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_whispered_pact
actions.precombat+=/food,type=nightborne_delicacy_platter
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=deadly_grace

# Executed every time the actor is available.
actions=auto_attack
actions+=/invoke_xuen
actions+=/blood_fury,if=target.time_to_die<18
actions+=/berserking,if=target.time_to_die<18
actions+=/arcane_torrent,if=chi.max-chi>=1&target.time_to_die<18
actions+=/potion,name=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=60
actions+=/run_action_list,name=aoe,if=active_enemies>=3
actions+=/call_action_list,name=st,if=active_enemies<3

actions.st=rising_sun_kick,if=buff.teachings_of_the_monastery.up
actions.st+=/blackout_kick,if=buff.teachings_of_the_monastery.up
actions.st+=/chi_burst
actions.st+=/tiger_palm,if=buff.teachings_of_the_monastery.down

actions.aoe=spinning_crane_kick
actions.aoe+=/refreshing_jade_wind
actions.aoe+=/chi_burst
actions.aoe+=/blackout_kick
actions.aoe+=/tiger_palm,if=talent.rushing_jade_wind.enabled

head=grandmasters_crown,id=139734,bonus_id=3386/3383
neck=breathless_choker,id=137461,bonus_id=1726/1492/3337
shoulders=brinewashed_leather_shoulderpads,id=134242,bonus_id=3396/1487/1675
back=rugged_marauder_cape,id=134407,bonus_id=1726/1492/3337
chest=tranquil_bough_vest,id=139071,bonus_id=1726/1492/3339
shirt=white_tuxedo_shirt,id=6833
wrists=compact_trifold_wristbands,id=137442,bonus_id=1727/1497/3336
hands=haustvelt_gloves,id=121130,bonus_id=3395/1808/40/1678/1612/1675
waist=steelgazer_hide_belt,id=134155,bonus_id=3394/1477/1675
legs=grandmasters_legguards,id=139735,bonus_id=3385/3383
feet=bleak_underworld_treads,id=137324,bonus_id=1727/1502/3336
finger1=roughhammered_silver_ring,id=134191,bonus_id=3395/1492/3339
finger2=thunder_totem_band,id=121082,bonus_id=3394/3406/1607/1675
trinket1=bloom_of_new_growth,id=139076,bonus_id=3397/607/1497/3336
trinket2=concave_reflecting_lens,id=137540,bonus_id=1826/1462/3339
main_hand=sheilun_staff_of_the_mists,id=128937,gem_id=132339/132816/0/0,relic_id=1793:1615:1809/664:1736:1601:1809/0/0

# Gear Summary
# gear_ilvl=827.80
# gear_stamina=15597
# gear_intellect=14200
# gear_crit_rating=5275
# gear_haste_rating=4568
# gear_mastery_rating=3064
# gear_versatility_rating=3613
# gear_avoidance_rating=375
# gear_armor=1899
# set_bonus=tier19oh_2pc=1

Waleràn

Waleràn : 90884 dps

  • Race: Dwarf
  • Class: Priest
  • Spec: Shadow
  • Level: 110
  • Role: Spell
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
90884.4 90884.4 36.2 / 0.040% 7241.9 / 8.0% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 2.41% 35.8 100.0% 100%
Origin https://eu.api.battle.net/wow/character/hyjal/Waleràn/advanced
Talents
  • 15: Twist of Fate (Shadow Priest)
  • 30: Body and Soul
  • 45: Mind Bomb (Shadow Priest)
  • 60: Reaper of Souls (Shadow Priest)
  • 75: Auspicious Spirits (Shadow Priest)
  • 90: Mindbender (Shadow Priest)
  • 100: Legacy of the Void (Shadow Priest)
  • Talent Calculator
Artifact
Professions
  • engineering: 700
  • inscription: 700

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Waleràn 90884
Deadly Grace 3679 4.0% 21.7 21.91sec 74925 0 Direct 21.7 66322 135203 74927 12.5%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.75 21.75 0.00 0.00 0.0000 0.0000 1629436.53 1629436.53 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.03 87.51% 66321.59 60409 72491 66297.80 62423 69311 1262080 1262080 0.00
crit 2.72 12.49% 135202.86 123234 147881 127172.73 0 147881 367357 367357 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:5.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=47572 to 71358} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:47572.00
  • base_dd_max:71358.00
 
Mind Blast 10629 11.7% 57.6 7.74sec 83033 73854 Direct 58.6 72262 147356 81617 12.5%  

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 57.60 58.60 0.00 0.00 1.1243 0.0000 4782726.23 4782726.23 0.00 73854.23 73854.23
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 51.30 87.54% 72262.47 60559 90005 72264.45 69555 74810 3707128 3707128 0.00
crit 7.30 12.46% 147355.53 123541 183611 147281.36 0 183611 1075598 1075598 0.00
 
 

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target's mind for {$s1=0} Shadow damage. |cFFFFFFFFGenerates {$/100;s2=12} Insanity.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Mind Flay 11121 12.3% 116.8 3.83sec 42884 25663 Periodic 318.5 13918 28410 15724 12.5% 39.1%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 116.79 0.00 318.53 318.53 1.6711 0.5531 5008573.71 5008573.71 0.00 25663.15 25663.15
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 278.8 87.54% 13918.18 12113 18003 13918.77 13630 14261 3881052 3881052 0.00
crit 39.7 12.46% 28410.00 24711 36726 28412.92 26220 30797 1127522 1127522 0.00
 
 

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.mind_spike.enabled
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}$?s120585[. Each time Mind Flay deals damage, the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.] |cFFFFFFFFGenerates ${4*$m3/100} Insanity over the duration.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.500000
  • base_td:1.00
  • dot_duration:3.00
  • base_tick_time:0.75
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Shadow Word: Death 4019 4.4% 15.6 10.67sec 115842 101215 Direct 15.6 102575 209167 115847 12.4%  

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.61 15.61 0.00 0.00 1.1445 0.0000 1808607.35 1808607.35 0.00 101214.81 101214.81
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.67 87.55% 102574.67 72672 108008 102578.68 94752 107000 1402131 1402131 0.00
crit 1.94 12.45% 209167.09 148251 220336 181551.05 0 220336 406476 406476 0.00
 
 

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=90
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s1=1} Shadow damage to the target. Only usable on enemies that have less than {$s2=20}% health. |cFFFFFFFFGenerates {$s3=10} Insanity, or $/100;190714s1 if the target dies.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.600000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Shadow Word: Pain 13635 15.0% 8.3 51.12sec 737634 661663 Direct 8.3 16032 32863 18078 12.2%  
Periodic 295.1 17948 36755 20292 12.5% 98.3%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.32 8.32 295.15 295.15 1.1149 1.5005 6139569.26 6139569.26 0.00 13578.49 661662.82
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.31 87.84% 16032.32 14585 22931 16004.43 14585 18899 117221 117221 0.00
crit 1.01 12.16% 32862.99 29753 46779 21537.20 0 46779 33252 33252 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 258.4 87.54% 17948.36 10 22931 17948.39 17398 18432 4637387 4637387 0.00
crit 36.8 12.46% 36755.02 24 46779 36749.46 32967 39781 1351709 1351709 0.00
 
 

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.shadow_word_pain.remains<(3+(4%3))*gcd
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec.
  • description:A word of darkness that causes {$s1=1} Shadow damage instantly, and an additional $o2 Shadow damage over {$d=14 seconds}.{$?s137033=false}[ |cFFFFFFFFGenerates ${$m3/100} Insanity.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.450000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.450000
  • base_td:1.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Shadowy Apparitions 1888 2.1% 51.5 8.58sec 16526 0 Direct 50.9 14752 30106 16692 12.6%  

Stats details: shadowy_apparitions

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.45 50.94 0.00 0.00 0.0000 0.0000 850331.09 850331.09 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 44.51 87.37% 14752.18 12112 18001 14751.36 13624 15946 656559 656559 0.00
crit 6.44 12.63% 30106.33 24708 36722 30013.85 0 36722 193772 193772 0.00
 
 

Action details: shadowy_apparitions

Static Values
  • id:78203
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:6.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When your Shadow Word: Pain damage over time critically strikes, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=0} Shadow damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Vampiric Touch 15279 16.8% 3.0 119.49sec 2297697 2033231 Periodic 196.3 31014 63502 35058 12.4% 98.5%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.99 0.00 196.26 196.26 1.1302 2.2602 6880452.34 6880452.34 0.00 15393.48 2033230.60
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 171.8 87.55% 31013.74 82 39447 31014.72 30000 31838 5329084 5329084 0.00
crit 24.4 12.45% 63502.00 29 80472 63498.96 55702 72604 1551368 1551368 0.00
 
 

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.vampiric_touch.remains<(4+(4%3))*gcd
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec.
  • description:A touch of darkness that causes $34914o2 Shadow damage over {$34914d=18 seconds}, and heals the Priest for ${$e2*100}% of damage dealt. If Vampiric Touch is dispelled, the dispeller flees in Horror for {$87204d=3 seconds}. |cFFFFFFFFGenerates ${$m3/100} Insanity.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.870000
  • base_td:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Void Bolt 13307 14.6% 66.3 6.61sec 90272 77731 Direct 66.1 80146 163967 90575 12.4%  

Stats details: void_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 66.34 66.12 0.00 0.00 1.1613 0.0000 5989020.64 5989020.64 0.00 77731.03 77731.03
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 57.90 87.56% 80146.09 60421 94998 80146.75 77831 82834 4640155 4640155 0.00
crit 8.23 12.44% 163967.46 123260 193797 163950.39 147912 191787 1348865 1348865 0.00
 
 

Action details: void_bolt

Static Values
  • id:205448
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10
Spelldata
  • id:205448
  • name:Void Bolt
  • school:shadow
  • tooltip:
  • description:Sends a bolt of pure void energy at the enemy, causing {$s1=1} Shadow damage and refreshing Shadow Word: Pain and Vampiric Touch to their original duration. Requires Voidform. |cFFFFFFFFGenerates {$/100;s3=16} Insanity.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.200000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Void Eruption 1927 2.1% 11.9 38.61sec 73124 0 Direct 23.6 32476 66161 36674 12.5%  

Stats details: void_eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.86 23.65 0.00 0.00 0.0000 0.0000 867273.14 867273.14 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.70 87.54% 32475.93 30281 37503 32473.75 31160 33834 672302 672302 0.00
crit 2.95 12.46% 66160.68 61773 76507 63098.86 0 76507 194971 194971 0.00
 
 

Action details: void_eruption

Static Values
  • id:228360
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:18.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:insanity>=85|(talent.auspicious_spirits.enabled&insanity>=(80-shadowy_apparitions_in_flight*4))
Spelldata
  • id:228360
  • name:Void Eruption
  • school:shadow
  • tooltip:
  • description:{$@spelldesc228260=Releases an explosive blast of pure void energy, activating Voidform and causing {$228360s1=1} Shadow damage to all enemies afflicted by your Shadow Word: Pain or Vampiric Touch. During Voidform, this ability is replaced by Void Bolt. |cFFFFFFFFRequires ${$C/100} Insanity to activate.|r}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Void Torrent 7022 7.7% 7.4 63.89sec 427571 101095 Periodic 47.7 58645 119783 66310 12.5% 6.5%

Stats details: void_torrent

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.39 0.00 47.66 47.66 4.2295 0.6170 3160539.18 3160539.18 0.00 101095.20 101095.20
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.7 87.46% 58645.02 106 72006 58649.97 53991 62713 2444702 2444702 0.00
crit 6.0 12.54% 119782.51 454 146892 119496.96 0 146892 715837 715837 0.00
 
 

Action details: void_torrent

Static Values
  • id:205065
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.surrender_to_madness.enabled
Spelldata
  • id:205065
  • name:Void Torrent
  • school:shadow
  • tooltip:Dealing {$s1=1} Shadow damage to the target every $t sec. Insanity drain temporarily stopped.
  • description:Raise your dagger into the sky, channeling a torrent of void energy into the target for $o Shadow damage over {$d=4 seconds}. Insanity does not drain during this channel. Requires Voidform.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:2.400000
  • base_td:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - mindbender 32217 / 8379
melee 32217 9.2% 97.3 4.52sec 38719 33539 Direct 97.3 34417 68854 38718 12.5%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 97.34 97.34 0.00 0.00 1.1545 0.0000 3768789.71 3768789.71 0.00 33538.51 33538.51
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 85.18 87.51% 34416.92 30280 35940 34416.93 33913 35097 2931610 2931610 0.00
crit 12.16 12.49% 68854.30 60559 71879 68859.05 62830 71879 837180 837180 0.00
 
 

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
Simple Action Stats Execute Interval
Waleràn
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Waleràn
  • harmful:false
  • if_expr:
 
Dispersion 4.9 92.70sec

Stats details: dispersion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.87 0.00 28.99 0.00 6.2062 1.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dispersion

Static Values
  • id:47585
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.power_infusion.up&!buff.berserking.up&!buff.bloodlust.up&artifact.void_torrent.rank&!talent.surrender_to_madness.enabled
Spelldata
  • id:47585
  • name:Dispersion
  • school:shadow
  • tooltip:Reduces all damage taken by {$s1=60}%. Cannot attack or cast spells. Immune to snare and movement impairing effects.
  • description:Disperse into pure Shadow energy for {$d=6 seconds}, reducing all damage you take by {$47585s1=60}%, but you are unable to attack or cast spells. Castable while stunned, feared, or silenced. Clears all snare and movement impairing effects when cast, and makes you immune to them while dispersed. Voidform does not drain Insanity while dispersed.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Waleràn
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Waleràn
  • harmful:false
  • if_expr:
 
Mindbender 8.0 60.63sec

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.95 0.00 0.00 0.00 1.2131 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: mindbender

Static Values
  • id:200174
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled&!talent.surrender_to_madness.enabled
Spelldata
  • id:200174
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Summons a Mindbender to attack the target for {$d=15 seconds}. |cFFFFFFFFGenerates {$s3=4} Insanity each time the Mindbender attacks.|r
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
pet - mindbender
Shadowcrawl 23.5 19.16sec

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.49 0.00 0.00 0.00 1.1796 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 11.36% 0.0(0.0) 1.0

Buff details

  • buff initial source:Waleràn
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Dispersion 4.9 0.0 0.0sec 0.0sec 6.44% 6.44% 29.0(29.0) 4.8

Buff details

  • buff initial source:Waleràn
  • cooldown name:buff_dispersion
  • max_stacks:1
  • duration:6.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • dispersion_1:6.44%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:47585
  • name:Dispersion
  • tooltip:Reduces all damage taken by {$s1=60}%. Cannot attack or cast spells. Immune to snare and movement impairing effects.
  • description:Disperse into pure Shadow energy for {$d=6 seconds}, reducing all damage you take by {$47585s1=60}%, but you are unable to attack or cast spells. Castable while stunned, feared, or silenced. Clears all snare and movement impairing effects when cast, and makes you immune to them while dispersed. Voidform does not drain Insanity while dispersed.
  • max_stacks:0
  • duration:6.00
  • cooldown:120.00
  • default_chance:0.00%
insanity_drain_stacks 11.9 237.0 38.6sec 38.6sec 65.65% 65.67% 0.0(0.0) 0.0

Buff details

  • buff initial source:Waleràn
  • cooldown name:buff_insanity_drain_stacks
  • max_stacks:999
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • insanity_drain_stacks_1:7.21%
  • insanity_drain_stacks_2:2.77%
  • insanity_drain_stacks_3:3.11%
  • insanity_drain_stacks_4:2.78%
  • insanity_drain_stacks_5:3.09%
  • insanity_drain_stacks_6:2.80%
  • insanity_drain_stacks_7:3.11%
  • insanity_drain_stacks_8:2.86%
  • insanity_drain_stacks_9:3.20%
  • insanity_drain_stacks_10:2.93%
  • insanity_drain_stacks_11:2.92%
  • insanity_drain_stacks_12:2.83%
  • insanity_drain_stacks_13:2.85%
  • insanity_drain_stacks_14:2.80%
  • insanity_drain_stacks_15:2.64%
  • insanity_drain_stacks_16:2.45%
  • insanity_drain_stacks_17:2.32%
  • insanity_drain_stacks_18:2.54%
  • insanity_drain_stacks_19:2.02%
  • insanity_drain_stacks_20:1.70%
  • insanity_drain_stacks_21:1.54%
  • insanity_drain_stacks_22:1.21%
  • insanity_drain_stacks_23:0.95%
  • insanity_drain_stacks_24:0.74%
  • insanity_drain_stacks_25:0.63%
  • insanity_drain_stacks_26:0.52%
  • insanity_drain_stacks_27:0.43%
  • insanity_drain_stacks_28:0.32%
  • insanity_drain_stacks_29:0.20%
  • insanity_drain_stacks_30:0.10%
  • insanity_drain_stacks_31:0.04%
  • insanity_drain_stacks_32:0.02%
  • insanity_drain_stacks_33:0.01%
  • insanity_drain_stacks_34:0.00%
  • insanity_drain_stacks_35:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%
Ley Surge 7.0 1.5 60.4sec 48.6sec 20.27% 20.33% 1.5(1.5) 6.8

Buff details

  • buff initial source:Waleràn
  • cooldown name:buff_ley_surge
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:607.00

Stack Uptimes

  • ley_surge_1:20.27%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202879
  • name:Ley Surge
  • tooltip:Intellect increased by {$s1=2039}.
  • description:{$@spelldesc202874=Your spells have a chance to increase your Intellect by {$202879s1=2039} for {$202879d=12 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Lingering Insanity 11.9 0.0 38.2sec 38.2sec 32.22% 32.26% 0.0(0.0) 0.0

Buff details

  • buff initial source:Waleràn
  • cooldown name:buff_lingering_insanity
  • max_stacks:100
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • lingering_insanity_13:0.00%
  • lingering_insanity_14:0.43%
  • lingering_insanity_15:2.72%
  • lingering_insanity_16:0.96%
  • lingering_insanity_17:0.72%
  • lingering_insanity_18:0.93%
  • lingering_insanity_19:1.54%
  • lingering_insanity_20:2.80%
  • lingering_insanity_21:1.38%
  • lingering_insanity_22:0.83%
  • lingering_insanity_23:0.72%
  • lingering_insanity_24:1.63%
  • lingering_insanity_25:1.93%
  • lingering_insanity_26:1.37%
  • lingering_insanity_27:1.10%
  • lingering_insanity_28:1.12%
  • lingering_insanity_29:0.65%
  • lingering_insanity_30:1.44%
  • lingering_insanity_31:1.49%
  • lingering_insanity_32:2.49%
  • lingering_insanity_33:1.63%
  • lingering_insanity_34:0.64%
  • lingering_insanity_35:0.48%
  • lingering_insanity_36:0.53%
  • lingering_insanity_37:0.65%
  • lingering_insanity_38:0.66%
  • lingering_insanity_39:0.60%
  • lingering_insanity_40:0.33%
  • lingering_insanity_41:0.21%
  • lingering_insanity_42:0.13%
  • lingering_insanity_43:0.07%
  • lingering_insanity_44:0.02%
  • lingering_insanity_45:0.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197937
  • name:Lingering Insanity
  • tooltip:Haste increased by $w1%.
  • description:{$@spelldesc194249={$@spelldesc228264=Activated by casting Void Eruption. Increases all damage you deal by {$194249s1=20}%{$?s8092=true}[, reduces the cooldown on Mind Blast by ${$194249m6/-1000} sec,][] and grants an additional $194249m3% Haste every $194249t5 sec. Your Insanity will drain increasingly fast until it reaches 0 and Voidform ends. When Voidform ends, you gain Lingering Insanity, allowing the Haste bonus to persist for {$197937d=60 seconds} or until you next enter Voidform.}}
  • max_stacks:100
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Potion of Deadly Grace 2.0 0.0 410.4sec 0.0sec 10.83% 10.89% 0.0(0.0) 2.0

Buff details

  • buff initial source:Waleràn
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:10.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Twist of Fate 1.0 136.0 0.0sec 1.2sec 36.41% 36.46% 136.0(136.0) 0.0

Buff details

  • buff initial source:Waleràn
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • twist_of_fate_1:36.41%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After {$?s15407=true}[damaging][healing] a target below {$s1=35}% health, you deal {$123254s2=20}% increased damage and {$123254s1=20}% increased healing for {$123254d=10 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Void Torrent 7.4 0.0 63.9sec 63.9sec 6.54% 6.54% 0.0(0.0) 7.3

Buff details

  • buff initial source:Waleràn
  • cooldown name:buff_void_torrent
  • max_stacks:1
  • duration:4.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • void_torrent_1:6.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205065
  • name:Void Torrent
  • tooltip:Dealing {$s1=1} Shadow damage to the target every $t sec. Insanity drain temporarily stopped.
  • description:Raise your dagger into the sky, channeling a torrent of void energy into the target for $o Shadow damage over {$d=4 seconds}. Insanity does not drain during this channel. Requires Voidform.
  • max_stacks:0
  • duration:4.00
  • cooldown:60.00
  • default_chance:0.00%
Voidform 11.9 0.0 38.6sec 38.6sec 65.65% 44.64% 0.0(0.0) 0.0

Buff details

  • buff initial source:Waleràn
  • cooldown name:buff_voidform
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • voidform_1:2.63%
  • voidform_2:2.63%
  • voidform_3:2.62%
  • voidform_4:2.62%
  • voidform_5:2.61%
  • voidform_6:2.61%
  • voidform_7:2.60%
  • voidform_8:2.59%
  • voidform_9:2.59%
  • voidform_10:2.58%
  • voidform_11:2.58%
  • voidform_12:2.57%
  • voidform_13:2.57%
  • voidform_14:2.55%
  • voidform_15:2.43%
  • voidform_16:2.29%
  • voidform_17:2.22%
  • voidform_18:2.15%
  • voidform_19:2.07%
  • voidform_20:1.91%
  • voidform_21:1.78%
  • voidform_22:1.69%
  • voidform_23:1.62%
  • voidform_24:1.53%
  • voidform_25:1.33%
  • voidform_26:1.21%
  • voidform_27:1.11%
  • voidform_28:1.00%
  • voidform_29:0.94%
  • voidform_30:0.86%
  • voidform_31:0.74%
  • voidform_32:0.60%
  • voidform_33:0.43%
  • voidform_34:0.35%
  • voidform_35:0.30%
  • voidform_36:0.25%
  • voidform_37:0.20%
  • voidform_38:0.14%
  • voidform_39:0.09%
  • voidform_40:0.05%
  • voidform_41:0.03%
  • voidform_42:0.01%
  • voidform_43:0.00%
  • voidform_44:0.00%
  • voidform_45:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194249
  • name:Voidform
  • tooltip:Cooldown on Mind Blast reduced by ${$w6/1000} sec. Shadow damage dealt increased by $w1%. Haste increased by $w3%. Losing ${$w2/500} Insanity every sec.
  • description:{$@spelldesc228264=Activated by casting Void Eruption. Increases all damage you deal by {$194249s1=20}%{$?s8092=true}[, reduces the cooldown on Mind Blast by ${$194249m6/-1000} sec,][] and grants an additional $194249m3% Haste every $194249t5 sec. Your Insanity will drain increasingly fast until it reaches 0 and Voidform ends. When Voidform ends, you gain Lingering Insanity, allowing the Haste bonus to persist for {$197937d=60 seconds} or until you next enter Voidform.}
  • max_stacks:100
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Voidsight 7.2 2.1 59.6sec 44.6sec 27.08% 27.14% 2.1(2.1) 6.9

Buff details

  • buff initial source:Waleràn
  • cooldown name:buff_voidsight
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1102.73
  • stat:haste_rating
  • amount:1102.73
  • stat:mastery_rating
  • amount:1102.73

Stack Uptimes

  • voidsight_1:27.08%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201410
  • name:Voidsight
  • tooltip:Critical Strike, Haste and Mastery increased by {$s1=1145}. Damage against Demons increased by {$s2=10}%.
  • description:Increases Critical Strike, Haste and Mastery by {$s1=1145}. Damage against Demons increased by {$s2=10}%.
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
mindbender: Shadowcrawl 23.5 0.0 19.2sec 19.2sec 86.70% 69.33% 0.0(0.0) 15.6

Buff details

  • buff initial source:Waleràn_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • shadowcrawl_1:86.70%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:0
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Waleràn
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Waleràn
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Waleràn
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Waleràn
Resource Gains Type Count Total Average Overflow
Insanity Gained from Auspicious Spirits Insanity 50.94 200.60 (371.82%) 3.94 3.18 1.56%
Insanity Saved by Dispersion Insanity 577.79 336.95 (624.55%) 0.58 0.00 0.00%
Insanity Drained by Voidform Insanity 5912.50 -4038.35 (-7485.18%) -0.68 0.00 -0.00%
Insanity Gained from Mind Blast Insanity 58.60 702.66 (1302.39%) 11.99 0.54 0.08%
Insanity Gained from Mind Flay Insanity 318.53 637.06 (1180.80%) 2.00 0.01 0.00%
Insanity Gained from Mindbender Insanity 97.34 377.12 (698.99%) 3.87 12.24 3.14%
Insanity Gained from Shadow Word: Death Insanity 15.61 426.89 (791.26%) 27.34 41.47 8.85%
Insanity Gained from Shadow Word: Pain Casts Insanity 8.32 24.72 (45.82%) 2.97 0.25 1.00%
Insanity Gained from Vampiric Touch Casts Insanity 2.99 11.86 (21.98%) 3.96 0.12 1.01%
Insanity Gained from Void Bolt Insanity 66.34 1009.87 (1871.82%) 15.22 51.64 4.87%
Insanity Saved by Void Torrent Insanity 585.07 364.58 (675.75%) 0.62 0.00 0.00%
Health from Vampiric Touch Ticks Health 196.26 0.00 (0.00%) 0.00 3440280.77 100.00%
Resource RPS-Gain RPS-Loss
Insanity 9.09 8.97
Combat End Resource Mean Min Max
Mana 1100000.00 1100000.00 1100000.00
Insanity 54.85 0.00 100.00

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval
Shadowy Apparition Insanity lost to overflow 51.5 8.6sec
Void Eruption casted when a target with both DoTs was up 11.9 38.6sec

Statistics & Data Analysis

Fight Length
Sample Data Waleràn Fight Length
Count 9999
Mean 450.42
Minimum 350.15
Maximum 555.44
Spread ( max - min ) 205.29
Range [ ( max - min ) / 2 * 100% ] 22.79%
DPS
Sample Data Waleràn Damage Per Second
Count 9999
Mean 90884.43
Minimum 84591.83
Maximum 98200.82
Spread ( max - min ) 13609.00
Range [ ( max - min ) / 2 * 100% ] 7.49%
Standard Deviation 1846.3311
5th Percentile 87930.19
95th Percentile 94021.56
( 95th Percentile - 5th Percentile ) 6091.37
Mean Distribution
Standard Deviation 18.4642
95.00% Confidence Intervall ( 90848.24 - 90920.62 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 15
0.1% Error 1585
0.1 Scale Factor Error with Delta=300 29100
0.05 Scale Factor Error with Delta=300 116402
0.01 Scale Factor Error with Delta=300 2910066
Priority Target DPS
Sample Data Waleràn Priority Target Damage Per Second
Count 9999
Mean 90884.43
Minimum 84591.83
Maximum 98200.82
Spread ( max - min ) 13609.00
Range [ ( max - min ) / 2 * 100% ] 7.49%
Standard Deviation 1846.3311
5th Percentile 87930.19
95th Percentile 94021.56
( 95th Percentile - 5th Percentile ) 6091.37
Mean Distribution
Standard Deviation 18.4642
95.00% Confidence Intervall ( 90848.24 - 90920.62 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 15
0.1% Error 1585
0.1 Scale Factor Error with Delta=300 29100
0.05 Scale Factor Error with Delta=300 116402
0.01 Scale Factor Error with Delta=300 2910066
DPS(e)
Sample Data Waleràn Damage Per Second (Effective)
Count 9999
Mean 90884.43
Minimum 84591.83
Maximum 98200.82
Spread ( max - min ) 13609.00
Range [ ( max - min ) / 2 * 100% ] 7.49%
Damage
Sample Data Waleràn Damage
Count 9999
Mean 37116529.49
Minimum 28130811.95
Maximum 46905602.75
Spread ( max - min ) 18774790.80
Range [ ( max - min ) / 2 * 100% ] 25.29%
DTPS
Sample Data Waleràn Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Waleràn Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Waleràn Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Waleràn Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Waleràn Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Waleràn Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data WalerànTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Waleràn Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=deadly_grace
5 0.00 mind_blast
Default action list Executed every time the actor is available.
# count action,conditions
6 1.00 potion,name=deadly_grace,if=buff.bloodlust.react|target.time_to_die<=40|buff.voidform.stack>80
0.00 variable,op=set,name=actors_fight_time_mod,value=0
0.00 variable,op=set,name=actors_fight_time_mod,value=-((-(450)+(time+target.time_to_die))%10),if=time+target.time_to_die>450&time+target.time_to_die<600
0.00 variable,op=set,name=actors_fight_time_mod,value=((450-(time+target.time_to_die))%5),if=time+target.time_to_die<=450
0.00 variable,op=set,name=s2mcheck,value=0.85*(45+((raw_haste_pct*100)*(2+(1*talent.reaper_of_souls.enabled)+(2*artifact.mass_hysteria.rank)-(1*talent.sanlayn.enabled))))-(variable.actors_fight_time_mod*nonexecute_actors_pct)
0.00 variable,op=min,name=s2mcheck,value=180
7 0.00 call_action_list,name=s2m,if=buff.voidform.up&buff.surrender_to_madness.up
8 0.00 call_action_list,name=vf,if=buff.voidform.up
9 0.00 call_action_list,name=main
actions.main
# count action,conditions
0.00 surrender_to_madness,if=talent.surrender_to_madness.enabled&target.time_to_die<=variable.s2mcheck
A 2.91 mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
0.00 mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck+60
B 6.55 shadow_word_pain,if=dot.shadow_word_pain.remains<(3+(4%3))*gcd
C 2.59 vampiric_touch,if=dot.vampiric_touch.remains<(4+(4%3))*gcd
D 11.86 void_eruption,if=insanity>=85|(talent.auspicious_spirits.enabled&insanity>=(80-shadowy_apparitions_in_flight*4))
0.00 shadow_crash,if=talent.shadow_crash.enabled
0.00 mindbender,if=talent.mindbender.enabled&set_bonus.tier18_2pc
0.00 shadow_word_pain,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
0.00 vampiric_touch,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
0.00 shadow_word_death,if=!talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=90
E 2.07 shadow_word_death,if=talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=70
F 22.62 mind_blast,if=talent.legacy_of_the_void.enabled&(insanity<=81|(insanity<=75.2&talent.fortress_of_the_mind.enabled))
0.00 mind_blast,if=!talent.legacy_of_the_void.enabled|(insanity<=96|(insanity<=95.2&talent.fortress_of_the_mind.enabled))
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
0.00 vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
0.00 shadow_word_void,if=(insanity<=70&talent.legacy_of_the_void.enabled)|(insanity<=85&!talent.legacy_of_the_void.enabled)
0.00 mind_sear,if=active_enemies>=3,interrupt=1,chain=1
G 29.77 mind_flay,if=!talent.mind_spike.enabled,interrupt=1,chain=1
0.00 mind_spike,if=talent.mind_spike.enabled
0.00 shadow_word_pain
actions.vf
# count action,conditions
0.00 surrender_to_madness,if=talent.surrender_to_madness.enabled&insanity>=25&(cooldown.void_bolt.up|cooldown.void_torrent.up|cooldown.shadow_word_death.up|buff.shadowy_insight.up)&target.time_to_die<=variable.s2mcheck-(buff.insanity_drain_stacks.stack)
0.00 shadow_crash,if=talent.shadow_crash.enabled
H 5.04 mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
0.00 mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+30
I 4.87 dispersion,if=!buff.power_infusion.up&!buff.berserking.up&!buff.bloodlust.up&artifact.void_torrent.rank&!talent.surrender_to_madness.enabled
0.00 dispersion,if=!buff.power_infusion.up&!buff.berserking.up&!buff.bloodlust.up&artifact.void_torrent.rank&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+(120-10*artifact.from_the_shadows.rank)
0.00 power_infusion,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=30&!talent.surrender_to_madness.enabled
0.00 power_infusion,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+15
0.00 berserking,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=20&!talent.surrender_to_madness.enabled
0.00 berserking,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+70
J 0.39 void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10,cycle_targets=1
K 5.06 void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)&target.time_to_die>10,cycle_targets=1
L 2.81 void_bolt,if=dot.vampiric_touch.remains<3.5*gcd&(talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))&target.time_to_die>10,cycle_targets=1
0.00 void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&artifact.sphere_of_insanity.rank&target.time_to_die>10,cycle_targets=1
M 58.08 void_bolt
N 7.39 void_torrent,if=!talent.surrender_to_madness.enabled
0.00 void_torrent,if=talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+60
0.00 shadow_word_death,if=!talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+10)<100
O 5.35 shadow_word_death,if=talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+30)<100
0.00 wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable_in<gcd.max*0.25
P 35.12 mind_blast
0.00 wait,sec=action.mind_blast.usable_in,if=action.mind_blast.usable_in<gcd.max*0.25
Q 8.20 shadow_word_death,if=cooldown.shadow_word_death.charges=2
0.00 shadowfiend,if=!talent.mindbender.enabled,if=buff.voidform.stack>15
0.00 shadow_word_void,if=(insanity-(current_insanity_drain*gcd.max)+25)<100
R 1.78 shadow_word_pain,if=!ticking&(active_enemies<5|talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled|artifact.sphere_of_insanity.rank)
S 0.40 vampiric_touch,if=!ticking&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
0.00 vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
0.00 wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable|action.void_bolt.usable_in<gcd.max*0.8
0.00 mind_sear,if=active_enemies>=3,interrupt=1
T 55.24 mind_flay,if=!talent.mind_spike.enabled,chain=1,interrupt_immediate=1,interrupt_if=action.void_bolt.usable_in<gcd.max*0.8
0.00 mind_spike,if=talent.mind_spike.enabled
0.00 shadow_word_pain

Sample Sequence

01245ABCGFGDNKPRMTMPTMTMPTMTPMTGFGFGFGBDILPTMHTMPTMTMNMPTMGFGFGBFDTMTPMTMTPMTGFGAGFGBDTMNMPIMPTMTMPTMTGFGFGBFDTLTPMHTMTPGFGBDNLPTMTMTPMTMTFGFGBFDIHLPSMTMPTMTMNMPTMTGFGFGBDPQMTMTPMQTMTOHFGFDTKQTMNMPIMPQMTMPTMTEFGFGDQTMPTMTHMPQMTMPTMOTMFGEFDNMTPMQTMTP6MTQMTOMPGFGAGEDIJPQMRTMPTM

Sample Sequence Table

time name target resources buffs
Pre flask Waleràn 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity
Pre food Waleràn 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity
Pre augmentation Waleràn 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity
Pre potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity potion_of_deadly_grace
0:00.000 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity ley_surge, potion_of_deadly_grace
0:00.000 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity ley_surge, potion_of_deadly_grace
0:01.293 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 16.0/100: 16% insanity bloodlust, ley_surge, potion_of_deadly_grace
0:02.357 vampiric_touch Fluffy_Pillow 1100000.0/1100000: 100% mana | 23.0/100: 23% insanity bloodlust, ley_surge, potion_of_deadly_grace
0:03.421 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 31.0/100: 31% insanity bloodlust, ley_surge, potion_of_deadly_grace
0:06.906 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 59.0/100: 59% insanity bloodlust, ley_surge, potion_of_deadly_grace
0:07.969 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.0/100: 75% insanity bloodlust, ley_surge, potion_of_deadly_grace
0:09.773 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.0/100: 85% insanity bloodlust, ley_surge, potion_of_deadly_grace
0:09.773 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.0/100: 85% insanity bloodlust, voidform, insanity_drain_stacks, ley_surge, potion_of_deadly_grace
0:13.972 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 98.2/100: 98% insanity bloodlust, voidform(5), insanity_drain_stacks(2), potion_of_deadly_grace
0:14.986 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.7/100: 91% insanity bloodlust, voidform(6), insanity_drain_stacks(3), potion_of_deadly_grace
0:15.990 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 92.7/100: 93% insanity bloodlust, voidform(7), insanity_drain_stacks(4), potion_of_deadly_grace
0:16.985 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.5/100: 85% insanity bloodlust, voidform(8), insanity_drain_stacks(5), potion_of_deadly_grace
0:17.984 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.6/100: 90% insanity bloodlust, voidform(9), insanity_drain_stacks(6), potion_of_deadly_grace
0:19.942 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.9/100: 73% insanity bloodlust, voidform(11), insanity_drain_stacks(8), potion_of_deadly_grace
0:20.901 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.4/100: 77% insanity bloodlust, voidform(12), insanity_drain_stacks(9), potion_of_deadly_grace
0:21.853 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.0/100: 77% insanity bloodlust, voidform(13), insanity_drain_stacks(10), potion_of_deadly_grace
0:22.795 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.6/100: 67% insanity bloodlust, voidform(14), insanity_drain_stacks(11), potion_of_deadly_grace
0:23.738 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 69.3/100: 69% insanity bloodlust, voidform(14), insanity_drain_stacks(11)
0:25.593 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 48.5/100: 49% insanity bloodlust, voidform(16), insanity_drain_stacks(13)
0:26.510 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 51.0/100: 51% insanity bloodlust, voidform(17), insanity_drain_stacks(14)
0:27.420 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 48.9/100: 49% insanity bloodlust, voidform(18), insanity_drain_stacks(15)
0:28.322 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 36.5/100: 37% insanity bloodlust, voidform(19), insanity_drain_stacks(16)
0:29.227 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 36.8/100: 37% insanity bloodlust, voidform(20), insanity_drain_stacks(17)
0:30.553 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 20.7/100: 21% insanity bloodlust, voidform(21), insanity_drain_stacks(18)
0:31.553 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 14.9/100: 15% insanity bloodlust, voidform(22), insanity_drain_stacks(19)
0:32.426 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 14.7/100: 15% insanity bloodlust, voidform(23), insanity_drain_stacks(20)
0:33.721 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/100: 2% insanity bloodlust, lingering_insanity(24)
0:34.931 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 6.0/100: 6% insanity bloodlust, lingering_insanity(24)
0:35.790 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 18.0/100: 18% insanity bloodlust, lingering_insanity(24)
0:39.033 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 32.0/100: 32% insanity bloodlust, lingering_insanity(24)
0:39.892 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 44.0/100: 44% insanity bloodlust, lingering_insanity(24)
0:43.409 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 58.0/100: 58% insanity lingering_insanity(24)
0:44.522 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.0/100: 70% insanity lingering_insanity(24)
0:47.500 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.0/100: 80% insanity lingering_insanity(24)
0:48.614 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.0/100: 83% insanity lingering_insanity(24)
0:48.614 dispersion Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.0/100: 83% insanity voidform, insanity_drain_stacks
0:54.895 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.3/100: 80% insanity voidform(7), insanity_drain_stacks(2)
0:56.186 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.0/100: 84% insanity voidform(8), insanity_drain_stacks(3)
0:57.465 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.0/100: 83% insanity voidform(9), insanity_drain_stacks(4)
0:58.731 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 71.4/100: 71% insanity voidform(11), insanity_drain_stacks(6)
1:00.000 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.2/100: 73% insanity voidform(12), insanity_drain_stacks(7)
1:01.232 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 58.2/100: 58% insanity voidform(13), insanity_drain_stacks(8)
1:02.454 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 49.0/100: 49% insanity voidform(14), insanity_drain_stacks(9)
1:03.690 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 56.6/100: 57% insanity voidform(16), insanity_drain_stacks(11)
1:05.110 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 53.0/100: 53% insanity voidform(17), insanity_drain_stacks(12)
1:06.291 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 41.5/100: 42% insanity voidform(18), insanity_drain_stacks(13)
1:07.463 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 44.3/100: 44% insanity voidform(19), insanity_drain_stacks(14)
1:09.792 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 20.6/100: 21% insanity voidform(22), insanity_drain_stacks(17)
1:10.924 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 21.1/100: 21% insanity voidform(23), insanity_drain_stacks(18)
1:15.192 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 32.8/100: 33% insanity voidform(27), insanity_drain_stacks(18)
1:16.280 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 29.4/100: 29% insanity voidform(28), insanity_drain_stacks(19)
1:17.360 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 22.5/100: 23% insanity voidform(29), insanity_drain_stacks(20)
1:18.431 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.9/100: 4% insanity voidform(30), insanity_drain_stacks(21)
1:19.508 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity lingering_insanity(31)
1:22.918 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity lingering_insanity(31)
1:23.971 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 24.0/100: 24% insanity lingering_insanity(31)
1:29.384 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 48.0/100: 48% insanity lingering_insanity(31)
1:30.441 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 60.0/100: 60% insanity lingering_insanity(31)
1:33.865 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.0/100: 76% insanity lingering_insanity(31)
1:34.888 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.0/100: 79% insanity lingering_insanity(31), voidsight
1:35.912 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.0/100: 91% insanity lingering_insanity(31), voidsight
1:35.912 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.0/100: 91% insanity voidform, insanity_drain_stacks, voidsight
1:38.556 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.9/100: 73% insanity voidform(3), insanity_drain_stacks(3), voidsight
1:39.857 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.9/100: 76% insanity voidform(4), insanity_drain_stacks(4), voidsight
1:41.788 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 64.5/100: 65% insanity voidform(6), insanity_drain_stacks(6), voidsight
1:43.054 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 61.6/100: 62% insanity voidform(8), insanity_drain_stacks(8), voidsight
1:44.294 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.3/100: 62% insanity voidform(9), insanity_drain_stacks(9), voidsight
1:46.764 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 38.9/100: 39% insanity voidform(11), insanity_drain_stacks(11), voidsight
1:47.971 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 37.9/100: 38% insanity voidform(13), insanity_drain_stacks(13), voidsight
1:49.748 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 21.7/100: 22% insanity voidform(14), insanity_drain_stacks(14)
1:50.961 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 14.6/100: 15% insanity voidform(16), insanity_drain_stacks(16)
1:52.154 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 15.2/100: 15% insanity voidform(17), insanity_drain_stacks(17)
1:53.923 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 4.0/100: 4% insanity lingering_insanity(18)
1:57.676 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 16.0/100: 16% insanity lingering_insanity(18)
1:58.846 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 28.0/100: 28% insanity lingering_insanity(18), voidsight
2:00.175 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 32.0/100: 32% insanity lingering_insanity(18), voidsight
2:01.313 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 32.0/100: 32% insanity lingering_insanity(18), voidsight
2:04.422 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 58.0/100: 58% insanity lingering_insanity(18), voidsight
2:05.559 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.0/100: 74% insanity lingering_insanity(18), voidsight
2:06.942 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.0/100: 82% insanity lingering_insanity(18), voidsight
2:08.079 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.0/100: 89% insanity lingering_insanity(18), voidsight
2:08.079 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.0/100: 89% insanity voidform, insanity_drain_stacks, voidsight
2:10.724 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.9/100: 83% insanity voidform(3), insanity_drain_stacks(3), voidsight
2:12.023 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.0/100: 88% insanity voidform(4), insanity_drain_stacks(4), voidsight
2:16.348 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 96.2/100: 96% insanity voidform(9), insanity_drain_stacks(5)
2:17.615 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.3/100: 86% insanity voidform(10), insanity_drain_stacks(6)
2:18.871 dispersion Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.7/100: 84% insanity voidform(11), insanity_drain_stacks(7)
2:25.063 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.3/100: 81% insanity voidform(17), insanity_drain_stacks(7)
2:26.245 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.7/100: 83% insanity voidform(19), insanity_drain_stacks(9)
2:27.408 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.8/100: 80% insanity voidform(20), insanity_drain_stacks(10)
2:28.558 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.3/100: 66% insanity voidform(21), insanity_drain_stacks(11)
2:29.735 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 65.5/100: 66% insanity voidform(22), insanity_drain_stacks(12)
2:31.922 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 43.5/100: 44% insanity voidform(24), insanity_drain_stacks(14), voidsight
2:33.003 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 42.1/100: 42% insanity voidform(25), insanity_drain_stacks(15), voidsight
2:34.074 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 37.3/100: 37% insanity voidform(26), insanity_drain_stacks(16), voidsight
2:35.140 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 20.6/100: 21% insanity voidform(28), insanity_drain_stacks(18), voidsight
2:36.201 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 18.6/100: 19% insanity voidform(29), insanity_drain_stacks(19), voidsight
2:37.757 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/100: 2% insanity lingering_insanity(30), voidsight
2:39.501 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 8.0/100: 8% insanity lingering_insanity(30), voidsight
2:40.531 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 20.0/100: 20% insanity lingering_insanity(30), voidsight
2:45.938 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 44.0/100: 44% insanity lingering_insanity(30)
2:47.002 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 56.0/100: 56% insanity lingering_insanity(30)
2:50.396 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.0/100: 72% insanity lingering_insanity(30)
2:51.458 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.0/100: 75% insanity lingering_insanity(30), ley_surge
2:52.550 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.0/100: 87% insanity lingering_insanity(30), ley_surge
2:52.550 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.0/100: 87% insanity voidform, insanity_drain_stacks, ley_surge
2:55.277 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 67.9/100: 68% insanity voidform(3), insanity_drain_stacks(3), ley_surge
2:56.618 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.3/100: 70% insanity voidform(5), insanity_drain_stacks(5), ley_surge
2:58.586 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 54.8/100: 55% insanity voidform(7), insanity_drain_stacks(7), ley_surge
2:59.879 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 51.2/100: 51% insanity voidform(8), insanity_drain_stacks(8), ley_surge
3:01.157 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 51.0/100: 51% insanity voidform(9), insanity_drain_stacks(9), ley_surge
3:02.423 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 34.8/100: 35% insanity voidform(10), insanity_drain_stacks(10), ley_surge
3:03.680 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 23.4/100: 23% insanity voidform(12), insanity_drain_stacks(12)
3:04.939 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 29.5/100: 29% insanity voidform(13), insanity_drain_stacks(13)
3:06.772 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 11.4/100: 11% insanity voidform(15), insanity_drain_stacks(15)
3:07.974 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity lingering_insanity(16)
3:14.166 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 52.0/100: 52% insanity lingering_insanity(16)
3:15.357 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.0/100: 68% insanity lingering_insanity(16)
3:19.139 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.0/100: 84% insanity lingering_insanity(16)
3:20.330 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.0/100: 87% insanity lingering_insanity(16)
3:20.330 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.0/100: 87% insanity voidform, insanity_drain_stacks
3:24.498 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.2/100: 85% insanity voidform(5), insanity_drain_stacks(2), ley_surge
3:25.812 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.8/100: 88% insanity voidform(6), insanity_drain_stacks(3), ley_surge
3:27.116 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.8/100: 91% insanity voidform(7), insanity_drain_stacks(4), ley_surge
3:28.407 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.7/100: 79% insanity voidform(9), insanity_drain_stacks(6), ley_surge
3:29.699 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.0/100: 80% insanity voidform(10), insanity_drain_stacks(7), ley_surge
3:32.223 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 55.1/100: 55% insanity voidform(12), insanity_drain_stacks(9), ley_surge
3:33.457 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 58.7/100: 59% insanity voidform(14), insanity_drain_stacks(11), ley_surge
3:35.272 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 39.5/100: 40% insanity voidform(15), insanity_drain_stacks(12)
3:36.475 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 33.6/100: 34% insanity voidform(17), insanity_drain_stacks(14)
3:37.656 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 35.2/100: 35% insanity voidform(18), insanity_drain_stacks(15)
3:40.006 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 6.9/100: 7% insanity voidform(20), insanity_drain_stacks(17)
3:41.157 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.4/100: 3% insanity voidform(21), insanity_drain_stacks(18)
3:42.867 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 10.0/100: 10% insanity lingering_insanity(22)
3:44.001 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 22.0/100: 22% insanity lingering_insanity(22)
3:49.853 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 42.0/100: 42% insanity lingering_insanity(22)
3:50.987 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 54.0/100: 54% insanity lingering_insanity(22)
3:55.162 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.0/100: 68% insanity lingering_insanity(22)
3:56.297 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.0/100: 75% insanity lingering_insanity(22)
3:57.430 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.0/100: 87% insanity lingering_insanity(22)
3:57.430 dispersion Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.0/100: 87% insanity voidform, insanity_drain_stacks
4:03.770 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.8/100: 88% insanity voidform(7), insanity_drain_stacks(2)
4:05.062 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.5/100: 75% insanity voidform(8), insanity_drain_stacks(3)
4:06.341 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.5/100: 82% insanity voidform(9), insanity_drain_stacks(4)
4:07.610 vampiric_touch Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.8/100: 85% insanity voidform(11), insanity_drain_stacks(6)
4:08.854 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.6/100: 83% insanity voidform(12), insanity_drain_stacks(7)
4:10.122 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.6/100: 86% insanity voidform(13), insanity_drain_stacks(8)
4:12.577 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 71.9/100: 72% insanity voidform(16), insanity_drain_stacks(11)
4:13.767 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.1/100: 75% insanity voidform(17), insanity_drain_stacks(12)
4:15.011 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.0/100: 77% insanity voidform(18), insanity_drain_stacks(13)
4:16.184 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 65.0/100: 65% insanity voidform(19), insanity_drain_stacks(14)
4:17.346 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.8/100: 71% insanity voidform(20), insanity_drain_stacks(15)
4:19.656 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 42.7/100: 43% insanity voidform(23), insanity_drain_stacks(18)
4:20.779 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 39.7/100: 40% insanity voidform(24), insanity_drain_stacks(19)
4:25.112 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 33.4/100: 33% insanity voidform(28), insanity_drain_stacks(19)
4:26.159 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 30.5/100: 30% insanity voidform(29), insanity_drain_stacks(20), voidsight
4:27.198 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 22.8/100: 23% insanity voidform(30), insanity_drain_stacks(21), voidsight
4:28.230 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 5.8/100: 6% insanity voidform(31), insanity_drain_stacks(22), voidsight
4:29.265 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/100: 1% insanity voidform(32), insanity_drain_stacks(23), voidsight
4:30.783 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 6.0/100: 6% insanity lingering_insanity(32), voidsight
4:32.609 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity lingering_insanity(32), voidsight
4:33.624 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 24.0/100: 24% insanity lingering_insanity(32), voidsight
4:38.936 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 48.0/100: 48% insanity lingering_insanity(32), voidsight
4:39.953 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 60.0/100: 60% insanity lingering_insanity(32), voidsight
4:43.707 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.0/100: 74% insanity lingering_insanity(32)
4:44.755 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.0/100: 77% insanity lingering_insanity(32)
4:44.755 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.0/100: 77% insanity voidform, insanity_drain_stacks
4:46.123 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.8/100: 81% insanity twist_of_fate, voidform(2), insanity_drain_stacks(2)
4:47.478 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.1/100: 87% insanity twist_of_fate, voidform(3), insanity_drain_stacks(3)
4:48.822 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.4/100: 86% insanity twist_of_fate, voidform(5), insanity_drain_stacks(5)
4:51.493 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.5/100: 63% insanity twist_of_fate, voidform(7), insanity_drain_stacks(7)
4:52.785 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.9/100: 63% insanity twist_of_fate, voidform(9), insanity_drain_stacks(9)
4:54.682 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 44.2/100: 44% insanity twist_of_fate, voidform(10), insanity_drain_stacks(10)
4:55.939 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 38.7/100: 39% insanity twist_of_fate, voidform(12), insanity_drain_stacks(12)
4:57.173 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 36.8/100: 37% insanity twist_of_fate, voidform(13), insanity_drain_stacks(13)
4:58.394 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 48.8/100: 49% insanity twist_of_fate, voidform(14), insanity_drain_stacks(14)
4:59.607 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 35.1/100: 35% insanity twist_of_fate, voidform(15), insanity_drain_stacks(15)
5:00.829 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 31.8/100: 32% insanity twist_of_fate, voidform(17), insanity_drain_stacks(17)
5:02.598 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.1/100: 12% insanity twist_of_fate, voidform(18), insanity_drain_stacks(18)
5:03.769 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 20.6/100: 21% insanity twist_of_fate, voidform(20), insanity_drain_stacks(20)
5:04.921 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity twist_of_fate, lingering_insanity(21)
5:06.064 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 16.0/100: 16% insanity twist_of_fate, lingering_insanity(21)
5:11.367 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.0/100: 62% insanity twist_of_fate, lingering_insanity(21)
5:12.509 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.0/100: 78% insanity twist_of_fate, lingering_insanity(21)
5:12.509 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.0/100: 78% insanity twist_of_fate, voidform, insanity_drain_stacks
5:15.236 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.9/100: 71% insanity twist_of_fate, voidform(3), insanity_drain_stacks(3)
5:16.577 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.3/100: 77% insanity twist_of_fate, voidform(5), insanity_drain_stacks(5)
5:17.893 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.7/100: 90% insanity twist_of_fate, voidform(6), insanity_drain_stacks(6)
5:19.196 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.7/100: 81% insanity twist_of_fate, voidform(7), insanity_drain_stacks(7)
5:20.539 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.5/100: 80% insanity twist_of_fate, voidform(9), insanity_drain_stacks(9)
5:24.917 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.3/100: 75% insanity twist_of_fate, voidform(13), insanity_drain_stacks(9)
5:26.139 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.7/100: 76% insanity twist_of_fate, voidform(14), insanity_drain_stacks(10)
5:27.352 dispersion Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.2/100: 75% insanity twist_of_fate, voidform(15), insanity_drain_stacks(11)
5:33.605 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.7/100: 76% insanity twist_of_fate, voidform(22), insanity_drain_stacks(12), ley_surge
5:34.738 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.3/100: 75% insanity twist_of_fate, voidform(23), insanity_drain_stacks(13), ley_surge
5:35.863 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.1/100: 70% insanity twist_of_fate, voidform(24), insanity_drain_stacks(14), ley_surge
5:36.977 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.0/100: 83% insanity twist_of_fate, voidform(25), insanity_drain_stacks(15), ley_surge
5:38.098 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.4/100: 81% insanity twist_of_fate, voidform(26), insanity_drain_stacks(16), ley_surge
5:40.297 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 50.4/100: 50% insanity twist_of_fate, voidform(28), insanity_drain_stacks(18), ley_surge
5:41.376 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 46.8/100: 47% insanity twist_of_fate, voidform(29), insanity_drain_stacks(19), ley_surge
5:42.448 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 43.9/100: 44% insanity twist_of_fate, voidform(30), insanity_drain_stacks(20), ley_surge
5:43.511 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 25.1/100: 25% insanity twist_of_fate, voidform(32), insanity_drain_stacks(22), ley_surge
5:44.573 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 21.0/100: 21% insanity twist_of_fate, voidform(33), insanity_drain_stacks(23)
5:46.130 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/100: 2% insanity twist_of_fate, lingering_insanity(34)
5:47.162 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 32.0/100: 32% insanity twist_of_fate, lingering_insanity(34)
5:48.193 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 44.0/100: 44% insanity twist_of_fate, lingering_insanity(34), voidsight
5:52.906 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.0/100: 66% insanity twist_of_fate, lingering_insanity(34), voidsight
5:53.905 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.0/100: 78% insanity twist_of_fate, lingering_insanity(34), voidsight
5:55.265 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.0/100: 82% insanity twist_of_fate, lingering_insanity(34), voidsight
5:55.265 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.0/100: 82% insanity twist_of_fate, voidform, insanity_drain_stacks, voidsight
5:56.592 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.3/100: 88% insanity twist_of_fate, voidform(2), insanity_drain_stacks(2), voidsight
5:57.907 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.9/100: 78% insanity twist_of_fate, voidform(3), insanity_drain_stacks(3), voidsight
5:59.210 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.9/100: 81% insanity twist_of_fate, voidform(4), insanity_drain_stacks(4), voidsight
6:00.499 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.7/100: 83% insanity twist_of_fate, voidform(6), insanity_drain_stacks(6), voidsight
6:01.765 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.5/100: 70% insanity twist_of_fate, voidform(7), insanity_drain_stacks(7), voidsight
6:03.051 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.9/100: 71% insanity twist_of_fate, voidform(8), insanity_drain_stacks(8), voidsight
6:04.910 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 53.0/100: 53% insanity twist_of_fate, voidform(10), insanity_drain_stacks(10)
6:06.167 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 35.2/100: 35% insanity twist_of_fate, voidform(11), insanity_drain_stacks(11)
6:07.412 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 38.2/100: 38% insanity twist_of_fate, voidform(13), insanity_drain_stacks(13)
6:08.635 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 35.5/100: 35% insanity twist_of_fate, voidform(14), insanity_drain_stacks(14), voidsight
6:09.809 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 51.7/100: 52% insanity twist_of_fate, voidform(15), insanity_drain_stacks(15), voidsight
6:10.984 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 52.5/100: 52% insanity twist_of_fate, voidform(16), insanity_drain_stacks(16), voidsight
6:13.302 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 27.6/100: 28% insanity twist_of_fate, voidform(19), insanity_drain_stacks(19), voidsight
6:14.428 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 26.9/100: 27% insanity twist_of_fate, voidform(20), insanity_drain_stacks(20), voidsight
6:15.546 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 22.8/100: 23% insanity twist_of_fate, voidform(21), insanity_drain_stacks(21), voidsight
6:16.653 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 7.9/100: 8% insanity twist_of_fate, voidform(22), insanity_drain_stacks(22), voidsight
6:17.767 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 9.5/100: 9% insanity twist_of_fate, voidform(23), insanity_drain_stacks(23), voidsight
6:18.857 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 22.5/100: 22% insanity twist_of_fate, voidform(24), insanity_drain_stacks(24), voidsight
6:19.939 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 5.8/100: 6% insanity twist_of_fate, voidform(25), insanity_drain_stacks(25), voidsight
6:21.024 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity twist_of_fate, lingering_insanity(26), voidsight
6:22.089 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity twist_of_fate, lingering_insanity(26), voidsight
6:27.785 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 36.0/100: 36% insanity twist_of_fate, lingering_insanity(26)
6:28.881 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.0/100: 66% insanity twist_of_fate, lingering_insanity(26)
6:29.977 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.0/100: 78% insanity twist_of_fate, lingering_insanity(26)
6:29.977 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.0/100: 78% insanity twist_of_fate, voidform, insanity_drain_stacks
6:34.183 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.7/100: 80% insanity twist_of_fate, voidform(5), insanity_drain_stacks(2)
6:35.499 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.5/100: 83% insanity twist_of_fate, voidform(6), insanity_drain_stacks(3)
6:37.451 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 69.5/100: 69% insanity twist_of_fate, voidform(8), insanity_drain_stacks(5)
6:38.729 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 67.2/100: 67% insanity twist_of_fate, voidform(9), insanity_drain_stacks(6)
6:39.996 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.4/100: 68% insanity twist_of_fate, voidform(11), insanity_drain_stacks(8)
6:41.242 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.1/100: 83% insanity twist_of_fate, voidform(12), insanity_drain_stacks(9)
6:42.477 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 69.5/100: 70% insanity twist_of_fate, voidform(13), insanity_drain_stacks(10)
6:43.741 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 67.8/100: 68% insanity twist_of_fate, voidform(14), insanity_drain_stacks(11)
6:45.557 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 48.0/100: 48% insanity twist_of_fate, voidform(16), insanity_drain_stacks(13)
6:46.747 potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 42.0/100: 42% insanity twist_of_fate, voidform(17), insanity_drain_stacks(14)
6:46.747 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 42.0/100: 42% insanity twist_of_fate, voidform(17), insanity_drain_stacks(14), potion_of_deadly_grace
6:47.929 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 43.0/100: 43% insanity twist_of_fate, voidform(18), insanity_drain_stacks(15), potion_of_deadly_grace
6:49.683 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 20.3/100: 20% insanity twist_of_fate, voidform(20), insanity_drain_stacks(17), potion_of_deadly_grace
6:50.800 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 31.5/100: 32% insanity twist_of_fate, voidform(21), insanity_drain_stacks(18), voidsight, potion_of_deadly_grace
6:51.907 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 27.9/100: 28% insanity twist_of_fate, voidform(22), insanity_drain_stacks(19), voidsight, potion_of_deadly_grace
6:53.553 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.6/100: 4% insanity twist_of_fate, voidform(24), insanity_drain_stacks(21), voidsight, potion_of_deadly_grace
6:54.632 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.7/100: 13% insanity twist_of_fate, voidform(25), insanity_drain_stacks(22), voidsight, potion_of_deadly_grace
6:55.705 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 8.0/100: 8% insanity twist_of_fate, voidform(26), insanity_drain_stacks(23), voidsight, potion_of_deadly_grace
6:56.768 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity twist_of_fate, lingering_insanity(27), voidsight, potion_of_deadly_grace
7:02.167 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 36.0/100: 36% insanity twist_of_fate, lingering_insanity(27), voidsight, potion_of_deadly_grace
7:03.221 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 48.0/100: 48% insanity twist_of_fate, lingering_insanity(27), voidsight, potion_of_deadly_grace
7:05.051 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 54.0/100: 54% insanity twist_of_fate, lingering_insanity(27), potion_of_deadly_grace
7:06.139 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 54.0/100: 54% insanity twist_of_fate, lingering_insanity(27), potion_of_deadly_grace
7:08.075 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.0/100: 68% insanity twist_of_fate, lingering_insanity(27), potion_of_deadly_grace
7:09.164 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity twist_of_fate, lingering_insanity(27), potion_of_deadly_grace
7:09.164 dispersion Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity twist_of_fate, voidform, insanity_drain_stacks, potion_of_deadly_grace
7:15.438 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 97.3/100: 97% insanity twist_of_fate, voidform(7), insanity_drain_stacks(2)
7:16.728 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.7/100: 92% insanity twist_of_fate, voidform(8), insanity_drain_stacks(3)
7:18.008 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 95.2/100: 95% insanity twist_of_fate, voidform(9), insanity_drain_stacks(4)
7:19.275 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.9/100: 90% insanity twist_of_fate, voidform(11), insanity_drain_stacks(6)
7:20.544 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.9/100: 90% insanity twist_of_fate, voidform(12), insanity_drain_stacks(7)
7:21.776 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.9/100: 78% insanity twist_of_fate, voidform(13), insanity_drain_stacks(8)
7:22.999 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 64.6/100: 65% insanity twist_of_fate, voidform(14), insanity_drain_stacks(9)
7:24.233 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 64.3/100: 64% insanity twist_of_fate, voidform(16), insanity_drain_stacks(11)
7:25.652 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 56.6/100: 57% insanity twist_of_fate, voidform(17), insanity_drain_stacks(12), voidsight
7:26.798 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 41.9/100: 42% insanity twist_of_fate, voidform(18), insanity_drain_stacks(13), voidsight

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 6259 5934 0
Agility 7825 7500 0
Stamina 15673 15673 7641
Intellect 19871 18165 9974 (458)
Spirit -1 -1 0
Health 940380 940380 0
Mana 1100000 1100000 0
Insanity 100 100 0
Spell Power 19871 18165 0
Crit 11.60% 11.60% 2311
Haste 8.90% 7.75% 2518
Damage / Heal Versatility 1.59% 1.59% 635
Mastery 36.05% 36.05% 2246
Armor 1046 1046 1046
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 734.00
Local Head Mitre of the High Priest
ilevel: 830, stats: { 197 Armor, +1614 Sta, +1077 Int, +787 Mastery, +424 Crit }
Local Neck Buccaneer's Lucky Chain
ilevel: 680, stats: { +225 Sta, +299 Crit, +200 Haste }
Local Shoulders Starlance Amice
ilevel: 680, stats: { 94 Armor, +200 Int, +300 Sta, +76 Crit, +190 Haste }
Local Chest Shaladrassil Vestments
ilevel: 800, stats: { 218 Armor, +814 Int, +1221 Sta, +449 Crit, +635 Vers }
Local Waist Temporal Scholar's Cord of the Feverflare
ilevel: 680, stats: { 70 Armor, +200 Int, +300 Sta, +171 Haste, +95 Mastery }
Local Legs Gilnean Fleece Pantaloons
ilevel: 680, stats: { 109 Armor, +266 Int, +399 Sta, +230 Crit, +124 Haste }
Local Feet Leywalker Treads
ilevel: 680, stats: { 86 Armor, +200 Int, +300 Sta, +162 Mastery, +105 Haste }
Local Wrists Subject 12's ID Bracelets
ilevel: 800, stats: { 95 Armor, +458 Int, +687 Sta, +396 Mastery, +213 Haste }
Local Hands Valiyaka's Weathered Handwraps
ilevel: 660, stats: { 68 Armor, +248 Sta, +166 Int, +139 Mastery, +82 Haste }
Local Finger1 Seal of House Farondis
ilevel: 680, stats: { +225 Sta, +299 Haste, +200 Mastery }
Local Finger2 Band of Ingression
ilevel: 680, stats: { +225 Sta, +342 Haste, +157 Crit }
Local Trinket1 Orb of Voidsight
ilevel: 815, stats: { +890 Int }
Local Trinket2 Runas' Nearly Depleted Ley Crystal
ilevel: 680, stats: { +253 Crit }
Local Back Cloak of the Everliving Keeper
ilevel: 800, stats: { 109 Armor, +458 StrAgiInt, +687 Sta, +370 Haste, +240 Mastery }
Local Main Hand Xal'atath, Blade of the Black Empire
ilevel: 800, weapon: { 715 - 1331, 1.8 }, stats: { +349 Int, +523 Sta, +236 Crit, +227 Mastery, +4438 Int }, relics: { +22 ilevels, +28 ilevels }
Local Off Hand Secrets of the Void
ilevel: 800, stats: { +458 Int, +687 Sta, +422 Haste, +187 Crit }

Talents

Level
15 Twist of Fate (Shadow Priest) Fortress of the Mind (Shadow Priest) Shadow Word: Void (Shadow Priest)
30 Mania (Shadow Priest) Body and Soul Masochism
45 Mind Bomb (Shadow Priest) Psychic Voice Dominant Mind
60 Void Lord (Shadow Priest) Reaper of Souls (Shadow Priest) Void Ray (Shadow Priest)
75 San'layn (Shadow Priest) Auspicious Spirits (Shadow Priest) Shadowy Insight (Shadow Priest)
90 Power Infusion (Shadow Priest) Shadow Crash (Shadow Priest) Mindbender (Shadow Priest)
100 Legacy of the Void (Shadow Priest) Mind Spike (Shadow Priest) Surrender to Madness (Shadow Priest)

Profile

priest="Waleràn"
origin="https://eu.api.battle.net/wow/character/hyjal/Waleràn/advanced"
thumbnail="http://eu.battle.net/static-render/eu/hyjal/196/115587524-avatar.jpg"
level=110
race=dwarf
role=spell
position=back
professions=engineering=700/inscription=700
talents=http://eu.battle.net/wow/en/tool/talent-calculator#Xb!0101120
artifact=47:0:0:0:0:764:1:765:1:767:3:771:3:773:3:1347:1
spec=shadow

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/augmentation,type=defiled
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/mind_blast

# Executed every time the actor is available.
actions=potion,name=deadly_grace,if=buff.bloodlust.react|target.time_to_die<=40|buff.voidform.stack>80
actions+=/variable,op=set,name=actors_fight_time_mod,value=0
actions+=/variable,op=set,name=actors_fight_time_mod,value=-((-(450)+(time+target.time_to_die))%10),if=time+target.time_to_die>450&time+target.time_to_die<600
actions+=/variable,op=set,name=actors_fight_time_mod,value=((450-(time+target.time_to_die))%5),if=time+target.time_to_die<=450
actions+=/variable,op=set,name=s2mcheck,value=0.85*(45+((raw_haste_pct*100)*(2+(1*talent.reaper_of_souls.enabled)+(2*artifact.mass_hysteria.rank)-(1*talent.sanlayn.enabled))))-(variable.actors_fight_time_mod*nonexecute_actors_pct)
actions+=/variable,op=min,name=s2mcheck,value=180
actions+=/call_action_list,name=s2m,if=buff.voidform.up&buff.surrender_to_madness.up
actions+=/call_action_list,name=vf,if=buff.voidform.up
actions+=/call_action_list,name=main

actions.main=surrender_to_madness,if=talent.surrender_to_madness.enabled&target.time_to_die<=variable.s2mcheck
actions.main+=/mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
actions.main+=/mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck+60
actions.main+=/shadow_word_pain,if=dot.shadow_word_pain.remains<(3+(4%3))*gcd
actions.main+=/vampiric_touch,if=dot.vampiric_touch.remains<(4+(4%3))*gcd
actions.main+=/void_eruption,if=insanity>=85|(talent.auspicious_spirits.enabled&insanity>=(80-shadowy_apparitions_in_flight*4))
actions.main+=/shadow_crash,if=talent.shadow_crash.enabled
actions.main+=/mindbender,if=talent.mindbender.enabled&set_bonus.tier18_2pc
actions.main+=/shadow_word_pain,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
actions.main+=/vampiric_touch,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
actions.main+=/shadow_word_death,if=!talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=90
actions.main+=/shadow_word_death,if=talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=70
actions.main+=/mind_blast,if=talent.legacy_of_the_void.enabled&(insanity<=81|(insanity<=75.2&talent.fortress_of_the_mind.enabled))
actions.main+=/mind_blast,if=!talent.legacy_of_the_void.enabled|(insanity<=96|(insanity<=95.2&talent.fortress_of_the_mind.enabled))
actions.main+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
actions.main+=/vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
actions.main+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
actions.main+=/shadow_word_void,if=(insanity<=70&talent.legacy_of_the_void.enabled)|(insanity<=85&!talent.legacy_of_the_void.enabled)
actions.main+=/mind_sear,if=active_enemies>=3,interrupt=1,chain=1
actions.main+=/mind_flay,if=!talent.mind_spike.enabled,interrupt=1,chain=1
actions.main+=/mind_spike,if=talent.mind_spike.enabled
actions.main+=/shadow_word_pain

actions.vf=surrender_to_madness,if=talent.surrender_to_madness.enabled&insanity>=25&(cooldown.void_bolt.up|cooldown.void_torrent.up|cooldown.shadow_word_death.up|buff.shadowy_insight.up)&target.time_to_die<=variable.s2mcheck-(buff.insanity_drain_stacks.stack)
actions.vf+=/shadow_crash,if=talent.shadow_crash.enabled
actions.vf+=/mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
actions.vf+=/mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+30
actions.vf+=/dispersion,if=!buff.power_infusion.up&!buff.berserking.up&!buff.bloodlust.up&artifact.void_torrent.rank&!talent.surrender_to_madness.enabled
actions.vf+=/dispersion,if=!buff.power_infusion.up&!buff.berserking.up&!buff.bloodlust.up&artifact.void_torrent.rank&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+(120-10*artifact.from_the_shadows.rank)
actions.vf+=/power_infusion,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=30&!talent.surrender_to_madness.enabled
actions.vf+=/power_infusion,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+15
actions.vf+=/berserking,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=20&!talent.surrender_to_madness.enabled
actions.vf+=/berserking,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+70
actions.vf+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt,if=dot.vampiric_touch.remains<3.5*gcd&(talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&artifact.sphere_of_insanity.rank&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt
actions.vf+=/void_torrent,if=!talent.surrender_to_madness.enabled
actions.vf+=/void_torrent,if=talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+60
actions.vf+=/shadow_word_death,if=!talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+10)<100
actions.vf+=/shadow_word_death,if=talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+30)<100
actions.vf+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable_in<gcd.max*0.25
actions.vf+=/mind_blast
actions.vf+=/wait,sec=action.mind_blast.usable_in,if=action.mind_blast.usable_in<gcd.max*0.25
actions.vf+=/shadow_word_death,if=cooldown.shadow_word_death.charges=2
actions.vf+=/shadowfiend,if=!talent.mindbender.enabled,if=buff.voidform.stack>15
actions.vf+=/shadow_word_void,if=(insanity-(current_insanity_drain*gcd.max)+25)<100
actions.vf+=/shadow_word_pain,if=!ticking&(active_enemies<5|talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled|artifact.sphere_of_insanity.rank)
actions.vf+=/vampiric_touch,if=!ticking&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))
actions.vf+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
actions.vf+=/vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
actions.vf+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
actions.vf+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable|action.void_bolt.usable_in<gcd.max*0.8
actions.vf+=/mind_sear,if=active_enemies>=3,interrupt=1
actions.vf+=/mind_flay,if=!talent.mind_spike.enabled,chain=1,interrupt_immediate=1,interrupt_if=action.void_bolt.usable_in<gcd.max*0.8
actions.vf+=/mind_spike,if=talent.mind_spike.enabled
actions.vf+=/shadow_word_pain

actions.s2m=shadow_crash,if=talent.shadow_crash.enabled
actions.s2m+=/mindbender,if=talent.mindbender.enabled
actions.s2m+=/dispersion,if=!buff.power_infusion.up&!buff.berserking.up&!buff.bloodlust.up
actions.s2m+=/power_infusion,if=buff.insanity_drain_stacks.stack>=85
actions.s2m+=/berserking,if=buff.voidform.stack>=90
actions.s2m+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt,if=dot.vampiric_touch.remains<3.5*gcd&(talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&artifact.sphere_of_insanity.rank&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt
actions.s2m+=/void_torrent
actions.s2m+=/shadow_word_death,if=!talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+30)<100
actions.s2m+=/shadow_word_death,if=talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+90)<100
actions.s2m+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable_in<gcd.max*0.25
actions.s2m+=/mind_blast
actions.s2m+=/wait,sec=action.mind_blast.usable_in,if=action.mind_blast.usable_in<gcd.max*0.25
actions.s2m+=/shadow_word_death,if=cooldown.shadow_word_death.charges=2
actions.s2m+=/shadowfiend,if=!talent.mindbender.enabled,if=buff.voidform.stack>15
actions.s2m+=/shadow_word_void,if=(insanity-(current_insanity_drain*gcd.max)+75)<100
actions.s2m+=/shadow_word_pain,if=!ticking&(active_enemies<5|talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled|artifact.sphere_of_insanity.rank)
actions.s2m+=/vampiric_touch,if=!ticking&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))
actions.s2m+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
actions.s2m+=/vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
actions.s2m+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
actions.s2m+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable|action.void_bolt.usable_in<gcd.max*0.8
actions.s2m+=/mind_sear,if=active_enemies>=3,interrupt=1
actions.s2m+=/mind_flay,if=!talent.mind_spike.enabled,chain=1,interrupt_immediate=1,interrupt_if=action.void_bolt.usable_in<gcd.max*0.8
actions.s2m+=/mind_spike,if=talent.mind_spike.enabled

head=mitre_of_the_high_priest,id=139757,bonus_id=3386/3383
neck=buccaneers_lucky_chain,id=132936,bonus_id=1793
shoulders=starlance_amice,id=138824,bonus_id=664
back=cloak_of_the_everliving_keeper,id=121804
chest=shaladrassil_vestments,id=129985
wrists=subject_12s_id_bracelets,id=139926
hands=valiyakas_weathered_handwraps,id=129082,bonus_id=1794/1735
waist=temporal_scholars_cord,id=121048,bonus_id=1812/1698
legs=gilnean_fleece_pantaloons,id=138852,bonus_id=664/1736
feet=leywalker_treads,id=121420,bonus_id=768/1739
finger1=seal_of_house_farondis,id=132911,bonus_id=1792
finger2=band_of_ingression,id=129171,bonus_id=664/1736
trinket1=orb_of_voidsight,id=133596
trinket2=runas_nearly_depleted_ley_crystal,id=132970,bonus_id=767/1734
main_hand=xalatath_blade_of_the_black_empire,id=128827,gem_id=133100/133020/0/0,relic_id=664:1736:1591:1809/1793:1615:1809/0/0
off_hand=secrets_of_the_void,id=133958

# Gear Summary
# gear_ilvl=734.06
# gear_stamina=7641
# gear_intellect=9974
# gear_crit_rating=2311
# gear_haste_rating=2518
# gear_mastery_rating=2246
# gear_versatility_rating=635
# gear_armor=1046

Ptitfille

Ptitfille : 170420 dps

  • Race: Human
  • Class: Rogue
  • Spec: Assassination
  • Level: 110
  • Role: Attack
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
170419.6 170419.6 113.6 / 0.067% 22807.4 / 13.4% 7383.6
RPS Out RPS In Primary Resource Waiting APM Active Skill
23.1 23.1 Energy 47.02% 32.5 100.0% 100%
Origin https://eu.api.battle.net/wow/character/hyjal/Ptitfille/advanced
Talents
  • 15: Elaborate Planning
  • 30: Nightstalker
  • 45: Deeper Stratagem
  • 60: Cheat Death
  • 75: Thuggee (Assassination Rogue)
  • 90: Exsanguinate
  • 100: Venom Rush (Assassination Rogue)
  • Talent Calculator
Artifact
Professions
  • alchemy: 734
  • herbalism: 790

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Ptitfille 170420
auto_attack_mh 8384 4.9% 272.1 1.66sec 13869 8456 Direct 272.1 12957 25926 13869 26.0% 19.0%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 272.09 272.09 0.00 0.00 1.6401 0.0000 3773572.09 5547508.41 31.98 8455.98 8455.98
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 149.73 55.03% 12956.77 11160 16685 12959.86 12611 13389 1939974 2851946 31.98
crit 70.72 25.99% 25925.75 22321 33369 25932.47 24570 27391 1833598 2695562 31.98
miss 51.64 18.98% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 4169 2.4% 270.6 1.66sec 6935 4189 Direct 270.6 6477 12952 6935 26.1% 19.0%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 270.56 270.56 0.00 0.00 1.6557 0.0000 1876442.44 2758548.13 31.98 4188.72 4188.72
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 148.69 54.96% 6477.08 5580 8342 6478.76 6257 6727 963105 1415856 31.98
crit 70.52 26.06% 12951.60 11160 16685 12955.12 12344 13885 913337 1342692 31.98
miss 51.35 18.98% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Cleansing Flame 5359 3.1% 27.7 16.24sec 87041 0 Direct 27.7 87041 0 87041 0.0% 0.0%  

Stats details: cleansing_flame

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.71 27.71 0.00 0.00 0.0000 0.0000 2411912.77 2411912.77 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 27.71 100.00% 87040.60 79543 91475 87040.55 82297 90907 2411913 2411913 0.00
 
 

Action details: cleansing_flame

Static Values
  • id:201408
  • school:holy
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:201408
  • name:Cleansing Flame
  • school:holy
  • tooltip:Damage against Demons increased by {$s2=10}%.
  • description:Deals {$s1=60162} damage. Increases damage against Demons by {$s2=10}%.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63030.38
  • base_dd_max:63030.38
 
Deadly Grace 5192 3.0% 22.2 7.02sec 103454 0 Direct 22.2 82096 164188 103454 26.0% 0.0%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.25 22.25 0.00 0.00 0.0000 0.0000 2301448.52 2301448.52 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.46 73.98% 82096.06 75044 86301 82082.76 76451 86301 1351142 1351142 0.00
crit 5.79 26.02% 164188.09 150089 172602 163785.66 0 172602 950306 950306 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:5.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=47572 to 71358} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:47572.00
  • base_dd_max:71358.00
 
Deadly Poison (_dot) 6427 3.8% 468.1 1.10sec 6183 0 Periodic 149.4 15363 30732 19368 26.1% 0.0% 99.5%

Stats details: deadly_poison_dot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 468.11 0.00 149.44 149.44 0.0000 3.0000 2894372.00 2894372.00 0.00 6456.05 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 110.5 73.94% 15362.59 13272 19842 15366.40 14894 15982 1697465 1697465 0.00
crit 38.9 26.06% 30731.92 26544 39683 30738.66 28137 33406 1196907 1196907 0.00
 
 

Action details: deadly_poison_dot

Static Values
  • id:2818
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2818
  • name:Deadly Poison
  • school:nature
  • tooltip:Suffering $w1 Nature damage every $t1 seconds.
  • description:{$@spelldesc2823=Coats your weapons with a Lethal Poison that lasts for {$2823d=3600 seconds}. Each strike has a {$2823h=30}% chance to poison the enemy for ${$2818m1*4} Nature damage over {$2818d=12 seconds}. Subsequent poison applications will instantly deal {$113780s1=0} Nature damage.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.275000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:12.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Deadly Poison (_instant) 12545 7.4% 467.1 1.10sec 12088 0 Direct 467.1 9593 19185 12088 26.0% 0.0%  

Stats details: deadly_poison_instant

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 467.11 467.11 0.00 0.00 0.0000 0.0000 5646702.28 5646702.28 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 345.59 73.98% 9592.89 8204 12266 9594.75 9345 9884 3315187 3315187 0.00
crit 121.53 26.02% 19184.86 16409 24531 19189.04 18348 20438 2331515 2331515 0.00
 
 

Action details: deadly_poison_instant

Static Values
  • id:113780
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:113780
  • name:Deadly Poison
  • school:nature
  • tooltip:
  • description:Poisoned weapons have a chance to deal {$s1=0} Nature damage to a target already affected by Deadly Poison.
 
Envenom 16671 9.8% 30.6 14.38sec 245508 244412 Direct 30.6 194733 389510 245511 26.1% 0.0%  

Stats details: envenom

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.57 30.57 0.00 0.00 1.0045 0.0000 7504189.46 7504189.46 0.00 244412.25 244412.25
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 22.60 73.93% 194733.30 163621 293536 194750.06 174139 215325 4400654 4400654 0.00
crit 7.97 26.07% 389509.93 327241 587071 389354.89 0 510497 3103536 3103536 0.00
 
 

Action details: envenom

Static Values
  • id:32645
  • school:nature
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:32645
  • name:Envenom
  • school:nature
  • tooltip:Poison application chance increased by {$s2=30}%.
  • description:Finishing move that drives your poisoned blades in deep, dealing instant Nature damage and increasing your poison application chance by {$s2=30}%. Damage and duration increased per combo point. 1 point : ${$m1*1} damage, 2 sec 2 points: ${$m1*2} damage, 3 sec 3 points: ${$m1*3} damage, 4 sec 4 points: ${$m1*4} damage, 5 sec 5 points: ${$m1*5} damage, 6 sec{$?s193531=false}[ 6 points: ${$m1*6} damage, 7 sec][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.600000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00
 
Garrote 18716 11.0% 28.8 15.95sec 292939 291633 Periodic 245.6 27223 54447 34304 26.0% 0.0% 98.1%

Stats details: garrote

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.76 0.00 245.63 245.63 1.0045 1.7981 8426149.81 8426149.81 0.00 17906.64 291632.91
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 181.8 73.99% 27223.36 27 51835 27238.70 25992 28654 4947926 4947926 0.00
crit 63.9 26.01% 54447.17 53 103669 54478.74 49375 61540 3478223 3478223 0.00
 
 

Action details: garrote

Static Values
  • id:703
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:45.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.subterfuge.enabled&!ticking&combo_points.deficit>=1&spell_targets.fan_of_knives>=2
Spelldata
  • id:703
  • name:Garrote
  • school:physical
  • tooltip:Suffering $w1 damage every $t1 seconds.
  • description:Garrote the enemy, causing $o1 Bleed damage over {$d=18 seconds}. Silences the target for {$1330d=3 seconds} when used from Stealth. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.900000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Kingsbane 6280 (8617) 3.7% (5.1%) 7.5 61.84sec 515216 512916 Periodic 51.5 43465 86970 54847 26.2% 0.0% 22.9%

Stats details: kingsbane

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.53 0.00 51.54 51.54 1.0045 2.0000 2827019.18 2827019.18 0.00 35053.85 512916.42
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.1 73.84% 43465.45 15806 102696 43510.63 33886 56120 1654298 1654298 0.00
crit 13.5 26.16% 86970.24 31611 205393 87059.59 50894 132134 1172722 1172722 0.00
 
 

Action details: kingsbane

Static Values
  • id:192759
  • school:nature
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.exsanguinate.enabled&(buff.vendetta.up|cooldown.vendetta.remains>10)|talent.exsanguinate.enabled&dot.rupture.exsanguinated
Spelldata
  • id:192759
  • name:Kingsbane
  • school:nature
  • tooltip:Suffering $w4 Nature damage every $t4 sec.
  • description:Releases lethal poison within |cFFFFCC99The Kingslayers|r and injects it into your target, dealing ${$222062sw1+$192760sw1} Nature damage instantly and an additional $o4 Nature damage over {$d=14 seconds}. Each time you apply a Lethal Poison to a target affected by Kingsbane, Kingsbane damage increases by {$192853s1=15}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.360000
  • spell_power_mod.tick:0.000000
  • base_td:5.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Kingsbane (_mh) 1557 0.9% 7.5 61.84sec 93085 0 Direct 7.5 73900 147800 93087 26.0% 0.0%  

Stats details: kingsbane_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.53 7.53 0.00 0.00 0.0000 0.0000 700770.60 700770.60 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.57 74.04% 73900.36 64262 73901 73885.61 0 73901 411910 411910 0.00
crit 1.95 25.96% 147800.47 128524 147802 130904.04 0 147802 288861 288861 0.00
 
 

Action details: kingsbane_mh

Static Values
  • id:222062
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222062
  • name:Kingsbane
  • school:nature
  • tooltip:
  • description:{$@spelldesc192759=Releases lethal poison within |cFFFFCC99The Kingslayers|r and injects it into your target, dealing ${$222062sw1+$192760sw1} Nature damage instantly and an additional $o4 Nature damage over {$d=14 seconds}. Each time you apply a Lethal Poison to a target affected by Kingsbane, Kingsbane damage increases by {$192853s1=15}%.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.40
 
    Kingsbane (_oh) 780 0.5% 7.5 61.84sec 46609 0 Direct 7.5 36950 73900 46611 26.1% 0.0%  

Stats details: kingsbane_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.53 7.53 0.00 0.00 0.0000 0.0000 350884.18 350884.18 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.56 73.86% 36950.18 32131 36951 36946.42 0 36951 205456 205456 0.00
crit 1.97 26.14% 73900.24 64262 73901 65652.38 0 73901 145428 145428 0.00
 
 

Action details: kingsbane_oh

Static Values
  • id:192760
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:192760
  • name:Kingsbane
  • school:nature
  • tooltip:
  • description:{$@spelldesc192759=Releases lethal poison within |cFFFFCC99The Kingslayers|r and injects it into your target, dealing ${$222062sw1+$192760sw1} Nature damage instantly and an additional $o4 Nature damage over {$d=14 seconds}. Each time you apply a Lethal Poison to a target affected by Kingsbane, Kingsbane damage increases by {$192853s1=15}%.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.40
 
Mutilate 0 (28142) 0.0% (16.5%) 128.6 3.50sec 98496 98055

Stats details: mutilate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 128.60 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 98055.19 98055.19
 
 

Action details: mutilate

Static Values
  • id:1329
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:55.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points.deficit<=1&energy.deficit<=30
Spelldata
  • id:1329
  • name:Mutilate
  • school:physical
  • tooltip:
  • description:Attack with both weapons, dealing a total of ${$5374sw2+$27576sw2} Physical damage. |cFFFFFFFFAwards {$s2=2} combo $lpoint:points;.|r
 
    Mutilate (_mh) 18765 11.0% 128.6 3.50sec 65675 0 Direct 128.6 52099 104102 65674 26.1% 0.0%  

Stats details: mutilate_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 128.60 128.60 0.00 0.00 0.0000 0.0000 8445751.31 12416054.43 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 95.03 73.90% 52098.60 44141 65991 52114.49 50479 54382 4950928 7278333 31.98
crit 33.57 26.10% 104102.49 88282 131982 104123.82 96228 113332 3494823 5137721 31.98
 
 

Action details: mutilate_mh

Static Values
  • id:5374
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:5374
  • name:Mutilate
  • school:physical
  • tooltip:
  • description:Instantly attacks for $5374sw2 Physical damage. Awards 2 combo points.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.60
 
    Mutilate Off-Hand (mutilate_oh) 9377 5.5% 128.6 3.50sec 32821 0 Direct 128.6 26037 52104 32821 26.0% 0.0%  

Stats details: mutilate_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 128.60 128.60 0.00 0.00 0.0000 0.0000 4220822.44 6205008.80 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 95.13 73.97% 26037.16 22069 32993 26045.32 25095 27078 2476978 3641392 31.98
crit 33.47 26.03% 52104.01 44138 65986 52110.67 48061 56459 1743845 2563617 31.98
 
 

Action details: mutilate_oh

Static Values
  • id:27576
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:27576
  • name:Mutilate Off-Hand
  • school:physical
  • tooltip:
  • description:Instantly attacks for $5374sw2 Physical damage. Awards 2 combo points.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.60
 
Rupture 56197 33.0% 27.4 16.63sec 923750 919615 Periodic 285.9 70206 140512 88493 26.0% 0.0% 97.1%

Stats details: rupture

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.39 0.00 285.91 285.91 1.0045 1.5293 25301359.45 25301359.45 0.00 54440.44 919614.71
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 211.5 73.99% 70205.61 30 209055 70191.88 54964 88469 14852053 14852053 0.00
crit 74.4 26.01% 140511.73 20 418109 140512.39 103666 197186 10449307 10449307 0.00
 
 

Action details: rupture

Static Values
  • id:1943
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points>=2&!ticking&time<10&!artifact.urge_to_kill.enabled
Spelldata
  • id:1943
  • name:Rupture
  • school:physical
  • tooltip:Suffering $w1 damage every $t1 sec.
  • description:Finishing move that tears open the target, dealing Bleed damage over time. Lasts longer per combo point. 1 point : ${4+$<bonus>*1*0.275*$AP*8/2} over 8 sec 2 points: ${12+$<bonus>*2*0.275*$AP*12/2} over 12 sec 3 points: ${24+$<bonus>*3*0.275*$AP*16/2} over 16 sec 4 points: ${40+$<bonus>*4*0.275*$AP*20/2} over 20 sec 5 points: ${60+$<bonus>*5*0.275*$AP*24/2} over 24 sec{$?s193531=false}[ 6 points: ${84+$<bonus>*6*0.275*$AP*28/2} over 28 sec][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.250000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:4.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Ptitfille
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Ptitfille
  • harmful:false
  • if_expr:
 
Exsanguinate 7.5 61.82sec

Stats details: exsanguinate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.55 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: exsanguinate

Static Values
  • id:200806
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:prev_gcd.rupture&dot.rupture.remains>22+4*talent.deeper_stratagem.enabled&cooldown.vanish.remains>10
Spelldata
  • id:200806
  • name:Exsanguinate
  • school:physical
  • tooltip:
  • description:Twist your blades into the target's wounds, causing your Bleed effects on them to bleed out {$s1=100}% faster.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Ptitfille
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Ptitfille
  • harmful:false
  • if_expr:
 
Maalus 4.1 120.16sec

Stats details: maalus

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.14 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: maalus

Static Values
  • id:187626
  • school:arcane
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187626
  • name:Maalus
  • school:arcane
  • tooltip:
  • description:{$@spelldesc187615=Awakens the powers of all the Savage Hallows worn by you and your allies, increasing damage dealt by ${$<WarlordsTrinketNerf>*$m1/100}% for {$187620d=15 seconds}. When this effect ends, each empowered player unleashes a blast of light that strikes all enemies within $187626A1 yards of the initiating player's location, inflicting damage equal to ${$m1/100}% of all damage they dealt while empowered. (2 min shared cooldown)}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3987254.60
  • base_dd_max:3987254.60
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Vanish 4.0 126.41sec

Stats details: vanish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: vanish

Static Values
  • id:1856
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.subterfuge.enabled&combo_points<=2&!dot.rupture.exsanguinated|talent.shadow_focus.enabled&!dot.rupture.exsanguinated&combo_points.deficit>=2
Spelldata
  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.
 
Vendetta 4.5 118.09sec

Stats details: vendetta

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.49 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: vendetta

Static Values
  • id:79140
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:target.time_to_die<20|buff.maalus.react
Spelldata
  • id:79140
  • name:Vendetta
  • school:physical
  • tooltip:Marked for death, increasing damage taken from the Rogue's attacks, and always visible to the Rogue.
  • description:Marks an enemy for death for {$d=20 seconds}, increasing the damage your abilities and auto attacks deal to the target by {$s1=30}%, and making the target visible to you even through concealments such as stealth and invisibility.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 8.27% 0.0(0.0) 1.0

Buff details

  • buff initial source:Ptitfille
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Cleansing Flame 21.7 6.0 20.8sec 16.2sec 27.36% 27.40% 6.0(6.0) 21.4

Buff details

  • buff initial source:Ptitfille
  • cooldown name:buff_cleansing_flame
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • cleansing_flame_1:27.36%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201408
  • name:Cleansing Flame
  • tooltip:Damage against Demons increased by {$s2=10}%.
  • description:Deals {$s1=60162} damage. Increases damage against Demons by {$s2=10}%.
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Elaborate Planning 52.4 5.6 8.6sec 7.8sec 62.60% 48.70% 5.6(5.6) 51.7

Buff details

  • buff initial source:Ptitfille
  • cooldown name:buff_elaborate_planning
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.15

Stack Uptimes

  • elaborate_planning_1:62.60%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193641
  • name:Elaborate Planning
  • tooltip:Increases damage done by {$s1=15}%.
  • description:Increases damage done by {$s1=15}% for {$d=5 seconds}.
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:101.00%
Envenom 25.0 5.5 17.6sec 14.4sec 44.13% 43.19% 5.5(5.5) 24.6

Buff details

  • buff initial source:Ptitfille
  • cooldown name:buff_envenom
  • max_stacks:1
  • duration:1.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • envenom_1:44.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:32645
  • name:Envenom
  • tooltip:Poison application chance increased by {$s2=30}%.
  • description:Finishing move that drives your poisoned blades in deep, dealing instant Nature damage and increasing your poison application chance by {$s2=30}%. Damage and duration increased per combo point. 1 point : ${$m1*1} damage, 2 sec 2 points: ${$m1*2} damage, 3 sec 3 points: ${$m1*3} damage, 4 sec 4 points: ${$m1*4} damage, 5 sec 5 points: ${$m1*5} damage, 6 sec{$?s193531=false}[ 6 points: ${$m1*6} damage, 7 sec][]
  • max_stacks:0
  • duration:1.00
  • cooldown:0.00
  • default_chance:0.00%
Maalus 4.3 0.0 120.2sec 120.2sec 14.17% 11.74% 0.0(0.0) 4.2

Buff details

  • buff initial source:Ptitfille
  • cooldown name:buff_maalus
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • maalus_1:14.17%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187620
  • name:Maalus
  • tooltip:$?$w1>0[Damage dealt increased by $w1%. When this effect ends, the triggering ally will explode for $w1% of all damage dealt while empowered.][Contributing toward the master's Savage Hollows.]
  • description:{$@spelldesc187615=Awakens the powers of all the Savage Hallows worn by you and your allies, increasing damage dealt by ${$<WarlordsTrinketNerf>*$m1/100}% for {$187620d=15 seconds}. When this effect ends, each empowered player unleashes a blast of light that strikes all enemies within $187626A1 yards of the initiating player's location, inflicting damage equal to ${$m1/100}% of all damage they dealt while empowered. (2 min shared cooldown)}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Potion of Deadly Grace 2.0 0.0 121.1sec 0.0sec 10.83% 10.89% 0.0(0.0) 2.0

Buff details

  • buff initial source:Ptitfille
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:10.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Stealth 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Ptitfille
  • cooldown name:buff_stealth
  • max_stacks:1
  • duration:225.00
  • cooldown:2.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=50}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for $31666d after deal {$31223s1=10}% more damage.][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:2.00
  • default_chance:100.00%
Vanish 4.0 0.0 126.9sec 126.9sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Ptitfille
  • cooldown name:buff_vanish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Ptitfille
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Ptitfille
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (seedbattered_fish_plate)

Buff details

  • buff initial source:Ptitfille
  • cooldown name:buff_seedbattered_fish_plate
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:versatility_rating
  • amount:375.00

Stack Uptimes

  • seedbattered_fish_plate_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225605
  • name:Well Fed
  • tooltip:Versatility increased by $w1.
  • description:Increases versatility by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Ptitfille
envenom Energy 30.6 1069.8 35.0 35.0 7014.6
envenom Combo Points 30.6 170.4 5.6 5.6 44048.4
garrote Energy 28.8 1294.4 45.0 45.0 6509.8
kingsbane Energy 7.5 263.5 35.0 35.0 14720.1
mutilate Energy 128.6 7073.0 55.0 55.0 1790.8
rupture Energy 27.4 684.8 25.0 25.0 36949.6
rupture Combo Points 27.4 146.3 5.3 5.3 172945.4
Resource Gains Type Count Total Average Overflow
garrote Combo Points 28.76 28.76 (9.00%) 1.00 0.00 0.00%
mutilate Combo Points 128.60 239.39 (74.93%) 1.86 17.81 6.92%
energy_regen Energy 2671.98 4798.00 (46.57%) 1.80 48.03 0.99%
seal_fate Combo Points 67.03 51.31 (16.06%) 0.77 15.72 23.45%
Venomous Vim Energy 531.51 5209.41 (50.56%) 9.80 105.71 1.99%
Urge to Kill Energy 4.49 296.45 (2.88%) 66.00 242.53 45.00%
Resource RPS-Gain RPS-Loss
Energy 22.88 23.06
Combo Points 0.71 0.70
Combat End Resource Mean Min Max
Energy 38.07 0.01 120.00
Combo Points 2.87 0.00 6.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 1.0%

Procs

Count Interval
Seal Fate 67.0 7.7sec

Statistics & Data Analysis

Fight Length
Sample Data Ptitfille Fight Length
Count 9999
Mean 450.42
Minimum 350.15
Maximum 555.44
Spread ( max - min ) 205.29
Range [ ( max - min ) / 2 * 100% ] 22.79%
DPS
Sample Data Ptitfille Damage Per Second
Count 9999
Mean 170419.59
Minimum 147034.05
Maximum 190722.39
Spread ( max - min ) 43688.34
Range [ ( max - min ) / 2 * 100% ] 12.82%
Standard Deviation 5793.3181
5th Percentile 160702.96
95th Percentile 179970.58
( 95th Percentile - 5th Percentile ) 19267.62
Mean Distribution
Standard Deviation 57.9361
95.00% Confidence Intervall ( 170306.04 - 170533.14 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 44
0.1% Error 4439
0.1 Scale Factor Error with Delta=300 286509
0.05 Scale Factor Error with Delta=300 1146036
0.01 Scale Factor Error with Delta=300 28650910
Priority Target DPS
Sample Data Ptitfille Priority Target Damage Per Second
Count 9999
Mean 170419.59
Minimum 147034.05
Maximum 190722.39
Spread ( max - min ) 43688.34
Range [ ( max - min ) / 2 * 100% ] 12.82%
Standard Deviation 5793.3181
5th Percentile 160702.96
95th Percentile 179970.58
( 95th Percentile - 5th Percentile ) 19267.62
Mean Distribution
Standard Deviation 57.9361
95.00% Confidence Intervall ( 170306.04 - 170533.14 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 44
0.1% Error 4439
0.1 Scale Factor Error with Delta=300 286509
0.05 Scale Factor Error with Delta=300 1146036
0.01 Scale Factor Error with Delta=300 28650910
DPS(e)
Sample Data Ptitfille Damage Per Second (Effective)
Count 9999
Mean 170419.59
Minimum 147034.05
Maximum 190722.39
Spread ( max - min ) 43688.34
Range [ ( max - min ) / 2 * 100% ] 12.82%
Damage
Sample Data Ptitfille Damage
Count 9999
Mean 76681396.52
Minimum 55144239.47
Maximum 99877981.26
Spread ( max - min ) 44733741.79
Range [ ( max - min ) / 2 * 100% ] 29.17%
DTPS
Sample Data Ptitfille Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Ptitfille Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Ptitfille Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Ptitfille Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Ptitfille Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Ptitfille Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data PtitfilleTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Ptitfille Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,name=flask_of_the_seventh_demon
1 0.00 augmentation,name=defiled
2 0.00 food,name=seedbattered_fish_plate
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 apply_poison
5 0.00 stealth
6 0.00 potion,name=deadly_grace
7 0.00 marked_for_death,if=raid_event.adds.in>40
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 potion,name=deadly_grace,if=buff.bloodlust.react|target.time_to_die<=25|debuff.vendetta.up
9 4.33 use_item,slot=finger1
0.00 blood_fury,if=debuff.vendetta.up
0.00 berserking,if=debuff.vendetta.up
0.00 arcane_torrent,if=debuff.vendetta.up&energy.deficit>50
A 0.00 call_action_list,name=cds
0.00 rupture,if=combo_points>=2&!ticking&time<10&!artifact.urge_to_kill.enabled
B 6.63 rupture,if=combo_points>=4&!ticking
0.00 pool_resource,for_next=1
C 7.53 kingsbane,if=!talent.exsanguinate.enabled&(buff.vendetta.up|cooldown.vendetta.remains>10)|talent.exsanguinate.enabled&dot.rupture.exsanguinated
D 0.00 run_action_list,name=exsang_combo,if=cooldown.exsanguinate.up&(buff.maalus.up|cooldown.vanish.remains>35)&talent.exsanguinate.enabled
E 0.00 call_action_list,name=garrote,if=spell_targets.fan_of_knives<=8-artifact.bag_of_tricks.enabled
F 0.00 call_action_list,name=exsang,if=dot.rupture.exsanguinated
G 11.39 rupture,if=talent.exsanguinate.enabled&remains-cooldown.exsanguinate.remains<(4+cp_max_spend*4)*0.3&new_duration-cooldown.exsanguinate.remains>=(4+cp_max_spend*4)*0.3+3
H 0.00 call_action_list,name=finish
I 0.00 call_action_list,name=build
actions.cds Cooldowns
# count action,conditions
0.00 marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|combo_points.deficit>=5
J 4.49 vendetta,if=target.time_to_die<20|buff.maalus.react
0.00 vanish,if=talent.subterfuge.enabled&combo_points<=2&!dot.rupture.exsanguinated|talent.shadow_focus.enabled&!dot.rupture.exsanguinated&combo_points.deficit>=2
actions.exsang_combo Exsanguinate Combo
# count action,conditions
K 4.00 vanish,if=talent.nightstalker.enabled&combo_points>=cp_max_spend&cooldown.exsanguinate.remains<1&gcd.remains=0&energy>=25
L 7.51 rupture,if=combo_points>=cp_max_spend&(!talent.nightstalker.enabled|buff.vanish.up|cooldown.vanish.remains>15)&cooldown.exsanguinate.remains<1
M 7.55 exsanguinate,if=prev_gcd.rupture&dot.rupture.remains>22+4*talent.deeper_stratagem.enabled&cooldown.vanish.remains>10
N 0.00 call_action_list,name=garrote,if=spell_targets.fan_of_knives<=8-artifact.bag_of_tricks.enabled
0.00 hemorrhage,if=spell_targets.fan_of_knives>=2&!ticking
O 0.00 call_action_list,name=build
actions.garrote Garrote
# count action,conditions
0.00 pool_resource,for_next=1
0.00 garrote,cycle_targets=1,if=talent.subterfuge.enabled&!ticking&combo_points.deficit>=1&spell_targets.fan_of_knives>=2
0.00 pool_resource,for_next=1
P 28.77 garrote,if=combo_points.deficit>=1&!exsanguinated
actions.exsang Exsanguinated Finishers
# count action,conditions
0.00 rupture,cycle_targets=1,max_cycle_targets=14-2*artifact.bag_of_tricks.enabled,if=!ticking&combo_points>=cp_max_spend-1&spell_targets.fan_of_knives>1&target.time_to_die-remains>6
Q 1.86 rupture,if=combo_points>=cp_max_spend&ticks_remain<2
0.00 death_from_above,if=combo_points>=cp_max_spend-1&(dot.rupture.remains>3|dot.rupture.remains>2&spell_targets.fan_of_knives>=3)&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6+2*debuff.vendetta.up)
R 13.48 envenom,if=combo_points>=cp_max_spend-1&(dot.rupture.remains>3|dot.rupture.remains>2&spell_targets.fan_of_knives>=3)&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6+2*debuff.vendetta.up)
actions.finish Finishers
# count action,conditions
0.00 rupture,cycle_targets=1,max_cycle_targets=14-2*artifact.bag_of_tricks.enabled,if=!ticking&combo_points>=cp_max_spend-1&spell_targets.fan_of_knives>1&target.time_to_die-remains>6
S 0.00 rupture,if=combo_points>=cp_max_spend-1&refreshable&!exsanguinated
0.00 death_from_above,if=combo_points>=cp_max_spend-1&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6)
T 15.06 envenom,if=combo_points>=cp_max_spend-1&!dot.rupture.refreshable&buff.elaborate_planning.remains<2&energy.deficit<40&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6)
U 2.02 envenom,if=combo_points>=cp_max_spend&!dot.rupture.refreshable&buff.elaborate_planning.remains<2&cooldown.garrote.remains<1&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6)
actions.build Builders
# count action,conditions
0.00 hemorrhage,cycle_targets=1,if=combo_points.deficit>=1&refreshable&dot.rupture.remains>6&spell_targets.fan_of_knives>1&spell_targets.fan_of_knives<=4
0.00 hemorrhage,cycle_targets=1,max_cycle_targets=3,if=combo_points.deficit>=1&refreshable&dot.rupture.remains>6&spell_targets.fan_of_knives>1&spell_targets.fan_of_knives=5
0.00 fan_of_knives,if=(spell_targets>=2+debuff.vendetta.up&(combo_points.deficit>=1|energy.deficit<=30))|(!artifact.bag_of_tricks.enabled&spell_targets>=7+2*debuff.vendetta.up)
0.00 fan_of_knives,if=equipped.the_dreadlords_deceit&((buff.the_dreadlords_deceit.stack>=29|buff.the_dreadlords_deceit.stack>=15&debuff.vendetta.remains<=3)&debuff.vendetta.up|buff.the_dreadlords_deceit.stack>=5&cooldown.vendetta.remains>60&cooldown.vendetta.remains<65)
0.00 hemorrhage,if=(combo_points.deficit>=1&refreshable)|(combo_points.deficit=1&(dot.rupture.exsanguinated&dot.rupture.remains<=2|cooldown.exsanguinate.remains<=2))
V 10.55 mutilate,if=combo_points.deficit<=1&energy.deficit<=30
W 118.04 mutilate,if=combo_points.deficit>=2&cooldown.garrote.remains>2

Sample Sequence

0124569PJWWBWWVKLMCPWWRWWRWWQPWWGWWWUPWWTWWPLMCWWRWWRPWWBWWGWPWTWWTPWWTWGW9J8PWVVVBWPWTWWWUPWGWWWUPWGWWTPWWGWWWUPWWTWWPGWWTWPWTWWW9KLMJCPWWRWWRWWBPWWGWWPTWWLMCWWPRWWRWWBPWWGWWWUPWWTWWUPWGWWWUP9WJWKLMCWWRWWPRWWBWWWGPWWTWWPTWWWLMCPWWRWWRWWBPWWG

Sample Sequence Table

time name target resources buffs
Pre flask Ptitfille 120.0/120: 100% energy | 0.0/6: 0% combo_points
Pre augmentation Ptitfille 120.0/120: 100% energy | 0.0/6: 0% combo_points
Pre food Ptitfille 120.0/120: 100% energy | 0.0/6: 0% combo_points
Pre apply_poison Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points
Pre stealth Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points stealth
Pre potion Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points stealth, potion_of_deadly_grace
0:00.000 use_item_maalus_the_blood_drinker Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points stealth, potion_of_deadly_grace
0:00.000 garrote Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points stealth, maalus, potion_of_deadly_grace
0:01.004 vendetta Fluffy_Pillow 86.0/120: 72% energy | 1.0/6: 17% combo_points bloodlust, maalus, cleansing_flame, potion_of_deadly_grace
0:01.004 mutilate Fluffy_Pillow 120.0/120: 100% energy | 1.0/6: 17% combo_points bloodlust, maalus, cleansing_flame, potion_of_deadly_grace
0:02.009 mutilate Fluffy_Pillow 88.7/120: 74% energy | 3.0/6: 50% combo_points bloodlust, maalus, cleansing_flame, potion_of_deadly_grace
0:03.013 rupture Fluffy_Pillow 47.4/120: 39% energy | 6.0/6: 100% combo_points bloodlust, maalus, cleansing_flame, potion_of_deadly_grace
0:04.015 Waiting 0.700 sec 46.0/120: 38% energy | 0.0/6: 0% combo_points bloodlust, elaborate_planning, maalus, cleansing_flame, potion_of_deadly_grace
0:04.715 mutilate Fluffy_Pillow 55.6/120: 46% energy | 0.0/6: 0% combo_points bloodlust, elaborate_planning, maalus, cleansing_flame, potion_of_deadly_grace
0:05.719 Waiting 1.300 sec 24.3/120: 20% energy | 2.0/6: 33% combo_points bloodlust, elaborate_planning, maalus, cleansing_flame, potion_of_deadly_grace
0:07.019 mutilate Fluffy_Pillow 62.0/120: 52% energy | 2.0/6: 33% combo_points bloodlust, elaborate_planning, maalus, cleansing_flame, potion_of_deadly_grace
0:08.024 Waiting 2.900 sec 30.7/120: 26% energy | 5.0/6: 83% combo_points bloodlust, maalus, cleansing_flame, potion_of_deadly_grace
0:10.924 mutilate Fluffy_Pillow 90.2/120: 75% energy | 5.0/6: 83% combo_points bloodlust, maalus, potion_of_deadly_grace
0:11.928 vanish Fluffy_Pillow 58.9/120: 49% energy | 6.0/6: 100% combo_points bloodlust, maalus, potion_of_deadly_grace
0:11.928 rupture Fluffy_Pillow 58.9/120: 49% energy | 6.0/6: 100% combo_points bloodlust, vanish, maalus, potion_of_deadly_grace
0:12.933 exsanguinate Fluffy_Pillow 57.6/120: 48% energy | 0.0/6: 0% combo_points bloodlust, elaborate_planning, maalus, potion_of_deadly_grace
0:13.938 kingsbane Fluffy_Pillow 91.3/120: 76% energy | 0.0/6: 0% combo_points bloodlust, elaborate_planning, maalus, potion_of_deadly_grace
0:14.941 Waiting 0.600 sec 89.9/120: 75% energy | 0.0/6: 0% combo_points bloodlust, elaborate_planning, maalus, potion_of_deadly_grace
0:15.541 garrote Fluffy_Pillow 118.1/120: 98% energy | 0.0/6: 0% combo_points bloodlust, elaborate_planning, potion_of_deadly_grace
0:16.546 mutilate Fluffy_Pillow 96.8/120: 81% energy | 1.0/6: 17% combo_points bloodlust, elaborate_planning, potion_of_deadly_grace
0:17.550 mutilate Fluffy_Pillow 75.5/120: 63% energy | 3.0/6: 50% combo_points bloodlust, potion_of_deadly_grace
0:18.555 envenom Fluffy_Pillow 44.2/120: 37% energy | 6.0/6: 100% combo_points bloodlust, cleansing_flame, potion_of_deadly_grace
0:19.562 Waiting 0.500 sec 42.9/120: 36% energy | 0.0/6: 0% combo_points bloodlust, envenom, elaborate_planning, cleansing_flame, potion_of_deadly_grace
0:20.062 mutilate Fluffy_Pillow 59.7/120: 50% energy | 0.0/6: 0% combo_points bloodlust, envenom, elaborate_planning, cleansing_flame, potion_of_deadly_grace
0:21.067 Waiting 1.000 sec 28.4/120: 24% energy | 2.0/6: 33% combo_points bloodlust, envenom, elaborate_planning, cleansing_flame, potion_of_deadly_grace
0:22.067 mutilate Fluffy_Pillow 62.1/120: 52% energy | 2.0/6: 33% combo_points bloodlust, envenom, elaborate_planning, cleansing_flame, potion_of_deadly_grace
0:23.070 Waiting 0.400 sec 30.7/120: 26% energy | 6.0/6: 100% combo_points bloodlust, envenom, elaborate_planning, cleansing_flame
0:23.470 envenom Fluffy_Pillow 36.2/120: 30% energy | 6.0/6: 100% combo_points bloodlust, envenom, elaborate_planning, cleansing_flame
0:24.474 Waiting 0.800 sec 34.9/120: 29% energy | 0.0/6: 0% combo_points bloodlust, envenom, elaborate_planning, cleansing_flame
0:25.274 mutilate Fluffy_Pillow 55.8/120: 46% energy | 0.0/6: 0% combo_points bloodlust, envenom, elaborate_planning, cleansing_flame
0:26.276 Waiting 0.800 sec 34.4/120: 29% energy | 3.0/6: 50% combo_points bloodlust, envenom, elaborate_planning, cleansing_flame
0:27.076 mutilate Fluffy_Pillow 55.3/120: 46% energy | 3.0/6: 50% combo_points bloodlust, envenom, elaborate_planning
0:28.082 Waiting 1.600 sec 34.0/120: 28% energy | 6.0/6: 100% combo_points bloodlust, envenom, elaborate_planning
0:29.682 rupture Fluffy_Pillow 75.8/120: 63% energy | 6.0/6: 100% combo_points bloodlust, envenom
0:30.685 garrote Fluffy_Pillow 74.5/120: 62% energy | 0.0/6: 0% combo_points bloodlust, envenom, elaborate_planning
0:31.689 Waiting 0.200 sec 53.2/120: 44% energy | 1.0/6: 17% combo_points bloodlust, envenom, elaborate_planning
0:31.889 mutilate Fluffy_Pillow 55.9/120: 47% energy | 1.0/6: 17% combo_points bloodlust, envenom, elaborate_planning
0:32.894 Waiting 1.100 sec 24.6/120: 21% energy | 3.0/6: 50% combo_points bloodlust, elaborate_planning
0:33.994 mutilate Fluffy_Pillow 59.6/120: 50% energy | 3.0/6: 50% combo_points bloodlust, elaborate_planning
0:35.001 Waiting 0.588 sec 18.3/120: 15% energy | 6.0/6: 100% combo_points bloodlust
0:35.589 rupture Fluffy_Pillow 36.4/120: 30% energy | 6.0/6: 100% combo_points bloodlust
0:36.595 Waiting 1.000 sec 35.1/120: 29% energy | 0.0/6: 0% combo_points bloodlust, elaborate_planning
0:37.595 mutilate Fluffy_Pillow 58.7/120: 49% energy | 0.0/6: 0% combo_points bloodlust, elaborate_planning
0:38.601 Waiting 1.300 sec 27.4/120: 23% energy | 2.0/6: 33% combo_points bloodlust, elaborate_planning
0:39.901 mutilate Fluffy_Pillow 55.1/120: 46% energy | 2.0/6: 33% combo_points bloodlust, elaborate_planning
0:40.905 Waiting 1.100 sec 23.8/120: 20% energy | 4.0/6: 67% combo_points bloodlust
0:42.005 mutilate Fluffy_Pillow 55.5/120: 46% energy | 4.0/6: 67% combo_points
0:43.009 Waiting 1.729 sec 11.1/120: 9% energy | 6.0/6: 100% combo_points
0:44.738 envenom Fluffy_Pillow 49.2/120: 41% energy | 6.0/6: 100% combo_points
0:45.999 garrote Fluffy_Pillow 47.4/120: 40% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
0:47.003 Waiting 2.151 sec 12.9/120: 11% energy | 1.0/6: 17% combo_points envenom, elaborate_planning
0:49.154 mutilate Fluffy_Pillow 55.5/120: 46% energy | 1.0/6: 17% combo_points envenom, elaborate_planning
0:50.158 Waiting 1.400 sec 31.0/120: 26% energy | 3.0/6: 50% combo_points envenom
0:51.558 mutilate Fluffy_Pillow 55.7/120: 46% energy | 3.0/6: 50% combo_points envenom
0:52.562 Waiting 3.061 sec 21.2/120: 18% energy | 5.0/6: 83% combo_points
0:55.623 envenom Fluffy_Pillow 83.3/120: 69% energy | 5.0/6: 83% combo_points
0:56.627 mutilate Fluffy_Pillow 68.8/120: 57% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
0:57.631 Waiting 1.100 sec 34.4/120: 29% energy | 2.0/6: 33% combo_points envenom, elaborate_planning
0:58.731 mutilate Fluffy_Pillow 55.9/120: 47% energy | 2.0/6: 33% combo_points envenom, elaborate_planning
0:59.736 Waiting 1.041 sec 21.4/120: 18% energy | 5.0/6: 83% combo_points envenom, elaborate_planning
1:01.033 garrote Fluffy_Pillow 45.0/120: 38% energy | 5.0/6: 83% combo_points envenom
1:02.038 rupture Fluffy_Pillow 30.6/120: 25% energy | 6.0/6: 100% combo_points
1:03.042 exsanguinate Fluffy_Pillow 16.1/120: 13% energy | 0.0/6: 0% combo_points elaborate_planning
1:04.046 kingsbane Fluffy_Pillow 46.6/120: 39% energy | 0.0/6: 0% combo_points elaborate_planning
1:05.050 Waiting 0.300 sec 42.1/120: 35% energy | 0.0/6: 0% combo_points elaborate_planning
1:05.350 mutilate Fluffy_Pillow 55.3/120: 46% energy | 0.0/6: 0% combo_points elaborate_planning
1:06.354 Waiting 1.000 sec 30.8/120: 26% energy | 2.0/6: 33% combo_points elaborate_planning
1:07.354 mutilate Fluffy_Pillow 61.3/120: 51% energy | 2.0/6: 33% combo_points
1:08.359 envenom Fluffy_Pillow 36.8/120: 31% energy | 5.0/6: 83% combo_points
1:09.363 Waiting 1.000 sec 32.3/120: 27% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
1:10.363 mutilate Fluffy_Pillow 62.8/120: 52% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
1:11.369 Waiting 0.700 sec 38.4/120: 32% energy | 2.0/6: 33% combo_points envenom, elaborate_planning
1:12.069 mutilate Fluffy_Pillow 55.7/120: 46% energy | 2.0/6: 33% combo_points envenom, elaborate_planning
1:13.075 Waiting 0.300 sec 31.3/120: 26% energy | 5.0/6: 83% combo_points envenom, elaborate_planning
1:13.375 envenom Fluffy_Pillow 44.4/120: 37% energy | 5.0/6: 83% combo_points envenom
1:14.381 Waiting 1.500 sec 40.0/120: 33% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
1:15.881 garrote Fluffy_Pillow 75.7/120: 63% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, cleansing_flame
1:17.038 Waiting 0.300 sec 52.8/120: 44% energy | 1.0/6: 17% combo_points envenom, elaborate_planning, cleansing_flame
1:17.338 mutilate Fluffy_Pillow 56.0/120: 47% energy | 1.0/6: 17% combo_points envenom, elaborate_planning, cleansing_flame
1:18.342 Waiting 1.200 sec 31.5/120: 26% energy | 3.0/6: 50% combo_points envenom, elaborate_planning, cleansing_flame
1:19.542 mutilate Fluffy_Pillow 64.1/120: 53% energy | 3.0/6: 50% combo_points envenom, cleansing_flame
1:20.546 Waiting 0.200 sec 39.6/120: 33% energy | 5.0/6: 83% combo_points
1:20.746 rupture Fluffy_Pillow 51.7/120: 43% energy | 5.0/6: 83% combo_points
1:21.751 Waiting 0.800 sec 37.2/120: 31% energy | 0.0/6: 0% combo_points elaborate_planning
1:22.551 mutilate Fluffy_Pillow 55.6/120: 46% energy | 0.0/6: 0% combo_points elaborate_planning
1:23.556 Waiting 1.368 sec 21.1/120: 18% energy | 2.0/6: 33% combo_points elaborate_planning
1:24.924 mutilate Fluffy_Pillow 55.5/120: 46% energy | 2.0/6: 33% combo_points elaborate_planning
1:25.929 Waiting 1.333 sec 11.0/120: 9% energy | 6.0/6: 100% combo_points
1:27.262 rupture Fluffy_Pillow 45.0/120: 37% energy | 6.0/6: 100% combo_points
1:28.267 Waiting 0.500 sec 40.5/120: 34% energy | 0.0/6: 0% combo_points elaborate_planning
1:28.767 mutilate Fluffy_Pillow 55.8/120: 46% energy | 0.0/6: 0% combo_points elaborate_planning
1:29.769 Waiting 1.309 sec 11.3/120: 9% energy | 2.0/6: 33% combo_points elaborate_planning
1:31.335 garrote Fluffy_Pillow 47.7/120: 40% energy | 2.0/6: 33% combo_points elaborate_planning
1:32.340 Waiting 1.768 sec 23.2/120: 19% energy | 3.0/6: 50% combo_points
1:34.108 mutilate Fluffy_Pillow 61.8/120: 51% energy | 3.0/6: 50% combo_points
1:35.112 Waiting 3.000 sec 27.3/120: 23% energy | 6.0/6: 100% combo_points
1:38.112 envenom Fluffy_Pillow 88.7/120: 74% energy | 6.0/6: 100% combo_points
1:39.119 mutilate Fluffy_Pillow 74.3/120: 62% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
1:40.121 Waiting 0.700 sec 39.8/120: 33% energy | 2.0/6: 33% combo_points envenom, elaborate_planning
1:40.821 mutilate Fluffy_Pillow 57.1/120: 48% energy | 2.0/6: 33% combo_points envenom, elaborate_planning
1:41.826 Waiting 2.975 sec 12.7/120: 11% energy | 5.0/6: 83% combo_points envenom, elaborate_planning
1:44.801 envenom Fluffy_Pillow 83.9/120: 70% energy | 5.0/6: 83% combo_points envenom
1:45.805 Waiting 0.300 sec 59.4/120: 49% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
1:46.105 garrote Fluffy_Pillow 72.5/120: 60% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
1:47.339 Waiting 0.500 sec 50.5/120: 42% energy | 1.0/6: 17% combo_points envenom, elaborate_planning
1:47.839 mutilate Fluffy_Pillow 55.7/120: 46% energy | 1.0/6: 17% combo_points envenom, elaborate_planning
1:48.844 Waiting 1.400 sec 31.3/120: 26% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
1:50.244 mutilate Fluffy_Pillow 55.9/120: 47% energy | 3.0/6: 50% combo_points envenom
1:51.247 Waiting 2.839 sec 21.4/120: 18% energy | 6.0/6: 100% combo_points
1:54.086 envenom Fluffy_Pillow 81.2/120: 68% energy | 6.0/6: 100% combo_points cleansing_flame
1:55.091 mutilate Fluffy_Pillow 66.7/120: 56% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, cleansing_flame
1:56.095 rupture Fluffy_Pillow 32.3/120: 27% energy | 2.0/6: 33% combo_points envenom, elaborate_planning, cleansing_flame
1:57.099 Waiting 1.700 sec 27.8/120: 23% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, cleansing_flame
1:58.799 mutilate Fluffy_Pillow 65.6/120: 55% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
1:59.804 use_item_maalus_the_blood_drinker Fluffy_Pillow 21.2/120: 18% energy | 2.0/6: 33% combo_points envenom, elaborate_planning
2:00.000 Waiting 0.970 sec 23.2/120: 19% energy | 2.0/6: 33% combo_points envenom, elaborate_planning, maalus
2:00.970 vendetta Fluffy_Pillow 53.4/120: 44% energy | 2.0/6: 33% combo_points envenom, elaborate_planning, maalus
2:00.970 potion Fluffy_Pillow 120.0/120: 100% energy | 2.0/6: 33% combo_points envenom, elaborate_planning, maalus
2:00.970 Waiting 0.200 sec 120.0/120: 100% energy | 2.0/6: 33% combo_points envenom, elaborate_planning, maalus, potion_of_deadly_grace
2:01.170 garrote Fluffy_Pillow 120.0/120: 100% energy | 2.0/6: 33% combo_points maalus, potion_of_deadly_grace
2:02.340 mutilate Fluffy_Pillow 95.5/120: 80% energy | 3.0/6: 50% combo_points maalus, potion_of_deadly_grace
2:03.344 Waiting 1.500 sec 61.1/120: 51% energy | 6.0/6: 100% combo_points maalus, potion_of_deadly_grace
2:04.844 mutilate Fluffy_Pillow 96.8/120: 81% energy | 6.0/6: 100% combo_points maalus, potion_of_deadly_grace
2:05.849 Waiting 1.700 sec 52.3/120: 44% energy | 6.0/6: 100% combo_points maalus, potion_of_deadly_grace
2:07.549 mutilate Fluffy_Pillow 90.1/120: 75% energy | 6.0/6: 100% combo_points maalus, potion_of_deadly_grace
2:08.553 Waiting 1.500 sec 55.7/120: 46% energy | 6.0/6: 100% combo_points maalus, potion_of_deadly_grace
2:10.053 mutilate Fluffy_Pillow 91.4/120: 76% energy | 6.0/6: 100% combo_points maalus, potion_of_deadly_grace
2:11.058 Waiting 0.700 sec 56.9/120: 47% energy | 6.0/6: 100% combo_points maalus, potion_of_deadly_grace
2:11.758 rupture Fluffy_Pillow 74.3/120: 62% energy | 6.0/6: 100% combo_points maalus, potion_of_deadly_grace
2:12.763 mutilate Fluffy_Pillow 69.8/120: 58% energy | 0.0/6: 0% combo_points elaborate_planning, maalus, potion_of_deadly_grace
2:13.767 Waiting 2.400 sec 35.3/120: 29% energy | 2.0/6: 33% combo_points elaborate_planning, maalus, potion_of_deadly_grace
2:16.167 garrote Fluffy_Pillow 90.5/120: 75% energy | 2.0/6: 33% combo_points elaborate_planning, potion_of_deadly_grace
2:17.338 mutilate Fluffy_Pillow 57.8/120: 48% energy | 3.0/6: 50% combo_points potion_of_deadly_grace
2:18.345 Waiting 2.600 sec 33.3/120: 28% energy | 5.0/6: 83% combo_points potion_of_deadly_grace
2:20.945 envenom Fluffy_Pillow 80.6/120: 67% energy | 5.0/6: 83% combo_points potion_of_deadly_grace
2:21.950 mutilate Fluffy_Pillow 66.1/120: 55% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, potion_of_deadly_grace
2:22.954 Waiting 1.100 sec 31.6/120: 26% energy | 2.0/6: 33% combo_points envenom, elaborate_planning, potion_of_deadly_grace
2:24.054 mutilate Fluffy_Pillow 63.2/120: 53% energy | 2.0/6: 33% combo_points envenom, elaborate_planning, potion_of_deadly_grace
2:25.059 Waiting 1.599 sec 18.7/120: 16% energy | 4.0/6: 67% combo_points envenom, elaborate_planning, potion_of_deadly_grace
2:26.658 mutilate Fluffy_Pillow 55.5/120: 46% energy | 4.0/6: 67% combo_points envenom, cleansing_flame
2:27.662 Waiting 2.735 sec 11.0/120: 9% energy | 6.0/6: 100% combo_points cleansing_flame
2:30.397 envenom Fluffy_Pillow 79.7/120: 66% energy | 6.0/6: 100% combo_points cleansing_flame
2:31.401 garrote Fluffy_Pillow 55.2/120: 46% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
2:32.404 Waiting 1.400 sec 40.7/120: 34% energy | 1.0/6: 17% combo_points envenom, elaborate_planning
2:33.804 mutilate Fluffy_Pillow 65.4/120: 54% energy | 1.0/6: 17% combo_points envenom, elaborate_planning
2:34.810 rupture Fluffy_Pillow 30.9/120: 26% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
2:35.813 Waiting 1.800 sec 26.5/120: 22% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
2:37.613 mutilate Fluffy_Pillow 55.3/120: 46% energy | 0.0/6: 0% combo_points elaborate_planning
2:38.617 Waiting 1.400 sec 30.9/120: 26% energy | 2.0/6: 33% combo_points elaborate_planning
2:40.017 mutilate Fluffy_Pillow 55.5/120: 46% energy | 2.0/6: 33% combo_points
2:41.022 Waiting 1.375 sec 21.1/120: 18% energy | 4.0/6: 67% combo_points
2:42.397 mutilate Fluffy_Pillow 55.5/120: 46% energy | 4.0/6: 67% combo_points
2:43.402 Waiting 2.033 sec 11.0/120: 9% energy | 6.0/6: 100% combo_points
2:45.435 envenom Fluffy_Pillow 52.3/120: 44% energy | 6.0/6: 100% combo_points
2:46.441 garrote Fluffy_Pillow 47.9/120: 40% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
2:47.445 Waiting 2.106 sec 13.4/120: 11% energy | 1.0/6: 17% combo_points envenom, elaborate_planning
2:49.551 mutilate Fluffy_Pillow 55.5/120: 46% energy | 1.0/6: 17% combo_points envenom, elaborate_planning
2:50.554 rupture Fluffy_Pillow 31.0/120: 26% energy | 4.0/6: 67% combo_points envenom
2:51.560 Waiting 1.806 sec 16.5/120: 14% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
2:53.366 mutilate Fluffy_Pillow 55.5/120: 46% energy | 0.0/6: 0% combo_points elaborate_planning
2:54.369 Waiting 1.400 sec 31.0/120: 26% energy | 3.0/6: 50% combo_points elaborate_planning
2:55.769 mutilate Fluffy_Pillow 55.7/120: 46% energy | 3.0/6: 50% combo_points
2:56.775 Waiting 3.060 sec 21.2/120: 18% energy | 6.0/6: 100% combo_points
2:59.835 envenom Fluffy_Pillow 83.3/120: 69% energy | 6.0/6: 100% combo_points
3:00.840 Waiting 0.400 sec 68.8/120: 57% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
3:01.240 garrote Fluffy_Pillow 73.0/120: 61% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
3:02.446 mutilate Fluffy_Pillow 60.7/120: 51% energy | 1.0/6: 17% combo_points envenom, elaborate_planning
3:03.451 Waiting 1.838 sec 16.2/120: 14% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
3:05.289 mutilate Fluffy_Pillow 55.5/120: 46% energy | 3.0/6: 50% combo_points envenom
3:06.292 Waiting 1.000 sec 31.0/120: 26% energy | 6.0/6: 100% combo_points envenom
3:07.292 rupture Fluffy_Pillow 41.5/120: 35% energy | 6.0/6: 100% combo_points
3:08.298 Waiting 0.800 sec 47.0/120: 39% energy | 0.0/6: 0% combo_points elaborate_planning
3:09.098 mutilate Fluffy_Pillow 55.4/120: 46% energy | 0.0/6: 0% combo_points elaborate_planning
3:10.102 Waiting 1.700 sec 30.9/120: 26% energy | 2.0/6: 33% combo_points elaborate_planning
3:11.802 mutilate Fluffy_Pillow 58.8/120: 49% energy | 2.0/6: 33% combo_points elaborate_planning, cleansing_flame
3:12.806 Waiting 1.300 sec 24.3/120: 20% energy | 4.0/6: 67% combo_points cleansing_flame
3:14.106 mutilate Fluffy_Pillow 57.9/120: 48% energy | 4.0/6: 67% combo_points cleansing_flame
3:15.110 Waiting 1.103 sec 13.4/120: 11% energy | 6.0/6: 100% combo_points cleansing_flame
3:16.213 envenom Fluffy_Pillow 45.0/120: 37% energy | 6.0/6: 100% combo_points
3:18.236 garrote Fluffy_Pillow 51.2/120: 43% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
3:19.241 Waiting 1.787 sec 16.7/120: 14% energy | 1.0/6: 17% combo_points envenom, elaborate_planning
3:21.028 mutilate Fluffy_Pillow 55.5/120: 46% energy | 1.0/6: 17% combo_points envenom, elaborate_planning
3:22.032 Waiting 1.781 sec 21.0/120: 18% energy | 3.0/6: 50% combo_points envenom
3:23.813 mutilate Fluffy_Pillow 59.7/120: 50% energy | 3.0/6: 50% combo_points
3:24.818 Waiting 3.000 sec 25.2/120: 21% energy | 6.0/6: 100% combo_points
3:27.818 envenom Fluffy_Pillow 86.7/120: 72% energy | 6.0/6: 100% combo_points
3:28.823 mutilate Fluffy_Pillow 72.2/120: 60% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
3:29.826 Waiting 0.700 sec 37.7/120: 31% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
3:30.526 mutilate Fluffy_Pillow 55.1/120: 46% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
3:31.531 Waiting 1.474 sec 10.6/120: 9% energy | 5.0/6: 83% combo_points envenom, elaborate_planning, cleansing_flame
3:33.005 garrote Fluffy_Pillow 46.0/120: 38% energy | 5.0/6: 83% combo_points envenom, cleansing_flame
3:34.240 Waiting 1.000 sec 34.0/120: 28% energy | 6.0/6: 100% combo_points envenom, cleansing_flame
3:35.240 rupture Fluffy_Pillow 44.5/120: 37% energy | 6.0/6: 100% combo_points cleansing_flame
3:36.245 Waiting 0.500 sec 50.0/120: 42% energy | 0.0/6: 0% combo_points elaborate_planning, cleansing_flame
3:36.745 mutilate Fluffy_Pillow 55.2/120: 46% energy | 0.0/6: 0% combo_points elaborate_planning, cleansing_flame
3:37.748 Waiting 2.057 sec 10.8/120: 9% energy | 2.0/6: 33% combo_points elaborate_planning, cleansing_flame
3:39.805 mutilate Fluffy_Pillow 62.3/120: 52% energy | 2.0/6: 33% combo_points elaborate_planning
3:40.811 Waiting 3.000 sec 27.9/120: 23% energy | 5.0/6: 83% combo_points
3:43.811 envenom Fluffy_Pillow 89.3/120: 74% energy | 5.0/6: 83% combo_points
3:44.816 mutilate Fluffy_Pillow 74.9/120: 62% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
3:45.820 Waiting 2.200 sec 40.4/120: 34% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
3:48.020 garrote Fluffy_Pillow 83.5/120: 70% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
3:49.241 mutilate Fluffy_Pillow 61.3/120: 51% energy | 4.0/6: 67% combo_points envenom
3:50.244 Waiting 2.300 sec 36.8/120: 31% energy | 6.0/6: 100% combo_points
3:52.544 envenom Fluffy_Pillow 80.9/120: 67% energy | 6.0/6: 100% combo_points
3:53.548 mutilate Fluffy_Pillow 56.4/120: 47% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
3:54.552 Waiting 1.300 sec 31.9/120: 27% energy | 2.0/6: 33% combo_points envenom, elaborate_planning
3:55.852 mutilate Fluffy_Pillow 55.6/120: 46% energy | 2.0/6: 33% combo_points envenom, elaborate_planning
3:56.855 Waiting 1.374 sec 21.1/120: 18% energy | 4.0/6: 67% combo_points envenom, elaborate_planning, cleansing_flame
3:58.229 mutilate Fluffy_Pillow 55.5/120: 46% energy | 4.0/6: 67% combo_points envenom, cleansing_flame
3:59.234 Waiting 1.333 sec 11.0/120: 9% energy | 6.0/6: 100% combo_points envenom, cleansing_flame
4:00.567 use_item_maalus_the_blood_drinker Fluffy_Pillow 45.0/120: 37% energy | 6.0/6: 100% combo_points cleansing_flame
4:00.567 vanish Fluffy_Pillow 45.0/120: 37% energy | 6.0/6: 100% combo_points maalus, cleansing_flame
4:00.567 rupture Fluffy_Pillow 45.0/120: 37% energy | 6.0/6: 100% combo_points vanish, maalus, cleansing_flame
4:01.574 exsanguinate Fluffy_Pillow 30.5/120: 25% energy | 0.0/6: 0% combo_points elaborate_planning, maalus
4:02.578 vendetta Fluffy_Pillow 61.1/120: 51% energy | 0.0/6: 0% combo_points elaborate_planning, maalus
4:02.578 kingsbane Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points elaborate_planning, maalus
4:03.582 Waiting 3.100 sec 115.5/120: 96% energy | 0.0/6: 0% combo_points elaborate_planning, maalus
4:06.682 garrote Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points maalus
4:07.688 mutilate Fluffy_Pillow 95.5/120: 80% energy | 1.0/6: 17% combo_points maalus, cleansing_flame
4:08.695 mutilate Fluffy_Pillow 71.1/120: 59% energy | 4.0/6: 67% combo_points maalus, cleansing_flame
4:09.700 envenom Fluffy_Pillow 36.6/120: 31% energy | 6.0/6: 100% combo_points maalus, cleansing_flame
4:10.704 Waiting 1.300 sec 32.2/120: 27% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, maalus, cleansing_flame
4:12.004 mutilate Fluffy_Pillow 55.8/120: 46% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, maalus, cleansing_flame
4:13.008 Waiting 1.400 sec 31.3/120: 26% energy | 3.0/6: 50% combo_points envenom, elaborate_planning, maalus
4:14.408 mutilate Fluffy_Pillow 56.0/120: 47% energy | 3.0/6: 50% combo_points envenom, elaborate_planning, maalus
4:15.413 Waiting 0.300 sec 31.5/120: 26% energy | 6.0/6: 100% combo_points envenom, maalus
4:15.713 envenom Fluffy_Pillow 44.7/120: 37% energy | 6.0/6: 100% combo_points envenom
4:16.718 Waiting 1.000 sec 40.2/120: 34% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
4:17.718 mutilate Fluffy_Pillow 60.7/120: 51% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
4:18.722 Waiting 0.900 sec 36.2/120: 30% energy | 2.0/6: 33% combo_points envenom, elaborate_planning
4:19.622 mutilate Fluffy_Pillow 55.7/120: 46% energy | 2.0/6: 33% combo_points envenom, elaborate_planning
4:20.626 Waiting 1.317 sec 11.2/120: 9% energy | 5.0/6: 83% combo_points envenom, elaborate_planning
4:21.943 rupture Fluffy_Pillow 35.0/120: 29% energy | 5.0/6: 83% combo_points envenom
4:23.972 garrote Fluffy_Pillow 51.3/120: 43% energy | 0.0/6: 0% combo_points elaborate_planning
4:24.976 Waiting 1.800 sec 26.8/120: 22% energy | 1.0/6: 17% combo_points elaborate_planning
4:26.776 mutilate Fluffy_Pillow 65.7/120: 55% energy | 1.0/6: 17% combo_points elaborate_planning, cleansing_flame
4:27.780 Waiting 1.363 sec 21.2/120: 18% energy | 4.0/6: 67% combo_points cleansing_flame
4:29.143 mutilate Fluffy_Pillow 55.5/120: 46% energy | 4.0/6: 67% combo_points cleansing_flame
4:30.148 Waiting 0.480 sec 21.0/120: 18% energy | 6.0/6: 100% combo_points cleansing_flame
4:30.628 rupture Fluffy_Pillow 26.0/120: 22% energy | 6.0/6: 100% combo_points
4:31.633 Waiting 1.326 sec 21.6/120: 18% energy | 0.0/6: 0% combo_points elaborate_planning
4:32.959 mutilate Fluffy_Pillow 55.5/120: 46% energy | 0.0/6: 0% combo_points elaborate_planning
4:33.963 Waiting 1.981 sec 21.0/120: 18% energy | 3.0/6: 50% combo_points elaborate_planning
4:35.944 mutilate Fluffy_Pillow 61.8/120: 51% energy | 3.0/6: 50% combo_points
4:36.948 Waiting 1.800 sec 27.3/120: 23% energy | 5.0/6: 83% combo_points
4:38.748 garrote Fluffy_Pillow 66.2/120: 55% energy | 5.0/6: 83% combo_points
4:39.977 Waiting 2.000 sec 44.1/120: 37% energy | 6.0/6: 100% combo_points
4:41.977 envenom Fluffy_Pillow 85.0/120: 71% energy | 6.0/6: 100% combo_points
4:42.982 mutilate Fluffy_Pillow 70.6/120: 59% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
4:43.988 Waiting 0.900 sec 36.1/120: 30% energy | 4.0/6: 67% combo_points envenom, elaborate_planning
4:44.888 mutilate Fluffy_Pillow 55.5/120: 46% energy | 4.0/6: 67% combo_points envenom, elaborate_planning
4:45.894 Waiting 1.327 sec 11.1/120: 9% energy | 6.0/6: 100% combo_points envenom, elaborate_planning
4:47.221 rupture Fluffy_Pillow 45.0/120: 37% energy | 6.0/6: 100% combo_points envenom
4:48.226 exsanguinate Fluffy_Pillow 40.5/120: 34% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
4:49.231 kingsbane Fluffy_Pillow 71.1/120: 59% energy | 0.0/6: 0% combo_points elaborate_planning
4:50.235 mutilate Fluffy_Pillow 66.6/120: 55% energy | 0.0/6: 0% combo_points elaborate_planning
4:51.239 Waiting 0.300 sec 42.1/120: 35% energy | 2.0/6: 33% combo_points elaborate_planning
4:51.539 mutilate Fluffy_Pillow 55.3/120: 46% energy | 2.0/6: 33% combo_points elaborate_planning
4:52.545 Waiting 2.000 sec 30.8/120: 26% energy | 4.0/6: 67% combo_points
4:54.545 garrote Fluffy_Pillow 91.8/120: 76% energy | 4.0/6: 67% combo_points
4:55.549 envenom Fluffy_Pillow 67.3/120: 56% energy | 5.0/6: 83% combo_points cleansing_flame
4:56.552 mutilate Fluffy_Pillow 62.8/120: 52% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, cleansing_flame
4:57.558 Waiting 1.000 sec 28.4/120: 24% energy | 2.0/6: 33% combo_points envenom, elaborate_planning, cleansing_flame
4:58.558 mutilate Fluffy_Pillow 58.9/120: 49% energy | 2.0/6: 33% combo_points envenom, elaborate_planning, cleansing_flame
4:59.562 Waiting 0.600 sec 24.4/120: 20% energy | 5.0/6: 83% combo_points envenom, elaborate_planning, cleansing_flame
5:00.162 envenom Fluffy_Pillow 40.7/120: 34% energy | 5.0/6: 83% combo_points envenom, elaborate_planning, cleansing_flame
5:01.166 Waiting 1.000 sec 36.2/120: 30% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
5:02.166 mutilate Fluffy_Pillow 56.7/120: 47% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
5:03.172 Waiting 1.300 sec 32.2/120: 27% energy | 2.0/6: 33% combo_points envenom, elaborate_planning
5:04.472 mutilate Fluffy_Pillow 55.9/120: 47% energy | 2.0/6: 33% combo_points envenom, elaborate_planning
5:05.476 Waiting 0.500 sec 31.4/120: 26% energy | 5.0/6: 83% combo_points envenom
5:05.976 rupture Fluffy_Pillow 46.6/120: 39% energy | 5.0/6: 83% combo_points envenom
5:06.980 Waiting 2.400 sec 42.1/120: 35% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
5:09.380 garrote Fluffy_Pillow 87.3/120: 73% energy | 0.0/6: 0% combo_points elaborate_planning
5:10.550 mutilate Fluffy_Pillow 74.6/120: 62% energy | 1.0/6: 17% combo_points elaborate_planning
5:11.556 Waiting 1.000 sec 30.1/120: 25% energy | 4.0/6: 67% combo_points
5:12.556 mutilate Fluffy_Pillow 60.6/120: 51% energy | 4.0/6: 67% combo_points
5:13.561 Waiting 0.845 sec 16.1/120: 13% energy | 6.0/6: 100% combo_points
5:14.406 rupture Fluffy_Pillow 35.0/120: 29% energy | 6.0/6: 100% combo_points
5:15.410 Waiting 1.200 sec 30.5/120: 25% energy | 0.0/6: 0% combo_points elaborate_planning
5:16.610 mutilate Fluffy_Pillow 63.1/120: 53% energy | 0.0/6: 0% combo_points elaborate_planning
5:17.615 Waiting 1.606 sec 18.6/120: 16% energy | 2.0/6: 33% combo_points elaborate_planning
5:19.221 mutilate Fluffy_Pillow 55.5/120: 46% energy | 2.0/6: 33% combo_points elaborate_planning
5:20.225 Waiting 1.781 sec 21.0/120: 18% energy | 4.0/6: 67% combo_points
5:22.006 mutilate Fluffy_Pillow 59.7/120: 50% energy | 4.0/6: 67% combo_points
5:23.011 Waiting 1.000 sec 25.2/120: 21% energy | 6.0/6: 100% combo_points
5:24.011 envenom Fluffy_Pillow 45.7/120: 38% energy | 6.0/6: 100% combo_points
5:26.037 garrote Fluffy_Pillow 51.9/120: 43% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
5:27.043 Waiting 1.600 sec 27.5/120: 23% energy | 1.0/6: 17% combo_points envenom, elaborate_planning
5:28.643 mutilate Fluffy_Pillow 64.3/120: 54% energy | 1.0/6: 17% combo_points envenom, elaborate_planning
5:29.647 Waiting 1.497 sec 19.8/120: 16% energy | 3.0/6: 50% combo_points envenom
5:31.144 mutilate Fluffy_Pillow 55.5/120: 46% energy | 3.0/6: 50% combo_points
5:32.150 Waiting 2.779 sec 21.0/120: 18% energy | 6.0/6: 100% combo_points
5:34.929 envenom Fluffy_Pillow 80.2/120: 67% energy | 6.0/6: 100% combo_points cleansing_flame
5:35.934 mutilate Fluffy_Pillow 55.7/120: 46% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, cleansing_flame
5:36.939 Waiting 1.400 sec 31.2/120: 26% energy | 3.0/6: 50% combo_points envenom, elaborate_planning, cleansing_flame
5:38.339 mutilate Fluffy_Pillow 55.9/120: 47% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
5:39.344 Waiting 0.739 sec 21.4/120: 18% energy | 6.0/6: 100% combo_points envenom, elaborate_planning
5:40.083 envenom Fluffy_Pillow 39.2/120: 33% energy | 6.0/6: 100% combo_points envenom
5:42.107 garrote Fluffy_Pillow 45.4/120: 38% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
5:43.114 Waiting 1.485 sec 21.0/120: 17% energy | 1.0/6: 17% combo_points envenom, elaborate_planning
5:44.599 mutilate Fluffy_Pillow 56.5/120: 47% energy | 1.0/6: 17% combo_points envenom, elaborate_planning
5:45.603 Waiting 1.234 sec 12.1/120: 10% energy | 3.0/6: 50% combo_points envenom
5:46.837 rupture Fluffy_Pillow 45.0/120: 37% energy | 3.0/6: 50% combo_points envenom
5:47.842 Waiting 0.800 sec 30.5/120: 25% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
5:48.642 mutilate Fluffy_Pillow 58.9/120: 49% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
5:49.648 Waiting 2.005 sec 14.5/120: 12% energy | 2.0/6: 33% combo_points elaborate_planning
5:51.653 mutilate Fluffy_Pillow 55.5/120: 46% energy | 2.0/6: 33% combo_points elaborate_planning
5:52.658 Waiting 1.400 sec 31.0/120: 26% energy | 4.0/6: 67% combo_points
5:54.058 mutilate Fluffy_Pillow 55.7/120: 46% energy | 4.0/6: 67% combo_points
5:55.062 Waiting 1.060 sec 21.2/120: 18% energy | 6.0/6: 100% combo_points
5:56.122 envenom Fluffy_Pillow 42.3/120: 35% energy | 6.0/6: 100% combo_points cleansing_flame
5:58.149 garrote Fluffy_Pillow 48.6/120: 40% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, cleansing_flame
5:59.152 Waiting 1.200 sec 24.1/120: 20% energy | 1.0/6: 17% combo_points envenom, elaborate_planning, cleansing_flame
6:00.352 use_item_maalus_the_blood_drinker Fluffy_Pillow 46.7/120: 39% energy | 1.0/6: 17% combo_points envenom, elaborate_planning, cleansing_flame
6:00.567 mutilate Fluffy_Pillow 58.9/120: 49% energy | 1.0/6: 17% combo_points envenom, elaborate_planning, maalus
6:01.571 vendetta Fluffy_Pillow 14.5/120: 12% energy | 4.0/6: 67% combo_points envenom, maalus
6:01.571 mutilate Fluffy_Pillow 120.0/120: 100% energy | 4.0/6: 67% combo_points envenom, maalus
6:02.577 vanish Fluffy_Pillow 95.5/120: 80% energy | 6.0/6: 100% combo_points envenom, maalus
6:02.577 rupture Fluffy_Pillow 95.5/120: 80% energy | 6.0/6: 100% combo_points vanish, envenom, maalus
6:03.582 exsanguinate Fluffy_Pillow 81.1/120: 68% energy | 0.0/6: 0% combo_points elaborate_planning, maalus
6:04.585 kingsbane Fluffy_Pillow 111.6/120: 93% energy | 0.0/6: 0% combo_points elaborate_planning, maalus
6:05.589 mutilate Fluffy_Pillow 107.1/120: 89% energy | 0.0/6: 0% combo_points elaborate_planning, maalus
6:06.595 mutilate Fluffy_Pillow 82.7/120: 69% energy | 3.0/6: 50% combo_points elaborate_planning, maalus
6:07.600 envenom Fluffy_Pillow 58.2/120: 49% energy | 5.0/6: 83% combo_points maalus
6:08.604 Waiting 0.200 sec 53.7/120: 45% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, maalus
6:08.804 mutilate Fluffy_Pillow 65.8/120: 55% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, maalus
6:09.808 Waiting 0.400 sec 41.4/120: 34% energy | 2.0/6: 33% combo_points envenom, elaborate_planning, maalus
6:10.208 mutilate Fluffy_Pillow 55.5/120: 46% energy | 2.0/6: 33% combo_points envenom, elaborate_planning, maalus
6:11.214 Waiting 1.700 sec 31.1/120: 26% energy | 4.0/6: 67% combo_points envenom, elaborate_planning, maalus
6:12.914 garrote Fluffy_Pillow 88.9/120: 74% energy | 4.0/6: 67% combo_points envenom, maalus
6:14.154 envenom Fluffy_Pillow 66.9/120: 56% energy | 5.0/6: 83% combo_points maalus
6:15.160 mutilate Fluffy_Pillow 62.5/120: 52% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, maalus
6:16.165 Waiting 1.000 sec 28.0/120: 23% energy | 2.0/6: 33% combo_points envenom, elaborate_planning
6:17.165 mutilate Fluffy_Pillow 58.5/120: 49% energy | 2.0/6: 33% combo_points envenom, elaborate_planning
6:18.169 Waiting 1.100 sec 24.0/120: 20% energy | 4.0/6: 67% combo_points envenom, elaborate_planning
6:19.269 rupture Fluffy_Pillow 65.5/120: 55% energy | 4.0/6: 67% combo_points envenom
6:20.272 Waiting 0.400 sec 51.1/120: 43% energy | 0.0/6: 0% combo_points elaborate_planning
6:20.672 mutilate Fluffy_Pillow 55.2/120: 46% energy | 0.0/6: 0% combo_points elaborate_planning, cleansing_flame
6:21.676 Waiting 1.500 sec 30.8/120: 26% energy | 2.0/6: 33% combo_points elaborate_planning, cleansing_flame
6:23.176 mutilate Fluffy_Pillow 56.5/120: 47% energy | 2.0/6: 33% combo_points elaborate_planning, cleansing_flame
6:24.182 Waiting 1.281 sec 22.0/120: 18% energy | 4.0/6: 67% combo_points elaborate_planning, cleansing_flame
6:25.463 mutilate Fluffy_Pillow 55.5/120: 46% energy | 4.0/6: 67% combo_points cleansing_flame
6:26.467 Waiting 1.335 sec 11.0/120: 9% energy | 6.0/6: 100% combo_points
6:27.802 rupture Fluffy_Pillow 45.0/120: 37% energy | 6.0/6: 100% combo_points
6:29.320 garrote Fluffy_Pillow 55.9/120: 47% energy | 0.0/6: 0% combo_points elaborate_planning
6:30.324 Waiting 1.339 sec 21.4/120: 18% energy | 1.0/6: 17% combo_points elaborate_planning
6:31.663 mutilate Fluffy_Pillow 55.5/120: 46% energy | 1.0/6: 17% combo_points elaborate_planning
6:32.667 Waiting 2.335 sec 11.0/120: 9% energy | 4.0/6: 67% combo_points elaborate_planning
6:35.002 mutilate Fluffy_Pillow 55.5/120: 46% energy | 4.0/6: 67% combo_points cleansing_flame
6:36.005 Waiting 2.800 sec 31.0/120: 26% energy | 6.0/6: 100% combo_points cleansing_flame
6:38.805 envenom Fluffy_Pillow 80.3/120: 67% energy | 6.0/6: 100% combo_points cleansing_flame
6:39.810 mutilate Fluffy_Pillow 75.9/120: 63% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
6:40.814 Waiting 0.500 sec 31.4/120: 26% energy | 2.0/6: 33% combo_points envenom, elaborate_planning
6:41.314 mutilate Fluffy_Pillow 56.7/120: 47% energy | 2.0/6: 33% combo_points envenom, elaborate_planning
6:42.320 Waiting 1.820 sec 12.2/120: 10% energy | 4.0/6: 67% combo_points envenom, elaborate_planning
6:44.140 garrote Fluffy_Pillow 51.3/120: 43% energy | 4.0/6: 67% combo_points envenom
6:45.325 Waiting 2.100 sec 38.7/120: 32% energy | 5.0/6: 83% combo_points envenom
6:47.425 envenom Fluffy_Pillow 80.7/120: 67% energy | 5.0/6: 83% combo_points
6:48.430 mutilate Fluffy_Pillow 56.3/120: 47% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
6:49.435 Waiting 1.800 sec 31.8/120: 26% energy | 2.0/6: 33% combo_points envenom, elaborate_planning
6:51.235 mutilate Fluffy_Pillow 60.7/120: 51% energy | 2.0/6: 33% combo_points envenom, elaborate_planning
6:52.240 Waiting 1.100 sec 26.2/120: 22% energy | 4.0/6: 67% combo_points envenom, elaborate_planning
6:53.340 mutilate Fluffy_Pillow 57.7/120: 48% energy | 4.0/6: 67% combo_points envenom
6:54.343 Waiting 1.121 sec 13.2/120: 11% energy | 6.0/6: 100% combo_points
6:55.464 rupture Fluffy_Pillow 45.0/120: 37% energy | 6.0/6: 100% combo_points
6:56.468 exsanguinate Fluffy_Pillow 30.5/120: 25% energy | 0.0/6: 0% combo_points elaborate_planning
6:57.473 kingsbane Fluffy_Pillow 61.1/120: 51% energy | 0.0/6: 0% combo_points elaborate_planning
6:58.478 Waiting 3.400 sec 56.6/120: 47% energy | 0.0/6: 0% combo_points elaborate_planning
7:01.878 garrote Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points
7:02.882 mutilate Fluffy_Pillow 95.5/120: 80% energy | 1.0/6: 17% combo_points
7:03.887 mutilate Fluffy_Pillow 71.1/120: 59% energy | 3.0/6: 50% combo_points
7:04.893 envenom Fluffy_Pillow 36.6/120: 31% energy | 5.0/6: 83% combo_points
7:05.897 Waiting 1.300 sec 32.1/120: 27% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
7:07.197 mutilate Fluffy_Pillow 55.8/120: 46% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
7:08.202 Waiting 1.400 sec 31.3/120: 26% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
7:09.602 mutilate Fluffy_Pillow 56.0/120: 47% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
7:10.606 Waiting 0.300 sec 31.5/120: 26% energy | 5.0/6: 83% combo_points envenom
7:10.906 envenom Fluffy_Pillow 44.6/120: 37% energy | 5.0/6: 83% combo_points
7:11.909 Waiting 1.000 sec 40.2/120: 33% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
7:12.909 mutilate Fluffy_Pillow 60.6/120: 51% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
7:13.914 Waiting 0.900 sec 36.2/120: 30% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
7:14.814 mutilate Fluffy_Pillow 55.6/120: 46% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
7:15.819 Waiting 1.320 sec 11.2/120: 9% energy | 5.0/6: 83% combo_points envenom, elaborate_planning
7:17.139 rupture Fluffy_Pillow 35.0/120: 29% energy | 5.0/6: 83% combo_points
7:19.162 garrote Fluffy_Pillow 51.2/120: 43% energy | 0.0/6: 0% combo_points elaborate_planning
7:20.166 Waiting 1.800 sec 26.7/120: 22% energy | 1.0/6: 17% combo_points elaborate_planning
7:21.966 mutilate Fluffy_Pillow 65.6/120: 55% energy | 1.0/6: 17% combo_points elaborate_planning
7:22.969 Waiting 1.370 sec 21.1/120: 18% energy | 3.0/6: 50% combo_points
7:24.339 mutilate Fluffy_Pillow 55.5/120: 46% energy | 3.0/6: 50% combo_points cleansing_flame
7:25.342 Waiting 0.482 sec 21.0/120: 17% energy | 6.0/6: 100% combo_points cleansing_flame
7:25.824 rupture Fluffy_Pillow 26.0/120: 22% energy | 6.0/6: 100% combo_points cleansing_flame
7:26.828 Waiting 0.727 sec 21.6/120: 18% energy | 0.0/6: 0% combo_points elaborate_planning, cleansing_flame

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 8806 8481 0
Agility 20350 18644 8727 (4941)
Stamina 21473 21473 12414
Intellect 5325 5000 0
Spirit 0 0 0
Health 1288380 1288380 0
Energy 120 120 0
Combo Points 6 6 0
Crit 26.04% 26.04% 3864
Haste 4.84% 4.84% 1572
Damage / Heal Versatility 7.86% 6.91% 2762
Attack Power 20350 18644 0
Mastery 70.84% 70.84% 3397
Armor 1723 1723 1723
Run Speed 8 0 0

Gear

Source Slot Average Item Level: 790.00
Local Head Mask of the Uncrowned
ilevel: 810, stats: { 234 Armor, +1340 Sta, +894 Agi, +731 Crit, +393 Mastery }
Local Neck The Violaceous Pearl
ilevel: 660, stats: { +186 Sta, +271 Mastery, +142 Haste }
Local Shoulders Dreadleather Shoulderguard of the Quickblade
ilevel: 815, stats: { 220 Armor, +1053 Sta, +702 AgiInt, +245 Crit, +614 Vers }
Local Chest Brinewashed Leather Vest
ilevel: 810, stats: { 288 Armor, +894 AgiInt, +1340 Sta, +803 Mastery, +321 Vers }
Local Waist Dreadleather Belt of the Quickblade
ilevel: 815, stats: { 165 Armor, +1053 Sta, +702 AgiInt, +368 Crit, +491 Vers }
Local Legs Ruin-Stalker Breeches
ilevel: 680, stats: { 151 Armor, +266 AgiInt, +399 Sta, +207 Mastery, +147 Crit }
Local Feet Brinewashed Leather Boots
ilevel: 840, stats: { 219 Armor, +886 AgiInt, +1329 Sta, +633 Mastery, +310 Vers }
Local Wrists Wristbands of the Uncrowned
ilevel: 810, stats: { 126 Armor, +754 Sta, +503 Agi, +383 Crit, +248 Haste }
Local Hands Gloves of Vile Defiance
ilevel: 840, stats: { 199 Armor, +886 AgiInt, +1329 Sta, +674 Haste, +269 Mastery }
Local Finger1 Maalus, the Blood Drinker
ilevel: 792, stats: { +425 Agi, +637 Sta, +296 Crit, +262 Vers }, enchant: { +50 Mastery }
Local Finger2 Utgarde Royal Signet
ilevel: 815, stats: { +790 Sta, +1104 Crit, +506 Vers }
Local Trinket1 Golza's Iron Fin
ilevel: 660, stats: { +210 Mastery, +210 Agi }
Local Trinket2 Infallible Tracking Charm
ilevel: 815, stats: { +890 Agi }
Local Back Shadowfeather Shawl
ilevel: 830, stats: { 121 Armor, +605 StrAgiInt, +908 Sta, +204 Vers, +477 Haste }
Local Main Hand The Kingslayers
ilevel: 823, weapon: { 1774 - 3296, 1.8 }, stats: { +432 Agi, +648 Sta, +257 Crit, +247 Mastery }, relics: { +40 ilevels, +33 ilevels }
Local Off Hand The Kingslayers
ilevel: 823, weapon: { 1774 - 3296, 1.8 }, stats: { +432 Agi, +648 Sta, +257 Crit, +247 Mastery }

Talents

Level
15 Master Poisoner (Assassination Rogue) Elaborate Planning Hemorrhage (Assassination Rogue)
30 Nightstalker Subterfuge Shadow Focus
45 Deeper Stratagem Anticipation Vigor
60 Leeching Poison (Assassination Rogue) Elusiveness Cheat Death
75 Thuggee (Assassination Rogue) Prey on the Weak Internal Bleeding (Assassination Rogue)
90 Agonizing Poison (Assassination Rogue) Alacrity Exsanguinate
100 Venom Rush (Assassination Rogue) Marked for Death Death from Above

Profile

rogue="Ptitfille"
origin="https://eu.api.battle.net/wow/character/hyjal/Ptitfille/advanced"
thumbnail="http://eu.battle.net/static-render/eu/hyjal/206/115091406-avatar.jpg"
level=110
race=human
role=attack
position=back
professions=alchemy=734/herbalism=790
talents=http://eu.battle.net/wow/en/tool/talent-calculator#ca!1002020
artifact=43:0:0:0:0:323:3:325:2:328:3:330:3:332:1:346:1:347:1:1276:1
spec=assassination

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,name=flask_of_the_seventh_demon
actions.precombat+=/augmentation,name=defiled
actions.precombat+=/food,name=seedbattered_fish_plate
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/apply_poison
actions.precombat+=/stealth
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/marked_for_death,if=raid_event.adds.in>40

# Executed every time the actor is available.
actions=potion,name=deadly_grace,if=buff.bloodlust.react|target.time_to_die<=25|debuff.vendetta.up
actions+=/use_item,slot=finger1
actions+=/blood_fury,if=debuff.vendetta.up
actions+=/berserking,if=debuff.vendetta.up
actions+=/arcane_torrent,if=debuff.vendetta.up&energy.deficit>50
actions+=/call_action_list,name=cds
actions+=/rupture,if=combo_points>=2&!ticking&time<10&!artifact.urge_to_kill.enabled
actions+=/rupture,if=combo_points>=4&!ticking
actions+=/pool_resource,for_next=1
actions+=/kingsbane,if=!talent.exsanguinate.enabled&(buff.vendetta.up|cooldown.vendetta.remains>10)|talent.exsanguinate.enabled&dot.rupture.exsanguinated
actions+=/run_action_list,name=exsang_combo,if=cooldown.exsanguinate.up&(buff.maalus.up|cooldown.vanish.remains>35)&talent.exsanguinate.enabled
actions+=/call_action_list,name=garrote,if=spell_targets.fan_of_knives<=8-artifact.bag_of_tricks.enabled
actions+=/call_action_list,name=exsang,if=dot.rupture.exsanguinated
actions+=/rupture,if=talent.exsanguinate.enabled&remains-cooldown.exsanguinate.remains<(4+cp_max_spend*4)*0.3&new_duration-cooldown.exsanguinate.remains>=(4+cp_max_spend*4)*0.3+3
actions+=/call_action_list,name=finish
actions+=/call_action_list,name=build

# Cooldowns
actions.cds=marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|combo_points.deficit>=5
actions.cds+=/vendetta,if=target.time_to_die<20|buff.maalus.react
actions.cds+=/vanish,if=talent.subterfuge.enabled&combo_points<=2&!dot.rupture.exsanguinated|talent.shadow_focus.enabled&!dot.rupture.exsanguinated&combo_points.deficit>=2

# Exsanguinate Combo
actions.exsang_combo=vanish,if=talent.nightstalker.enabled&combo_points>=cp_max_spend&cooldown.exsanguinate.remains<1&gcd.remains=0&energy>=25
actions.exsang_combo+=/rupture,if=combo_points>=cp_max_spend&(!talent.nightstalker.enabled|buff.vanish.up|cooldown.vanish.remains>15)&cooldown.exsanguinate.remains<1
actions.exsang_combo+=/exsanguinate,if=prev_gcd.rupture&dot.rupture.remains>22+4*talent.deeper_stratagem.enabled&cooldown.vanish.remains>10
actions.exsang_combo+=/call_action_list,name=garrote,if=spell_targets.fan_of_knives<=8-artifact.bag_of_tricks.enabled
actions.exsang_combo+=/hemorrhage,if=spell_targets.fan_of_knives>=2&!ticking
actions.exsang_combo+=/call_action_list,name=build

# Garrote
actions.garrote=pool_resource,for_next=1
actions.garrote+=/garrote,cycle_targets=1,if=talent.subterfuge.enabled&!ticking&combo_points.deficit>=1&spell_targets.fan_of_knives>=2
actions.garrote+=/pool_resource,for_next=1
actions.garrote+=/garrote,if=combo_points.deficit>=1&!exsanguinated

# Exsanguinated Finishers
actions.exsang=rupture,cycle_targets=1,max_cycle_targets=14-2*artifact.bag_of_tricks.enabled,if=!ticking&combo_points>=cp_max_spend-1&spell_targets.fan_of_knives>1&target.time_to_die-remains>6
actions.exsang+=/rupture,if=combo_points>=cp_max_spend&ticks_remain<2
actions.exsang+=/death_from_above,if=combo_points>=cp_max_spend-1&(dot.rupture.remains>3|dot.rupture.remains>2&spell_targets.fan_of_knives>=3)&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6+2*debuff.vendetta.up)
actions.exsang+=/envenom,if=combo_points>=cp_max_spend-1&(dot.rupture.remains>3|dot.rupture.remains>2&spell_targets.fan_of_knives>=3)&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6+2*debuff.vendetta.up)

# Finishers
actions.finish=rupture,cycle_targets=1,max_cycle_targets=14-2*artifact.bag_of_tricks.enabled,if=!ticking&combo_points>=cp_max_spend-1&spell_targets.fan_of_knives>1&target.time_to_die-remains>6
actions.finish+=/rupture,if=combo_points>=cp_max_spend-1&refreshable&!exsanguinated
actions.finish+=/death_from_above,if=combo_points>=cp_max_spend-1&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6)
actions.finish+=/envenom,if=combo_points>=cp_max_spend-1&!dot.rupture.refreshable&buff.elaborate_planning.remains<2&energy.deficit<40&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6)
actions.finish+=/envenom,if=combo_points>=cp_max_spend&!dot.rupture.refreshable&buff.elaborate_planning.remains<2&cooldown.garrote.remains<1&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6)

# Builders
actions.build=hemorrhage,cycle_targets=1,if=combo_points.deficit>=1&refreshable&dot.rupture.remains>6&spell_targets.fan_of_knives>1&spell_targets.fan_of_knives<=4
actions.build+=/hemorrhage,cycle_targets=1,max_cycle_targets=3,if=combo_points.deficit>=1&refreshable&dot.rupture.remains>6&spell_targets.fan_of_knives>1&spell_targets.fan_of_knives=5
actions.build+=/fan_of_knives,if=(spell_targets>=2+debuff.vendetta.up&(combo_points.deficit>=1|energy.deficit<=30))|(!artifact.bag_of_tricks.enabled&spell_targets>=7+2*debuff.vendetta.up)
actions.build+=/fan_of_knives,if=equipped.the_dreadlords_deceit&((buff.the_dreadlords_deceit.stack>=29|buff.the_dreadlords_deceit.stack>=15&debuff.vendetta.remains<=3)&debuff.vendetta.up|buff.the_dreadlords_deceit.stack>=5&cooldown.vendetta.remains>60&cooldown.vendetta.remains<65)
actions.build+=/hemorrhage,if=(combo_points.deficit>=1&refreshable)|(combo_points.deficit=1&(dot.rupture.exsanguinated&dot.rupture.remains<=2|cooldown.exsanguinate.remains<=2))
actions.build+=/mutilate,if=combo_points.deficit<=1&energy.deficit<=30
actions.build+=/mutilate,if=combo_points.deficit>=2&cooldown.garrote.remains>2

head=mask_of_the_uncrowned,id=139742,bonus_id=3385/3381
neck=the_violaceous_pearl,id=129072,bonus_id=1794
shoulders=dreadleather_shoulderguard,id=128889,bonus_id=596/601/689/1682/3408
back=shadowfeather_shawl,id=136977,bonus_id=1726/1482/3339
chest=brinewashed_leather_vest,id=134241,bonus_id=1825/1472/1675
wrists=wristbands_of_the_uncrowned,id=139746,bonus_id=3385/3381
hands=gloves_of_vile_defiance,id=137320,bonus_id=1727/1808/1492/1813
waist=dreadleather_belt,id=128890,bonus_id=596/601/689/1680/3408
legs=ruinstalker_breeches,id=121434,bonus_id=767/1733
feet=brinewashed_leather_boots,id=134237,bonus_id=1727/1502/1813
finger1=maalus_the_blood_drinker,id=124636,bonus_id=650/640,enchant=50mastery
finger2=utgarde_royal_signet,id=133637,bonus_id=1826/1467/3339
trinket1=golzas_iron_fin,id=129091,bonus_id=1794
trinket2=infallible_tracking_charm,id=133597
main_hand=the_kingslayers,id=128870,gem_id=137377/141268/0/0,relic_id=1727:1492:1813/3394:1477:1675/0/0
off_hand=the_kingslayers,id=128869

# Gear Summary
# gear_ilvl=789.88
# gear_agility=8727
# gear_stamina=12414
# gear_crit_rating=3788
# gear_haste_rating=1541
# gear_mastery_rating=3330
# gear_versatility_rating=2708
# gear_armor=1723
# set_bonus=tier19oh_2pc=1

Mastoria

Mastoria : 192817 dps

  • Race: Dwarf
  • Class: Shaman
  • Spec: Elemental
  • Level: 110
  • Role: Spell
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
192816.7 192816.7 103.7 / 0.054% 20743.5 / 10.8% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 47.2 100.0% 100%
Origin https://eu.api.battle.net/wow/character/hyjal/Mastoria/advanced
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Ancestral Swiftness
  • 75: Primal Elementalist (Elemental Shaman)
  • 90: Elemental Mastery (Elemental Shaman)
  • 100: Ascendance (Elemental Shaman)
  • Talent Calculator
Artifact
Professions
  • herbalism: 796
  • enchanting: 726

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Mastoria 192817
Deadly Grace 3962 2.0% 24.3 9.03sec 72361 0 Direct 24.3 60265 122940 72361 19.3%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.28 24.28 0.00 0.00 0.0000 0.0000 1756926.07 1756926.07 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.59 80.70% 60264.80 60265 60265 60264.80 60265 60265 1180832 1180832 0.00
crit 4.69 19.30% 122940.20 122940 122940 122251.67 0 122940 576094 576094 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:5.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=47572 to 71358} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:47572.00
  • base_dd_max:71358.00
 
Earth Shock 33101 17.2% 41.8 10.66sec 356066 328880 Direct 41.8 273524 700301 356064 19.3%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.84 41.84 0.00 0.00 1.0827 0.0000 14899242.82 14899242.82 0.00 328879.83 328879.83
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.75 80.66% 273523.51 229271 314520 273558.88 259513 286368 9231613 9231613 0.00
crit 8.09 19.34% 700301.26 586935 805171 700279.39 0 805171 5667630 5667630 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:90.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:8.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 17162 8.9% 14.3 32.34sec 538425 504091 Direct 14.3 31909 81726 41376 19.0%  
Periodic 312.3 17588 45033 22840 19.1% 99.6%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.35 14.35 312.29 312.29 1.0681 1.4364 7726196.32 7726196.32 0.00 16655.23 504090.58
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.62 81.00% 31909.19 29517 34823 31907.37 30052 33478 370875 370875 0.00
crit 2.73 19.00% 81726.14 75564 89147 77614.64 0 89147 222846 222846 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 252.5 80.87% 17587.56 1839 19154 17587.36 16830 18222 4441449 4441449 0.00
crit 59.8 19.13% 45033.17 8315 49033 45031.31 42809 46961 2691027 2691027 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}. Maelstrom increases duration up to {$s3=100}%.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.400000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Burst 40116 (57318) 20.8% (29.7%) 87.0 5.16sec 295799 235114 Direct 86.9 0 207358 207358 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 87.03 86.89 0.00 0.00 1.2581 0.0000 18017798.51 18017798.51 0.00 235114.40 235114.40
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 86.89 100.00% 207358.16 176806 253330 207422.72 200762 214680 18017799 18017799 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage. Lava Burst will always critically strike if the target is affected by Flame Shock.{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.100000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 17202 8.9% 50.9 8.78sec 151709 0 Direct 50.8 0 152036 152036 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.92 50.81 0.00 0.00 0.0000 0.0000 7725582.65 7725582.65 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 50.81 100.00% 152036.10 129593 185682 152080.70 143506 163240 7725583 7725583 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.100000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Lightning Bolt 31771 (52535) 16.5% (27.3%) 181.8 2.45sec 130187 88852 Direct 181.8 60644 155205 78732 19.1%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 181.82 181.82 0.00 0.00 1.4652 0.0000 14315082.84 14315082.84 0.00 88851.84 88851.84
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 147.04 80.87% 60644.19 44483 157439 60656.07 54776 65289 8917282 8917282 0.00
crit 34.78 19.13% 155205.35 113877 403045 155218.85 121288 227961 5397801 5397801 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage. |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.300000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 20764 10.8% 153.5 3.33sec 60954 0 Direct 153.5 46884 120238 60954 19.2%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 153.49 153.49 0.00 0.00 0.0000 0.0000 9355490.50 9355490.50 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 124.05 80.82% 46884.44 33362 118079 46887.13 37800 54637 5815997 5815997 0.00
crit 29.44 19.18% 120237.97 85408 302283 120156.12 90334 178871 3539494 3539494 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.300000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - primal_fire_elemental 88767 / 28738
Fire Blast 70501 11.9% 58.7 6.63sec 175636 88575 Direct 58.7 147385 294789 175639 19.2%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.67 58.67 0.00 0.00 1.9829 0.0000 10304590.04 10304590.04 0.00 88574.58 88574.58
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 47.43 80.83% 147385.38 144604 155090 147402.08 145943 148855 6989826 6989826 0.00
crit 11.24 19.17% 294789.38 289208 310180 294826.04 289208 310180 3314764 3314764 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Fire Nova 5680 1.0% 12.8 32.45sec 65286 46615 Direct 12.8 54765 109526 65283 19.2%  

Stats details: fire_nova

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.75 12.75 0.00 0.00 1.4006 0.0000 832631.58 832631.58 0.00 46614.69 46614.69
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.30 80.79% 54765.06 53558 57442 54772.27 53558 56471 564256 564256 0.00
crit 2.45 19.21% 109525.58 107116 114883 101239.28 0 114883 268376 268376 0.00
 
 

Action details: fire_nova

Static Values
  • id:117588
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.3
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:117588
  • name:Fire Nova
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to nearby enemies.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:2.00
 
Immolate 12586 2.1% 7.4 59.41sec 249868 181773 Direct 7.4 43636 87280 52068 19.3%  
Periodic 79.3 15430 30838 18388 19.2% 33.5%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.37 7.37 79.27 79.27 1.3746 1.9035 1841363.44 1841363.44 0.00 11435.12 181773.29
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.95 80.68% 43636.42 42846 45953 43618.01 42846 45953 259452 259452 0.00
crit 1.42 19.32% 87279.78 85691 91905 68538.63 0 91905 124247 124247 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 64.1 80.80% 15430.02 28 17232 15434.82 14720 16344 988402 988402 0.00
crit 15.2 19.20% 30837.91 55 34464 30845.86 21931 34464 469262 469262 0.00
 
 

Action details: immolate

Static Values
  • id:118297
  • school:fire
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:118297
  • name:Immolate
  • school:fire
  • tooltip:Fire damage inflicted every $t1 sec.
  • description:Burns an enemy, then inflicts additional Fire damage every $t1 sec. for {$d=21 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.300000
  • base_td:0.00
  • dot_duration:21.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Mastoria
Ascendance 2.9 180.79sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.94 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114050
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
Spelldata
  • id:114050
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Mastoria
  • harmful:false
  • if_expr:
 
Elemental Mastery 4.3 120.49sec

Stats details: elemental_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.31 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: elemental_mastery

Static Values
  • id:16166
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:16166
  • name:Elemental Mastery
  • school:nature
  • tooltip:Haste increased by {$s1=20}%.
  • description:Elemental forces empower you with {$s1=20}% haste for {$d=20 seconds}.
 
Fire Elemental 2.6 223.96sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.60 0.00 0.00 0.00 1.1577 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:nature
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:nature
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Mastoria
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Mastoria
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 7.5 65.01sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.50 0.00 0.00 0.00 0.9787 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will deal {$s1=200}% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to deal {$s1=200}% increased damage.
 
Totem Mastery 4.5 111.20sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.54 0.00 0.00 0.00 0.6005 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 2.9 0.0 180.8sec 180.8sec 9.67% 34.06% 0.0(0.0) 2.8

Buff details

  • buff initial source:Mastoria
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:9.67%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114050
  • name:Ascendance
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 14.37% 0.0(0.0) 1.0

Buff details

  • buff initial source:Mastoria
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Collapsing Shadow 8.0 0.0 60.5sec 60.5sec 26.06% 26.12% 0.0(0.0) 7.7

Buff details

  • buff initial source:Mastoria
  • cooldown name:buff_collapsing_shadow
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:2027.50

Stack Uptimes

  • collapsing_shadow_1:26.06%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:215476
  • name:Collapsing Shadow
  • tooltip:Agility or Intellect increased by $w3.
  • description:{$@spelldesc215467=Create a Collapsing Shadow at your location for {$d=15 seconds}, increasing your Agility or Intellect by {$s2=2124} while you are within it.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 87.4 54.3 5.1sec 3.2sec 72.99% 56.33% 54.3(54.4) 0.0

Buff details

  • buff initial source:Mastoria
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:20.27%
  • elemental_focus_2:52.72%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Elemental Mastery 4.3 0.0 120.5sec 120.5sec 18.61% 23.18% 0.0(0.0) 4.1

Buff details

  • buff initial source:Mastoria
  • cooldown name:buff_elemental_mastery
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.83

Stack Uptimes

  • elemental_mastery_1:18.61%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:16166
  • name:Elemental Mastery
  • tooltip:Haste increased by {$s1=20}%.
  • description:Elemental forces empower you with {$s1=20}% haste for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:101.00%
Ember Totem 1.0 3.5 0.0sec 111.3sec 100.00% 99.81% 3.5(3.5) 0.0

Buff details

  • buff initial source:Mastoria
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Lava Surge 30.1 1.1 14.6sec 14.1sec 8.37% 29.68% 1.1(1.1) 0.0

Buff details

  • buff initial source:Mastoria
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:8.37%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Potion of Deadly Grace 2.0 0.0 188.0sec 0.0sec 10.83% 10.89% 0.0(0.0) 2.0

Buff details

  • buff initial source:Mastoria
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:10.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Power of the Maelstrom 9.7 3.4 45.4sec 32.9sec 19.81% 15.23% 3.4(9.3) 0.2

Buff details

  • buff initial source:Mastoria
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:4.19%
  • power_of_the_maelstrom_2:4.15%
  • power_of_the_maelstrom_3:11.47%

Trigger Attempt Success

  • trigger_pct:15.05%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 3.5 0.0sec 111.3sec 100.00% 100.00% 451.9(451.9) 0.0

Buff details

  • buff initial source:Mastoria
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Totem 1.0 3.5 0.0sec 111.3sec 100.00% 99.44% 3.5(3.5) 0.0

Buff details

  • buff initial source:Mastoria
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 7.5 0.0 64.4sec 65.0sec 11.65% 11.77% 0.0(0.0) 0.0

Buff details

  • buff initial source:Mastoria
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:3.26%
  • stormkeeper_2:3.25%
  • stormkeeper_3:5.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will deal {$s1=200}% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 3.5 0.0sec 111.3sec 100.00% 99.81% 3.5(3.5) 0.0

Buff details

  • buff initial source:Mastoria
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Voidsight 7.2 2.1 59.7sec 44.8sec 26.97% 27.03% 2.1(2.1) 6.9

Buff details

  • buff initial source:Mastoria
  • cooldown name:buff_voidsight
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1102.73
  • stat:haste_rating
  • amount:1102.73
  • stat:mastery_rating
  • amount:1102.73

Stack Uptimes

  • voidsight_1:26.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201410
  • name:Voidsight
  • tooltip:Critical Strike, Haste and Mastery increased by {$s1=1145}. Damage against Demons increased by {$s2=10}%.
  • description:Increases Critical Strike, Haste and Mastery by {$s1=1145}. Damage against Demons increased by {$s2=10}%.
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Mastoria
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Mastoria
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (the_hungry_magister)

Buff details

  • buff initial source:Mastoria
  • cooldown name:buff_the_hungry_magister
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:375.00

Stack Uptimes

  • the_hungry_magister_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225602
  • name:Well Fed
  • tooltip:Critical Strike increased by $w1.
  • description:Increases critical strike by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper4.8500.00133.50828.61821.72942.027
Fire Elemental0.3670.0011.4140.1460.0002.330
Elemental Mastery0.5880.0011.5081.6210.0004.731
Ascendance0.9600.00111.3571.5880.00011.639
Lava Burst0.9500.0014.97348.20521.85482.717

Resources

Resource Usage Type Count Total Average RPE APR
Mastoria
earth_shock Maelstrom 41.8 3956.4 94.6 94.6 3765.8
flame_shock Maelstrom 14.3 268.0 18.7 18.7 28830.7
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 87.03 1018.99 (23.90%) 11.71 25.38 2.43%
Lava Burst Overload Maelstrom 50.92 437.28 (10.25%) 8.59 21.03 4.59%
Lightning Bolt Maelstrom 181.82 1449.62 (33.99%) 7.97 4.93 0.34%
Lightning Bolt Overload Maelstrom 153.48 913.43 (21.42%) 5.95 7.48 0.81%
Resonance Totem Maelstrom 448.32 444.93 (10.43%) 0.99 3.39 0.76%
Resource RPS-Gain RPS-Loss
Maelstrom 9.47 9.38
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 38.26 0.00 100.00

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval
Lava Surge 31.2 14.1sec
Lava Surge: Wasted 1.2 122.0sec
Lava Surge: During Lava Burst 5.7 69.0sec

Statistics & Data Analysis

Fight Length
Sample Data Mastoria Fight Length
Count 9999
Mean 450.42
Minimum 350.15
Maximum 555.44
Spread ( max - min ) 205.29
Range [ ( max - min ) / 2 * 100% ] 22.79%
DPS
Sample Data Mastoria Damage Per Second
Count 9999
Mean 192816.74
Minimum 174129.75
Maximum 215377.84
Spread ( max - min ) 41248.10
Range [ ( max - min ) / 2 * 100% ] 10.70%
Standard Deviation 5290.7391
5th Percentile 184225.06
95th Percentile 201653.71
( 95th Percentile - 5th Percentile ) 17428.65
Mean Distribution
Standard Deviation 52.9100
95.00% Confidence Intervall ( 192713.03 - 192920.44 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 28
0.1% Error 2892
0.1 Scale Factor Error with Delta=300 238955
0.05 Scale Factor Error with Delta=300 955820
0.01 Scale Factor Error with Delta=300 23895512
Priority Target DPS
Sample Data Mastoria Priority Target Damage Per Second
Count 9999
Mean 192816.74
Minimum 174129.75
Maximum 215377.84
Spread ( max - min ) 41248.10
Range [ ( max - min ) / 2 * 100% ] 10.70%
Standard Deviation 5290.7391
5th Percentile 184225.06
95th Percentile 201653.71
( 95th Percentile - 5th Percentile ) 17428.65
Mean Distribution
Standard Deviation 52.9100
95.00% Confidence Intervall ( 192713.03 - 192920.44 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 28
0.1% Error 2892
0.1 Scale Factor Error with Delta=300 238955
0.05 Scale Factor Error with Delta=300 955820
0.01 Scale Factor Error with Delta=300 23895512
DPS(e)
Sample Data Mastoria Damage Per Second (Effective)
Count 9999
Mean 192816.74
Minimum 174129.75
Maximum 215377.84
Spread ( max - min ) 41248.10
Range [ ( max - min ) / 2 * 100% ] 10.70%
Damage
Sample Data Mastoria Damage
Count 9999
Mean 73796319.72
Minimum 54134936.86
Maximum 94988933.96
Spread ( max - min ) 40853997.10
Range [ ( max - min ) / 2 * 100% ] 27.68%
DTPS
Sample Data Mastoria Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Mastoria Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Mastoria Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Mastoria Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Mastoria Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Mastoria Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data MastoriaTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Mastoria Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,name=the_hungry_magister
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=deadly_grace
5 0.00 stormkeeper
6 0.00 totem_mastery
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 7.97 use_item,slot=trinket1
8 1.00 potion,name=deadly_grace,if=buff.ascendance.up|target.time_to_die<=30
In-combat potion is preferentially linked to Ascendance, unless combat will end shortly
9 0.00 totem_mastery,if=buff.resonance_totem.remains<2
A 2.60 fire_elemental
0.00 storm_elemental
B 4.31 elemental_mastery
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
C 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
D 0.00 run_action_list,name=single
actions.single Single target action priority list
# count action,conditions
E 2.94 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
F 1.00 flame_shock,if=!ticking
G 2.99 flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
H 30.12 earth_shock,if=maelstrom>=92
0.00 icefury,if=raid_event.movement.in<5
I 87.21 lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
0.00 elemental_blast
J 10.36 flame_shock,if=maelstrom>=20,target_if=refreshable
0.00 frost_shock,if=talent.icefury.enabled&buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack))
0.00 frost_shock,moving=1,if=buff.icefury.up
K 11.72 earth_shock,if=maelstrom>=86
0.00 icefury,if=maelstrom<=70&raid_event.movement.in>30&((talent.ascendance.enabled&cooldown.ascendance.remains>buff.icefury.duration)|!talent.ascendance.enabled)
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
L 6.50 stormkeeper,if=(talent.ascendance.enabled&cooldown.ascendance.remains>10)|!talent.ascendance.enabled
M 3.54 totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
0.00 lava_beam,if=active_enemies>1&spell_targets.lava_beam>1,target_if=!debuff.lightning_rod.up
0.00 lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=!debuff.lightning_rod.up
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
N 182.39 lightning_bolt,target_if=!debuff.lightning_rod.up
0.00 lightning_bolt
0.00 frost_shock,if=maelstrom>=20&dot.flame_shock.remains>19
0.00 flame_shock,moving=1,target_if=refreshable
0.00 flame_shock,moving=1

Sample Sequence

0124567ABFIIGNNNEIIHIIIIIHIIIIIHIINNNIHNNNNNNIHIIJNNNNNHINNNNNN7IHLNINNIHNNJNINNNNHNINNNNHNININNHNNIJMINNNH7NBILNIKNINNNHNNINNNNHNIJNNNNNIHNNNNNIHNNNGNIN7NNHNNIE8IIIIHIIIIIIAHILJNINNNNNHIMNINNNHINNNN7NBIHNNJNNNINNNHNINNNNNIHLNNINNKNNIJNNNNKINNNN7HNINNNIHNNJNINNIKNNNNIHLMNNNNIHNNNNGINNHNNN7IBNIHNNNEIIIIHIIIIIHIIIJNNKNLINNIHNNNNINKNNNINHI7JNNIAINNHINNNNNIHMNN

Sample Sequence Table

time name target resources buffs
Pre flask Mastoria 220000.0/220000: 100% mana | 0.0/100: 0% maelstrom
Pre food Mastoria 220000.0/220000: 100% mana | 0.0/100: 0% maelstrom
Pre augmentation Mastoria 220000.0/220000: 100% mana | 0.0/100: 0% maelstrom
Pre potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/100: 0% maelstrom potion_of_deadly_grace
Pre stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/100: 0% maelstrom stormkeeper(3), potion_of_deadly_grace
Pre totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/100: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
0:00.000 use_item_obelisk_of_the_void Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/100: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
0:00.000 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/100: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, collapsing_shadow, potion_of_deadly_grace
0:01.124 elemental_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, collapsing_shadow, potion_of_deadly_grace
0:01.124 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, collapsing_shadow, potion_of_deadly_grace
0:01.856 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/100: 0% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, collapsing_shadow, voidsight, potion_of_deadly_grace
0:02.821 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/100: 13% maelstrom bloodlust, lava_surge, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, collapsing_shadow, voidsight, potion_of_deadly_grace
0:03.575 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/100: 35% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, collapsing_shadow, voidsight, potion_of_deadly_grace
0:04.330 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/100: 16% maelstrom bloodlust, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, collapsing_shadow, voidsight, potion_of_deadly_grace
0:05.296 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/100: 25% maelstrom bloodlust, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, collapsing_shadow, voidsight, potion_of_deadly_grace
0:06.263 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/100: 34% maelstrom bloodlust, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, collapsing_shadow, voidsight, potion_of_deadly_grace
0:07.230 ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/100: 49% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, collapsing_shadow, voidsight, potion_of_deadly_grace
0:07.230 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/100: 49% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, collapsing_shadow, voidsight, potion_of_deadly_grace
0:08.196 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/100: 68% maelstrom bloodlust, ascendance, lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, collapsing_shadow, voidsight, potion_of_deadly_grace
0:08.952 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/100: 98% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, collapsing_shadow, voidsight, potion_of_deadly_grace
0:09.707 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, collapsing_shadow, voidsight, potion_of_deadly_grace
0:10.673 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/100: 14% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, collapsing_shadow, voidsight, potion_of_deadly_grace
0:11.639 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/100: 36% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, collapsing_shadow, voidsight, potion_of_deadly_grace
0:12.606 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/100: 58% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, collapsing_shadow, voidsight, potion_of_deadly_grace
0:13.573 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/100: 80% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, collapsing_shadow, voidsight, potion_of_deadly_grace
0:14.537 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/100: 100% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, collapsing_shadow, voidsight, potion_of_deadly_grace
0:15.290 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/100: 10% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, voidsight, potion_of_deadly_grace
0:16.255 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/100: 23% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:17.250 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/100: 36% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:18.244 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/100: 49% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:19.238 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/100: 71% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:20.232 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/100: 93% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:20.985 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/100: 9% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:21.982 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/100: 22% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
0:23.176 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/100: 36% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
0:24.368 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/100: 54% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
0:25.562 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/100: 75% maelstrom bloodlust, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:26.756 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/100: 90% maelstrom bloodlust, lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:27.651 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/100: 100% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
0:28.547 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:29.740 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/100: 10% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:30.933 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/100: 25% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:32.128 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/100: 41% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:33.320 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/100: 56% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:34.514 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/100: 71% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:35.710 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/100: 86% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:36.903 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/100: 100% maelstrom bloodlust, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:37.801 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/100: 10% maelstrom bloodlust, lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
0:38.698 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/100: 23% maelstrom bloodlust, lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
0:39.593 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/100: 45% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
0:40.489 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/100: 26% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:41.684 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/100: 35% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
0:43.235 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/100: 51% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
0:44.783 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/100: 66% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:46.334 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/100: 82% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
0:47.883 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/100: 97% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
0:49.048 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/100: 8% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
0:50.598 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/100: 21% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
0:52.150 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/100: 31% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:53.699 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/100: 40% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
0:55.249 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/100: 50% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
0:56.798 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/100: 59% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
0:58.347 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/100: 69% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
0:59.895 use_item_obelisk_of_the_void Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/100: 84% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:00.000 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/100: 85% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, collapsing_shadow
1:01.549 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/100: 100% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, collapsing_shadow
1:02.713 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, collapsing_shadow
1:03.875 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/100: 2% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, collapsing_shadow
1:05.425 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/100: 12% maelstrom lava_surge, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, collapsing_shadow
1:06.589 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/100: 40% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, collapsing_shadow
1:08.139 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/100: 50% maelstrom lava_surge, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, collapsing_shadow
1:09.689 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/100: 65% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, collapsing_shadow
1:10.851 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/100: 93% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, collapsing_shadow
1:12.014 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/100: 2% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, collapsing_shadow
1:13.563 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/100: 11% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, collapsing_shadow
1:15.112 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/100: 27% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:16.276 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/100: 14% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:17.826 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/100: 23% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:19.376 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/100: 43% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:20.926 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/100: 52% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:22.476 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/100: 68% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:24.025 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/100: 84% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, voidsight
1:25.529 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/100: 99% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, voidsight
1:26.659 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, voidsight
1:28.163 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/100: 11% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, voidsight
1:29.668 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/100: 30% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, voidsight
1:31.173 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/100: 49% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, voidsight
1:32.676 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/100: 64% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, voidsight
1:34.182 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/100: 80% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, voidsight
1:35.688 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/100: 95% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, voidsight
1:36.817 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/100: 7% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, voidsight
1:38.322 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/100: 17% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, voidsight
1:39.827 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/100: 36% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:41.378 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/100: 46% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:42.542 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/100: 68% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:44.093 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/100: 78% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:45.644 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/100: 93% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:46.808 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:48.357 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/100: 11% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:49.906 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/100: 26% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:51.068 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/100: 55% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:52.231 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/100: 36% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:53.009 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/100: 36% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:54.171 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/100: 49% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:55.721 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/100: 59% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:57.272 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/100: 81% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:58.821 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/100: 96% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:59.986 use_item_obelisk_of_the_void Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/100: 13% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:00.000 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/100: 13% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, collapsing_shadow
2:01.549 elemental_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/100: 23% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, collapsing_shadow
2:01.549 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/100: 23% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, collapsing_shadow
2:02.842 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/100: 42% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, collapsing_shadow
2:03.812 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/100: 52% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, collapsing_shadow
2:05.105 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/100: 61% maelstrom lava_surge, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, collapsing_shadow
2:06.074 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/100: 89% maelstrom elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, collapsing_shadow
2:07.044 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom lava_surge, elemental_focus, stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, collapsing_shadow
2:08.337 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/100: 11% maelstrom lava_surge, stormkeeper, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, collapsing_shadow
2:09.308 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/100: 45% maelstrom elemental_focus(2), stormkeeper, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, collapsing_shadow
2:10.600 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/100: 54% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, collapsing_shadow
2:11.892 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/100: 75% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, collapsing_shadow
2:13.186 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/100: 96% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, collapsing_shadow
2:14.157 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, collapsing_shadow
2:15.449 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/100: 11% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:16.741 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/100: 26% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:18.032 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/100: 45% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:19.325 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/100: 55% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:20.618 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/100: 70% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:21.909 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/100: 85% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:23.459 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/100: 100% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:24.623 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/100: 7% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:26.174 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/100: 16% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:27.725 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/100: 36% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:28.887 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/100: 17% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:30.436 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/100: 27% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:31.984 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/100: 42% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:33.533 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/100: 58% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:35.082 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/100: 73% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:36.631 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/100: 83% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:38.179 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/100: 100% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:39.343 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/100: 2% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:40.892 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/100: 11% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:42.441 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/100: 27% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:43.991 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/100: 42% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:45.541 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/100: 58% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:47.089 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/100: 73% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:48.638 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/100: 93% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:49.802 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:51.352 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/100: 11% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:52.901 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/100: 26% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:54.449 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/100: 42% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:55.614 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/100: 29% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:57.164 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/100: 38% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, voidsight
2:58.668 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/100: 52% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, voidsight
3:00.172 use_item_obelisk_of_the_void Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/100: 61% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, voidsight
3:00.172 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/100: 61% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, collapsing_shadow, voidsight
3:01.678 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/100: 77% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, collapsing_shadow, voidsight
3:03.183 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/100: 92% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, collapsing_shadow, voidsight
3:04.315 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/100: 2% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, collapsing_shadow, voidsight
3:05.821 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/100: 11% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, collapsing_shadow, voidsight
3:07.326 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/100: 21% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, collapsing_shadow, voidsight
3:08.831 ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/100: 40% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, collapsing_shadow, voidsight
3:08.831 potion Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/100: 40% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, collapsing_shadow, voidsight
3:08.831 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/100: 40% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, collapsing_shadow, voidsight, potion_of_deadly_grace
3:10.336 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/100: 54% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, collapsing_shadow, voidsight, potion_of_deadly_grace
3:11.841 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/100: 76% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, collapsing_shadow, voidsight, potion_of_deadly_grace
3:13.346 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/100: 90% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, collapsing_shadow, potion_of_deadly_grace
3:14.894 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/100: 100% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, collapsing_shadow, potion_of_deadly_grace
3:16.057 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/100: 10% maelstrom ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
3:17.220 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/100: 23% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
3:18.770 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/100: 37% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
3:20.318 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/100: 51% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
3:21.867 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/100: 73% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
3:23.417 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/100: 87% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
3:24.966 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/100: 100% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
3:26.129 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/100: 100% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
3:27.293 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/100: 2% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
3:28.455 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/100: 24% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
3:29.618 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/100: 25% maelstrom elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
3:30.782 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 6.0/100: 6% maelstrom elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
3:32.331 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/100: 16% maelstrom lava_surge, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
3:33.496 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/100: 29% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
3:35.045 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/100: 38% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:36.596 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/100: 54% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:38.145 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/100: 69% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:39.695 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/100: 85% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:41.247 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/100: 95% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:42.412 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/100: 7% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:43.960 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/100: 20% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:44.736 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/100: 29% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:46.286 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/100: 39% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:47.450 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/100: 58% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:49.000 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/100: 68% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:50.550 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/100: 83% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:52.100 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/100: 93% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:53.263 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:54.427 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/100: 14% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:55.976 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/100: 24% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:57.525 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/100: 39% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:59.075 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/100: 49% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:00.625 use_item_obelisk_of_the_void Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/100: 64% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:00.625 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/100: 64% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, collapsing_shadow
4:02.174 elemental_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/100: 80% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, collapsing_shadow
4:02.174 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/100: 80% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, collapsing_shadow
4:03.466 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/100: 99% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, collapsing_shadow
4:04.437 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, collapsing_shadow
4:05.731 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/100: 10% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, collapsing_shadow
4:07.022 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/100: 20% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, collapsing_shadow
4:07.993 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/100: 7% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, collapsing_shadow
4:09.286 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/100: 16% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, collapsing_shadow
4:10.578 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/100: 31% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, collapsing_shadow
4:11.870 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/100: 46% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, collapsing_shadow
4:13.161 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/100: 66% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, collapsing_shadow
4:14.456 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/100: 75% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, collapsing_shadow
4:15.750 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/100: 84% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:17.042 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/100: 100% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:18.013 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:19.307 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/100: 10% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:20.278 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/100: 23% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:21.572 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/100: 32% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, voidsight
4:22.827 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/100: 47% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, voidsight
4:24.332 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/100: 57% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, voidsight
4:25.837 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/100: 72% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, voidsight
4:27.341 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/100: 88% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, voidsight
4:28.846 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/100: 100% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, voidsight
4:29.976 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/100: 11% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, voidsight
4:31.106 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/100: 12% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, voidsight
4:32.612 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/100: 21% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, voidsight
4:34.120 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/100: 37% maelstrom lava_surge, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, voidsight
4:35.251 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/100: 65% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, voidsight
4:36.757 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/100: 74% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:38.307 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/100: 90% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:39.471 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/100: 7% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:41.019 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/100: 17% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:42.567 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/100: 32% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:44.117 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/100: 46% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:45.280 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/100: 36% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:46.829 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/100: 45% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:48.379 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/100: 55% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:49.929 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/100: 70% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:51.480 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/100: 86% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:52.644 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:54.194 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/100: 15% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:55.744 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/100: 33% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:57.293 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/100: 55% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:58.844 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/100: 76% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
5:00.394 use_item_obelisk_of_the_void Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/100: 92% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
5:00.625 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/100: 92% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, collapsing_shadow
5:01.789 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, collapsing_shadow
5:03.338 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/100: 11% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, collapsing_shadow
5:04.504 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/100: 39% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, collapsing_shadow
5:06.054 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/100: 49% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, collapsing_shadow
5:07.604 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/100: 64% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, collapsing_shadow
5:09.154 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/100: 80% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, collapsing_shadow
5:10.316 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/100: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, collapsing_shadow
5:11.479 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, collapsing_shadow
5:13.029 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/100: 11% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, collapsing_shadow
5:14.579 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/100: 26% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, collapsing_shadow
5:15.742 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/100: 13% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
5:17.292 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/100: 23% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
5:18.841 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/100: 36% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
5:20.389 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/100: 46% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
5:21.938 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/100: 61% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
5:23.102 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/100: 90% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
5:24.231 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, voidsight
5:25.736 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/100: 10% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, voidsight
5:27.242 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/100: 32% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, voidsight
5:28.747 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/100: 53% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, voidsight
5:30.251 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/100: 75% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, voidsight
5:31.755 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/100: 94% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, voidsight
5:32.886 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/100: 10% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, voidsight
5:34.017 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/100: 12% maelstrom elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, voidsight
5:34.772 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/100: 12% maelstrom elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, voidsight
5:36.277 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/100: 22% maelstrom elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, voidsight
5:37.782 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/100: 43% maelstrom stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, voidsight
5:39.289 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/100: 65% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
5:40.839 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/100: 80% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
5:42.389 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/100: 100% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
5:43.551 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
5:45.102 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/100: 11% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
5:46.653 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/100: 26% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
5:48.203 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/100: 42% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
5:49.752 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/100: 57% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
5:50.916 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/100: 44% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
5:52.465 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/100: 58% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
5:54.014 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/100: 76% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
5:55.562 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/100: 92% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
5:56.725 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/100: 7% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
5:58.275 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/100: 17% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
5:59.824 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/100: 26% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
6:01.375 use_item_obelisk_of_the_void Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/100: 42% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
6:01.375 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/100: 42% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, collapsing_shadow
6:02.540 elemental_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/100: 64% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, collapsing_shadow
6:02.540 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/100: 64% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, collapsing_shadow
6:03.835 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/100: 73% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, collapsing_shadow
6:04.807 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/100: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, collapsing_shadow
6:05.776 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, collapsing_shadow
6:07.069 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/100: 11% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, collapsing_shadow
6:08.361 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/100: 20% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, collapsing_shadow
6:09.653 ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/100: 35% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, collapsing_shadow
6:09.653 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/100: 35% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, collapsing_shadow
6:10.947 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/100: 48% maelstrom ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, collapsing_shadow
6:11.916 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/100: 70% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, collapsing_shadow
6:13.206 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/100: 84% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, collapsing_shadow
6:14.500 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/100: 100% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, collapsing_shadow
6:15.468 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/100: 10% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, collapsing_shadow
6:16.760 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/100: 23% maelstrom ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
6:17.729 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/100: 45% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
6:19.021 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/100: 59% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
6:20.314 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/100: 72% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
6:21.607 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/100: 94% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
6:22.584 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/100: 10% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
6:24.133 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/100: 24% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
6:25.297 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/100: 55% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
6:26.845 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/100: 68% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
6:28.009 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/100: 58% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
6:29.559 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/100: 68% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
6:31.108 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/100: 90% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
6:32.271 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/100: 13% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
6:33.821 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/100: 22% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
6:34.983 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/100: 35% maelstrom lava_surge, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
6:36.146 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/100: 49% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
6:37.695 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/100: 58% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
6:39.244 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/100: 74% maelstrom lava_surge, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
6:40.407 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/100: 93% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
6:41.572 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
6:43.121 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/100: 11% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
6:44.669 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/100: 26% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
6:46.219 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/100: 42% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
6:47.769 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/100: 57% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
6:48.931 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/100: 76% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
6:50.480 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/100: 86% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
6:51.644 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/100: 13% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
6:53.194 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/100: 23% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
6:54.742 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/100: 44% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
6:56.293 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/100: 60% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
6:57.843 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/100: 79% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
6:59.392 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/100: 98% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
7:00.556 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/100: 7% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
7:01.722 use_item_obelisk_of_the_void Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/100: 20% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
7:01.722 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/100: 20% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, collapsing_shadow
7:02.886 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, collapsing_shadow
7:04.436 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/100: 11% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, collapsing_shadow, voidsight
7:05.941 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/100: 20% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, collapsing_shadow, voidsight
7:07.073 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/100: 49% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, collapsing_shadow, voidsight
7:08.204 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/100: 50% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, collapsing_shadow, voidsight
7:09.336 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/100: 72% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, collapsing_shadow, voidsight
7:10.842 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/100: 81% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, collapsing_shadow, voidsight
7:12.346 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/100: 97% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, collapsing_shadow, voidsight
7:13.478 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/100: 7% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, collapsing_shadow, voidsight
7:14.609 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/100: 29% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, collapsing_shadow, voidsight
7:16.115 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/100: 39% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, collapsing_shadow, voidsight
7:17.622 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/100: 48% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, voidsight
7:19.125 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/100: 64% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, voidsight
7:20.631 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/100: 73% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
7:22.180 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/100: 83% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
7:23.730 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/100: 96% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
7:24.892 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/100: 10% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
7:25.671 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/100: 10% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
7:27.220 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/100: 20% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4732 4407 0
Agility 9351 9026 0
Stamina 28353 28353 18557
Intellect 29359 27653 19010 (8858)
Spirit -1 -1 0
Health 1701180 1701180 0
Mana 220000 220000 0
Maelstrom 100 100 0
Spell Power 29359 27653 0
Crit 18.30% 17.23% 4279
Haste 26.85% 26.85% 4977
Damage / Heal Versatility 1.34% 1.34% 538
Attack Power 9351 9026 0
Mastery 56.80% 56.80% 7140
Armor 2471 2471 2471
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 842.00
Local Head Farseer's Mask
ilevel: 830, stats: { 316 Armor, +1614 Sta, +1077 AgiInt, +866 Haste, +345 Crit }
Local Neck Hatecoil Commander's Amulet
ilevel: 845, stats: { +1045 Sta, +1081 Haste, +721 Mastery }
Local Shoulders Thundercrush Pauldrons
ilevel: 840, stats: { 301 Armor, +886 AgiInt, +1329 Sta, +572 Mastery, +370 Haste }
Local Chest Tunic of Screaming Earth
ilevel: 850, stats: { 414 Armor, +1297 AgiInt, +1945 Sta, +932 Crit, +372 Haste }
Local Waist Belt of Mighty Links
ilevel: 840, stats: { 226 Armor, +886 AgiInt, +1329 Sta, +613 Mastery, +330 Haste }
Local Legs Farseer's Leggings
ilevel: 830, stats: { 340 Armor, +1614 Sta, +1077 AgiInt, +709 Crit, +502 Mastery }
Local Feet Elemental Rebalancers
ilevel: 895, stats: { 327 Armor, +2219 Sta, +1479 AgiInt, +413 Haste, +745 Mastery }
Local Wrists Farseer's Wristwraps
ilevel: 830, stats: { 170 Armor, +908 Sta, +605 AgiInt, +471 Crit, +208 Vers }
Local Hands Sea Stalker's Gloves
ilevel: 840, stats: { 251 Armor, +886 AgiInt, +1329 Sta, +613 Mastery, +330 Vers }
Local Finger1 Signet of the Highborne Magi
ilevel: 850, stats: { +1094 Sta, +1154 Mastery, +682 Crit }, enchant: { +150 Mastery }
Local Finger2 Arch-Druid's Tainted Seal
ilevel: 840, stats: { +997 Sta, +1263 Mastery, +505 Haste }, enchant: { +150 Mastery }
Local Trinket1 Obelisk of the Void
ilevel: 805, stats: { +788 Haste }
Local Trinket2 Orb of Voidsight
ilevel: 815, stats: { +890 Int }
Local Back Cloak of Fading Echoes
ilevel: 840, stats: { 126 Armor, +665 StrAgiInt, +997 Sta, +252 Haste, +455 Crit }
Local Main Hand The Fist of Ra-den
ilevel: 861, weapon: { 1825 - 3392, 2.6 }, stats: { +616 Int, +924 Sta, +296 Crit, +284 Mastery, +7838 Int }, relics: { +35 ilevels, +37 ilevels, +39 ilevels }
Local Off Hand The Highkeeper's Ward
ilevel: 861, stats: { +808 Int, +1213 Sta, +389 Crit, +373 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Elemental Blast (Elemental Shaman) Ancestral Swiftness Echo of the Elements
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Icefury (Elemental Shaman)
90 Elemental Mastery (Elemental Shaman) Storm Elemental (Elemental Shaman) Aftershock (Elemental Shaman)
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Liquid Magma Totem (Elemental Shaman)

Profile

shaman="Mastoria"
origin="https://eu.api.battle.net/wow/character/hyjal/Mastoria/advanced"
thumbnail="http://eu.battle.net/static-render/eu/hyjal/70/136418630-avatar.jpg"
level=110
race=dwarf
role=spell
position=back
professions=enchanting=726/herbalism=796
talents=http://eu.battle.net/wow/en/tool/talent-calculator#Wa!2001100
artifact=40:0:0:0:0:291:1:294:1:296:1:300:1:301:3:302:3:303:3:1350:1
spec=elemental

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,name=the_hungry_magister
actions.precombat+=/augmentation,type=defiled
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/stormkeeper
actions.precombat+=/totem_mastery

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
actions+=/use_item,slot=trinket1
# In-combat potion is preferentially linked to Ascendance, unless combat will end shortly
actions+=/potion,name=deadly_grace,if=buff.ascendance.up|target.time_to_die<=30
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single

# Single target action priority list
actions.single=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single+=/flame_shock,if=!ticking
actions.single+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
actions.single+=/earth_shock,if=maelstrom>=92
actions.single+=/icefury,if=raid_event.movement.in<5
actions.single+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single+=/elemental_blast
actions.single+=/flame_shock,if=maelstrom>=20,target_if=refreshable
actions.single+=/frost_shock,if=talent.icefury.enabled&buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack))
actions.single+=/frost_shock,moving=1,if=buff.icefury.up
actions.single+=/earth_shock,if=maelstrom>=86
actions.single+=/icefury,if=maelstrom<=70&raid_event.movement.in>30&((talent.ascendance.enabled&cooldown.ascendance.remains>buff.icefury.duration)|!talent.ascendance.enabled)
actions.single+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single+=/stormkeeper,if=(talent.ascendance.enabled&cooldown.ascendance.remains>10)|!talent.ascendance.enabled
actions.single+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1,target_if=!debuff.lightning_rod.up
actions.single+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=!debuff.lightning_rod.up
actions.single+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single+=/lightning_bolt,target_if=!debuff.lightning_rod.up
actions.single+=/lightning_bolt
actions.single+=/frost_shock,if=maelstrom>=20&dot.flame_shock.remains>19
actions.single+=/flame_shock,moving=1,target_if=refreshable
actions.single+=/flame_shock,moving=1

# Multi target action priority list
actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning=3&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake_totem
actions.aoe+=/lava_burst,if=buff.lava_surge.up&spell_targets.chain_lightning=3
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=!debuff.lightning_rod.up
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

head=farseers_mask,id=139701,bonus_id=3386/3383
neck=hatecoil_commanders_amulet,id=134492,bonus_id=1727/1497/3336
shoulders=thundercrush_pauldrons,id=134478,bonus_id=1727/1492/1813
back=cloak_of_fading_echoes,id=134405,bonus_id=1727/1808/1492/1813
chest=tunic_of_screaming_earth,id=137354,bonus_id=1727/1502/3336
wrists=farseers_wristwraps,id=139705,bonus_id=3385/3383
hands=sea_stalkers_gloves,id=134253,bonus_id=3432/1502/3336
waist=belt_of_mighty_links,id=137456,bonus_id=1727/1492/1813
legs=farseers_leggings,id=139702,bonus_id=3385/3383
feet=elemental_rebalancers,id=137036,bonus_id=1811
finger1=signet_of_the_highborne_magi,id=134537,bonus_id=1727/1502/3336,enchant=150mastery
finger2=archdruids_tainted_seal,id=134487,bonus_id=1727/1492/1813,enchant=150mastery
trinket1=obelisk_of_the_void,id=137433,bonus_id=1826/1457
trinket2=orb_of_voidsight,id=133596
main_hand=the_fist_of_raden,id=128935,bonus_id=744,gem_id=141258/141267/141258/0,relic_id=1825:1482:3339/3397:1492:1675/3432:1497:1674/0
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=842.00
# gear_stamina=18557
# gear_intellect=19010
# gear_crit_rating=4279
# gear_haste_rating=4977
# gear_mastery_rating=7140
# gear_versatility_rating=538
# gear_armor=2471
# set_bonus=tier19oh_2pc=1

Dèmonos

Dèmonos : 125061 dps

  • Race: Human
  • Class: Warlock
  • Spec: Destruction
  • Level: 110
  • Role: Spell
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
125060.6 125060.6 71.4 / 0.057% 14250.0 / 11.4% 3.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
27244.6 27244.6 Mana 0.00% 39.1 100.0% 100%
Origin https://eu.api.battle.net/wow/character/hyjal/Dèmonos/advanced
Talents
  • 15: Backdraft (Destruction Warlock)
  • 30: Reverse Entropy (Destruction Warlock)
  • 45: Demon Skin
  • 60: Eradication (Destruction Warlock)
  • 75: Burning Rush
  • 90: Grimoire of Sacrifice
  • 100: Soul Conduit
  • Talent Calculator
Artifact
Professions
  • tailoring: 9
  • enchanting: 610

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Dèmonos 125061
Chaos Bolt 35356 28.3% 51.8 8.57sec 306845 176298 Direct 51.6 0 308446 308446 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.85 51.58 0.00 0.00 1.7405 0.0000 15908604.11 15908604.11 0.00 176298.02 176298.02
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 51.58 100.00% 308446.30 204354 449360 308260.62 279035 342414 15908604 15908604 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:116858
  • school:chromatic
  • resource:soul_shard
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:soul_shard>3
Spelldata
  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.300000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Conflagrate 8606 6.9% 42.4 10.69sec 91367 67157 Direct 42.4 78078 156334 91368 17.0%  

Stats details: conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.38 42.38 0.00 0.00 1.3605 0.0000 3872335.42 3872335.42 0.00 67156.92 67156.92
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.19 83.02% 78078.03 50655 108388 78081.56 70133 87137 2747188 2747188 0.00
crit 7.20 16.98% 156333.73 101315 216778 156245.94 0 216410 1125147 1125147 0.00
 
 

Action details: conflagrate

Static Values
  • id:17962
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:22000.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.roaring_blaze.enabled&(charges=2|(action.conflagrate.charges>=1&action.conflagrate.recharge_time<gcd))
Spelldata
  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=1} Fire damage.{$?s196406=false}[ Reduces the cast time of Incinerate and Chaos Bolt by {$117828s1=30}% for {$117828d=5 seconds}.][] |cFFFFFFFFGenerates 1 Soul Shard.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.041000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Deadly Grace 3254 2.6% 19.4 6.30sec 74477 0 Direct 19.4 63509 127017 74479 17.3%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.37 19.37 0.00 0.00 0.0000 0.0000 1442307.03 1442307.03 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.02 82.73% 63508.74 63509 63509 63508.74 63509 63509 1017493 1017493 0.00
crit 3.34 17.27% 127017.48 127017 127017 123181.17 0 127017 424814 424814 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:5.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=47572 to 71358} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:47572.00
  • base_dd_max:71358.00
 
Demonic Power 11443 9.2% 164.5 2.73sec 31328 0 Direct 165.5 26622 53250 31139 17.0%  

Stats details: demonic_power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 164.45 165.45 0.00 0.00 0.0000 0.0000 5152040.66 5152040.66 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 137.39 83.04% 26621.74 24818 27796 26622.32 26095 27184 3657481 3657481 0.00
crit 28.07 16.96% 53249.66 49636 55593 53250.88 50487 55593 1494560 1494560 0.00
 
 

Action details: demonic_power

Static Values
  • id:196100
  • school:shadow
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196100
  • name:Demonic Power
  • school:shadow
  • tooltip:
  • description:{$@spelldesc108503=Sacrifice your demon to gain Demonic Power, causing your spells to sometimes also deal {$196100s1=0} Shadow damage to the target and other enemies within $196100A1 yds. Lasts {$196099d=3600 seconds} or until you summon a demon.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Immolate 14424 11.5% 25.5 17.90sec 254522 185882 Direct 25.5 45262 90761 56497 24.7%  
Periodic 165.3 24457 48955 30566 24.9% 99.1%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.52 25.52 165.32 165.32 1.3693 2.7005 6495071.58 6495071.58 0.00 13492.13 185881.51
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.22 75.31% 45262.36 29783 63725 45262.41 38729 53494 869820 869820 0.00
crit 6.30 24.69% 90761.34 59566 127456 90678.23 0 126225 571898 571898 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 124.1 75.06% 24456.68 135 34518 24457.84 22819 25980 3034929 3034929 0.00
crit 41.2 24.94% 48955.25 286 69036 48953.42 43289 55257 2018424 2018424 0.00
 
 

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.08
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=tick_time
Spelldata
  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=1} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFF{$193541s1=15}% chance to generate 1 Soul Shard. Chance doubled on critical strikes.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.650000
  • base_td:0.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Incinerate 32963 26.4% 145.3 3.00sec 102213 63131 Direct 145.7 87197 174544 101955 16.9%  

Stats details: incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 145.29 145.65 0.00 0.00 1.6191 0.0000 14850148.38 14850148.38 0.00 63131.14 63131.14
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 121.05 83.10% 87197.00 56809 121557 87215.60 80817 93549 10554754 10554754 0.00
crit 24.61 16.90% 174543.63 113620 243110 174577.79 148064 201265 4295395 4295395 0.00
 
 

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.100000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - doomguard 19946 / 3186
Doom Bolt 19946 2.5% 26.1 14.64sec 54484 21517 Direct 26.0 46763 93533 54701 17.0%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.15 26.05 0.00 0.00 2.5322 0.0000 1424671.00 1424671.00 0.00 21517.13 21517.13
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 21.63 83.03% 46763.36 45342 54410 46717.06 45342 49638 1011304 1011304 0.00
crit 4.42 16.97% 93532.61 90684 108821 92496.43 0 108821 413367 413367 0.00
 
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.900000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - shadowy_tear 35943 / 6303
Shadow Bolt 35943 5.0% 6.6 63.38sec 428793 0 Periodic 53.8 44998 90039 52622 16.9% 20.1%

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.60 0.00 54.00 53.79 0.0000 1.6765 2830752.47 2830752.47 0.00 31267.29 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 44.7 83.07% 44997.99 470 47728 44998.12 42222 47728 2010914 2010914 0.00
crit 9.1 16.93% 90039.27 3594 95457 89618.65 0 95457 819839 819839 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:196657
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196657
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - chaos_tear 57574 / 4007
Chaos Bolt 57574 3.2% 6.5 64.00sec 277597 102097 Direct 6.5 0 278923 278923 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.49 6.46 0.00 0.00 2.7190 0.0000 1801305.76 1801305.76 0.00 102097.48 102097.48
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 6.46 100.00% 278922.60 276944 284614 278929.64 276944 284614 1801306 1801306 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:215279
  • school:chromatic
  • resource:none
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.500
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215279
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:5.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - chaos_portal 79353 / 5529
Chaos Barrage 79353 4.4% 6.6 64.95sec 377014 0 Periodic 165.8 12812 25620 14988 17.0% 8.0%

Stats details: chaos_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.59 0.00 166.32 165.78 0.0000 0.2159 2484606.63 2484606.63 0.00 69180.19 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 137.6 83.01% 12812.13 58 13126 12809.54 0 13126 1763153 1763153 0.00
crit 28.2 16.99% 25619.88 782 26252 25615.66 0 26252 721453 721453 0.00
 
 

Action details: chaos_barrage

Static Values
  • id:187394
  • school:magic
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187394
  • name:Chaos Barrage
  • school:magic
  • tooltip:
  • description:Deals {$s1=1} Chaos damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.50
  • base_tick_time:0.25
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Dèmonos
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Dèmonos
  • harmful:false
  • if_expr:
 
Dimensional Rift 19.8 23.93sec

Stats details: dimensional_rift

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.76 0.00 0.00 0.00 1.3641 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dimensional_rift

Static Values
  • id:196586
  • school:chaos
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=3
Spelldata
  • id:196586
  • name:Dimensional Rift
  • school:chaos
  • tooltip:
  • description:Rips a hole in time and space, opening a portal that damages your target.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Dèmonos
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Dèmonos
  • harmful:false
  • if_expr:
 
Grimoire of Sacrifice 1.0 0.00sec

Stats details: grimoire_of_sacrifice

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: grimoire_of_sacrifice

Static Values
  • id:108503
  • school:shadow
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_sacrifice.enabled
Spelldata
  • id:108503
  • name:Grimoire of Sacrifice
  • school:shadow
  • tooltip:Your spells sometimes deal additional Shadow damage.
  • description:Sacrifice your demon to gain Demonic Power, causing your spells to sometimes also deal {$196100s1=0} Shadow damage to the target and other enemies within $196100A1 yds. Lasts {$196099d=3600 seconds} or until you summon a demon.
 
Nithramus 4.1 120.55sec

Stats details: nithramus

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.12 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: nithramus

Static Values
  • id:187625
  • school:arcane
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187625
  • name:Nithramus
  • school:arcane
  • tooltip:
  • description:{$@spelldesc187611=Awakens the powers of all the Savage Hallows worn by you and your allies, increasing damage dealt by ${$<WarlordsTrinketNerf>*$m1/100}% for {$187620d=15 seconds}. When this effect ends, each empowered player unleashes a blast of light that strikes all enemies within $187626A1 yards of the initiating player's location, inflicting damage equal to ${$m1/100}% of all damage they dealt while empowered. (2 min shared cooldown)}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1536127.08
  • base_dd_max:1536127.08
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Summon Doomguard 2.9 181.78sec

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.95 0.00 0.00 0.00 1.2974 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&active_enemies<3
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:
  • description:Summons a Doomguard for {$60478d=25 seconds} to assault the target with its Doom Bolts.
 
Summon Imp 1.0 0.00sec

Stats details: summon_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_imp

Static Values
  • id:688
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
Spelldata
  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.$?s74434[ |cFFFFFFFFSoulburn:|r |cFF8282FFInstant cast.|r][]
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Backdraft 41.4 1.0 11.0sec 10.7sec 41.76% 40.04% 1.0(1.0) 41.0

Buff details

  • buff initial source:Dèmonos
  • cooldown name:buff_backdraft
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • backdraft_1:41.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Casting Conflagrate reduces the cast time of Incinerate and Chaos Bolt by {$117828s1=30}% for {$117828d=5 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 14.37% 0.0(0.0) 1.0

Buff details

  • buff initial source:Dèmonos
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Nithramus 4.3 0.0 120.6sec 120.5sec 14.11% 16.40% 0.0(0.0) 4.1

Buff details

  • buff initial source:Dèmonos
  • cooldown name:buff_nithramus
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • nithramus_1:14.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187616
  • name:Nithramus
  • tooltip:$?$w1>0[Damage dealt increased by $w1%. When this effect ends, the triggering ally will explode for $w1% of all damage dealt while empowered.][Contributing toward the master's Savage Hollows.]
  • description:{$@spelldesc187611=Awakens the powers of all the Savage Hallows worn by you and your allies, increasing damage dealt by ${$<WarlordsTrinketNerf>*$m1/100}% for {$187620d=15 seconds}. When this effect ends, each empowered player unleashes a blast of light that strikes all enemies within $187626A1 yards of the initiating player's location, inflicting damage equal to ${$m1/100}% of all damage they dealt while empowered. (2 min shared cooldown)}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Potion of Deadly Grace 2.0 0.0 89.2sec 0.0sec 10.83% 10.89% 0.0(0.0) 2.0

Buff details

  • buff initial source:Dèmonos
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:10.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Voidsight 7.2 2.1 59.8sec 44.9sec 27.00% 27.05% 2.1(2.1) 6.9

Buff details

  • buff initial source:Dèmonos
  • cooldown name:buff_voidsight
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1102.73
  • stat:haste_rating
  • amount:1102.73
  • stat:mastery_rating
  • amount:1102.73

Stack Uptimes

  • voidsight_1:27.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201410
  • name:Voidsight
  • tooltip:Critical Strike, Haste and Mastery increased by {$s1=1145}. Damage against Demons increased by {$s2=10}%.
  • description:Increases Critical Strike, Haste and Mastery by {$s1=1145}. Damage against Demons increased by {$s2=10}%.
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Dèmonos
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Dèmonos
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Demonic Power

Buff details

  • buff initial source:Dèmonos
  • cooldown name:buff_demonic_power
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • demonic_power_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196099
  • name:Demonic Power
  • tooltip:Your spells sometimes deal additional Shadow damage.
  • description:{$@spelldesc108503=Sacrifice your demon to gain Demonic Power, causing your spells to sometimes also deal {$196100s1=0} Shadow damage to the target and other enemies within $196100A1 yds. Lasts {$196099d=3600 seconds} or until you summon a demon.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Dèmonos
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Dèmonos
chaos_bolt Soul Shard 51.8 103.7 2.0 2.0 153422.6
conflagrate Mana 42.4 932402.5 22000.0 21999.9 4.2
immolate Mana 25.5 1684249.8 66000.0 66000.5 3.9
incinerate Mana 146.3 9654869.4 66000.0 66454.3 1.5
summon_doomguard Soul Shard 2.9 2.9 1.0 1.0 0.0
pet - doomguard
doom_bolt Energy 26.1 915.2 35.0 35.0 1556.6
Resource Gains Type Count Total Average Overflow
immolate Soul Shard 30.92 30.69 (29.28%) 0.99 0.23 0.74%
conflagrate Soul Shard 42.38 42.38 (40.43%) 1.00 0.00 0.01%
mp5_regen Mana 530.17 4525240.74 (37.36%) 8535.46 916052.08 16.84%
soul_conduit Soul Shard 21.38 21.38 (20.40%) 1.00 0.00 0.00%
reverse_entropy Mana 51.85 7586921.20 (62.64%) 146336.53 12373676.39 61.99%
soulsnatcher Soul Shard 10.38 10.38 (9.90%) 1.00 0.00 0.04%
pet - doomguard
energy_regen Energy 26.15 812.91 (100.00%) 31.09 128.30 13.63%
Resource RPS-Gain RPS-Loss
Mana 26890.84 27244.59
Soul Shard 0.23 0.24
Combat End Resource Mean Min Max
Mana 934945.53 413087.51 1100000.00
Soul Shard 1.22 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 15.5%

Procs

Count Interval
shadowy_tear 6.6 63.1sec
chaos_tear 6.6 63.3sec
chaos_portal 6.6 63.0sec
dimension_ripper 7.3 52.3sec
soul_conduit 21.4 22.3sec

Statistics & Data Analysis

Fight Length
Sample Data Dèmonos Fight Length
Count 9999
Mean 450.42
Minimum 350.15
Maximum 555.44
Spread ( max - min ) 205.29
Range [ ( max - min ) / 2 * 100% ] 22.79%
DPS
Sample Data Dèmonos Damage Per Second
Count 9999
Mean 125060.64
Minimum 112359.11
Maximum 140959.32
Spread ( max - min ) 28600.22
Range [ ( max - min ) / 2 * 100% ] 11.43%
Standard Deviation 3641.8968
5th Percentile 119309.86
95th Percentile 131335.37
( 95th Percentile - 5th Percentile ) 12025.51
Mean Distribution
Standard Deviation 36.4208
95.00% Confidence Intervall ( 124989.26 - 125132.03 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 32
0.1% Error 3257
0.1 Scale Factor Error with Delta=300 113224
0.05 Scale Factor Error with Delta=300 452896
0.01 Scale Factor Error with Delta=300 11322411
Priority Target DPS
Sample Data Dèmonos Priority Target Damage Per Second
Count 9999
Mean 125060.64
Minimum 112359.11
Maximum 140959.32
Spread ( max - min ) 28600.22
Range [ ( max - min ) / 2 * 100% ] 11.43%
Standard Deviation 3641.8968
5th Percentile 119309.86
95th Percentile 131335.37
( 95th Percentile - 5th Percentile ) 12025.51
Mean Distribution
Standard Deviation 36.4208
95.00% Confidence Intervall ( 124989.26 - 125132.03 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 32
0.1% Error 3257
0.1 Scale Factor Error with Delta=300 113224
0.05 Scale Factor Error with Delta=300 452896
0.01 Scale Factor Error with Delta=300 11322411
DPS(e)
Sample Data Dèmonos Damage Per Second (Effective)
Count 9999
Mean 125060.64
Minimum 112359.11
Maximum 140959.32
Spread ( max - min ) 28600.22
Range [ ( max - min ) / 2 * 100% ] 11.43%
Damage
Sample Data Dèmonos Damage
Count 9999
Mean 47720507.17
Minimum 35444614.47
Maximum 63556855.58
Spread ( max - min ) 28112241.10
Range [ ( max - min ) / 2 * 100% ] 29.46%
DTPS
Sample Data Dèmonos Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Dèmonos Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Dèmonos Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Dèmonos Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Dèmonos Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Dèmonos Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data DèmonosTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Dèmonos Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies<3
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>=3
5 0.00 augmentation,type=defiled
6 0.00 snapshot_stats
7 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
8 0.00 potion,name=deadly_grace
9 0.00 mana_tap,if=talent.mana_tap.enabled&!buff.mana_tap.remains
A 0.00 incinerate
Default action list Executed every time the actor is available.
# count action,conditions
B 4.32 use_item,name=nithramus_the_allseer
C 1.00 dimensional_rift,if=charges=3
D 6.97 immolate,if=remains<=tick_time
0.00 immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&(action.conflagrate.charges=2|(action.conflagrate.charges>=1&action.conflagrate.recharge_time<cast_time+gcd))
0.00 berserking
0.00 blood_fury
0.00 arcane_torrent
E 1.00 potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=30)
0.00 conflagrate,if=talent.roaring_blaze.enabled&(charges=2|(action.conflagrate.charges>=1&action.conflagrate.recharge_time<gcd))
0.00 conflagrate,if=talent.roaring_blaze.enabled&prev_gcd.conflagrate
0.00 conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack=2
0.00 conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack=3&buff.bloodlust.remains
F 42.38 conflagrate,if=!talent.roaring_blaze.enabled&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 conflagrate,if=!talent.roaring_blaze.enabled&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
0.00 service_pet
0.00 summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
G 2.95 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<3
0.00 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>=3
0.00 soul_harvest
0.00 channel_demonfire,if=dot.immolate.remains>cast_time
H 2.43 chaos_bolt,if=soul_shard>3
I 18.76 dimensional_rift
0.00 mana_tap,if=buff.mana_tap.remains<=buff.mana_tap.duration*0.3&(mana.pct<20|buff.mana_tap.remains<=action.chaos_bolt.cast_time)&target.time_to_die>buff.mana_tap.duration*0.3
J 49.60 chaos_bolt
0.00 cataclysm
0.00 conflagrate,if=!talent.roaring_blaze.enabled
K 18.63 immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
0.00 life_tap,if=talent.mana_tap.enabled&mana.pct<=10
L 145.82 incinerate
0.00 life_tap

Sample Sequence

012578ABCDFFGHIIJFLLLLKLLFJLLJLFLJLJKLFLLLLJILFJJHDHEFHHJJJFJDLLLFLLJLKLIFJLLLLLFLKLLLLFJLLBLLKFJLLLLIFJJLKLLFJLLLLLFJDLLLLFLLILKIFJLLLLLFGKLLLLFJLLLLKLFJLLJILFJJKLILFBLLLJLFJDLLLLFJJLLJDFILLIJLFLKJJLLFJLLLLKFLLILLIFJLIKLLFJLLLJLFJDJJJFJJLLKIBFLLLLLLFGJJDJLFJLLLLKFJLLLLLFIJJKLJFJLLLLLFKLLLILFJLLL

Sample Sequence Table

time name target resources buffs
Pre flask Dèmonos 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre food Dèmonos 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre summon_imp Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre augmentation Dèmonos 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre grimoire_of_sacrifice Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard potion_of_deadly_grace
0:00.000 incinerate Fluffy_Pillow 1034000.0/1100000: 94% mana | 3.0/5: 60% soul_shard voidsight, potion_of_deadly_grace
0:00.000 use_item_nithramus_the_allseer Fluffy_Pillow 1034000.0/1100000: 94% mana | 3.0/5: 60% soul_shard voidsight, potion_of_deadly_grace
0:00.000 dimensional_rift Fluffy_Pillow 1034000.0/1100000: 94% mana | 3.0/5: 60% soul_shard nithramus, voidsight, potion_of_deadly_grace
0:01.287 immolate Fluffy_Pillow 1054146.5/1100000: 96% mana | 3.0/5: 60% soul_shard bloodlust, nithramus, voidsight, potion_of_deadly_grace
0:02.346 conflagrate Fluffy_Pillow 1004724.0/1100000: 91% mana | 3.0/5: 60% soul_shard bloodlust, nithramus, voidsight, potion_of_deadly_grace
0:03.404 conflagrate Fluffy_Pillow 999285.8/1100000: 91% mana | 4.0/5: 80% soul_shard bloodlust, backdraft, nithramus, voidsight, potion_of_deadly_grace
0:04.463 summon_doomguard Fluffy_Pillow 993863.3/1100000: 90% mana | 5.0/5: 100% soul_shard bloodlust, backdraft, nithramus, voidsight, potion_of_deadly_grace
0:05.520 chaos_bolt Fluffy_Pillow 1010409.4/1100000: 92% mana | 4.0/5: 80% soul_shard bloodlust, backdraft, nithramus, voidsight, potion_of_deadly_grace
0:06.753 dimensional_rift Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, backdraft, nithramus, voidsight, potion_of_deadly_grace
0:07.812 dimensional_rift Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, nithramus, voidsight, potion_of_deadly_grace
0:08.870 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, nithramus, voidsight, potion_of_deadly_grace
0:10.631 conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard bloodlust, nithramus, voidsight, potion_of_deadly_grace
0:11.836 incinerate Fluffy_Pillow 1094546.2/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, backdraft, nithramus, voidsight, potion_of_deadly_grace
0:12.825 incinerate Fluffy_Pillow 1034093.9/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, backdraft, nithramus, voidsight, potion_of_deadly_grace
0:13.812 incinerate Fluffy_Pillow 983544.3/1100000: 89% mana | 1.0/5: 20% soul_shard bloodlust, backdraft, nithramus, voidsight, potion_of_deadly_grace
0:14.801 incinerate Fluffy_Pillow 933026.0/1100000: 85% mana | 1.0/5: 20% soul_shard bloodlust, nithramus, voidsight, potion_of_deadly_grace
0:16.211 immolate Fluffy_Pillow 888498.5/1100000: 81% mana | 1.0/5: 20% soul_shard bloodlust, potion_of_deadly_grace
0:17.304 incinerate Fluffy_Pillow 839067.2/1100000: 76% mana | 1.0/5: 20% soul_shard bloodlust, potion_of_deadly_grace
0:18.760 incinerate Fluffy_Pillow 795138.5/1100000: 72% mana | 1.0/5: 20% soul_shard bloodlust, potion_of_deadly_grace
0:20.216 conflagrate Fluffy_Pillow 751209.8/1100000: 68% mana | 1.0/5: 20% soul_shard bloodlust, potion_of_deadly_grace
0:21.309 chaos_bolt Fluffy_Pillow 745778.5/1100000: 68% mana | 2.0/5: 40% soul_shard bloodlust, backdraft, potion_of_deadly_grace
0:22.582 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, backdraft, potion_of_deadly_grace
0:23.602 incinerate Fluffy_Pillow 1034075.8/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, backdraft
0:24.622 chaos_bolt Fluffy_Pillow 983537.9/1100000: 89% mana | 2.0/5: 40% soul_shard bloodlust
0:26.442 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard bloodlust
0:27.897 conflagrate Fluffy_Pillow 1034060.6/1100000: 94% mana | 0.0/5: 0% soul_shard bloodlust
0:29.148 incinerate Fluffy_Pillow 1031024.4/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, backdraft
0:30.167 chaos_bolt Fluffy_Pillow 980471.3/1100000: 89% mana | 2.0/5: 40% soul_shard bloodlust, backdraft
0:31.440 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, backdraft
0:32.459 chaos_bolt Fluffy_Pillow 1034060.6/1100000: 94% mana | 2.0/5: 40% soul_shard bloodlust
0:34.275 immolate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard bloodlust
0:35.368 incinerate Fluffy_Pillow 1034075.8/1100000: 94% mana | 0.0/5: 0% soul_shard bloodlust
0:36.823 conflagrate Fluffy_Pillow 990132.0/1100000: 90% mana | 0.0/5: 0% soul_shard bloodlust
0:37.916 incinerate Fluffy_Pillow 984700.6/1100000: 90% mana | 1.0/5: 20% soul_shard bloodlust, backdraft
0:38.935 incinerate Fluffy_Pillow 934147.5/1100000: 85% mana | 1.0/5: 20% soul_shard bloodlust, backdraft
0:39.955 incinerate Fluffy_Pillow 883609.6/1100000: 80% mana | 1.0/5: 20% soul_shard bloodlust, backdraft
0:40.975 incinerate Fluffy_Pillow 833071.6/1100000: 76% mana | 1.0/5: 20% soul_shard bloodlust
0:42.430 chaos_bolt Fluffy_Pillow 784037.9/1100000: 71% mana | 2.0/5: 40% soul_shard
0:44.791 dimensional_rift Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard
0:46.421 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard
0:48.312 conflagrate Fluffy_Pillow 1034058.3/1100000: 94% mana | 1.0/5: 20% soul_shard
0:49.731 chaos_bolt Fluffy_Pillow 1028604.8/1100000: 94% mana | 3.0/5: 60% soul_shard backdraft
0:51.386 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard backdraft
0:53.040 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 5.0/5: 100% soul_shard
0:55.403 immolate Fluffy_Pillow 1100000.0/1100000: 100% mana | 5.0/5: 100% soul_shard
0:56.824 chaos_bolt Fluffy_Pillow 1034072.2/1100000: 94% mana | 5.0/5: 100% soul_shard voidsight
0:59.113 potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 5.0/5: 100% soul_shard voidsight
0:59.113 conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 5.0/5: 100% soul_shard voidsight, potion_of_deadly_grace
1:00.488 chaos_bolt Fluffy_Pillow 1094557.0/1100000: 100% mana | 5.0/5: 100% soul_shard backdraft, voidsight, potion_of_deadly_grace
1:02.091 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 4.0/5: 80% soul_shard backdraft, voidsight, potion_of_deadly_grace
1:03.692 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard voidsight, potion_of_deadly_grace
1:05.980 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard voidsight, potion_of_deadly_grace
1:08.269 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard voidsight, potion_of_deadly_grace
1:10.556 conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard voidsight, potion_of_deadly_grace
1:11.936 chaos_bolt Fluffy_Pillow 1094572.3/1100000: 100% mana | 2.0/5: 40% soul_shard backdraft, potion_of_deadly_grace
1:13.590 immolate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard backdraft, potion_of_deadly_grace
1:15.008 incinerate Fluffy_Pillow 1034035.0/1100000: 94% mana | 0.0/5: 0% soul_shard backdraft, potion_of_deadly_grace
1:16.333 incinerate Fluffy_Pillow 983485.4/1100000: 89% mana | 0.0/5: 0% soul_shard potion_of_deadly_grace
1:18.222 incinerate Fluffy_Pillow 939512.4/1100000: 85% mana | 0.0/5: 0% soul_shard potion_of_deadly_grace
1:20.113 conflagrate Fluffy_Pillow 895562.7/1100000: 81% mana | 0.0/5: 0% soul_shard potion_of_deadly_grace
1:21.695 incinerate Fluffy_Pillow 892009.9/1100000: 81% mana | 1.0/5: 20% soul_shard backdraft, potion_of_deadly_grace
1:23.018 incinerate Fluffy_Pillow 841437.0/1100000: 76% mana | 1.0/5: 20% soul_shard backdraft, potion_of_deadly_grace
1:24.344 chaos_bolt Fluffy_Pillow 790899.1/1100000: 72% mana | 2.0/5: 40% soul_shard backdraft
1:25.997 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard
1:27.887 immolate Fluffy_Pillow 1034046.6/1100000: 94% mana | 1.0/5: 20% soul_shard
1:29.307 incinerate Fluffy_Pillow 984604.8/1100000: 90% mana | 1.0/5: 20% soul_shard
1:31.197 dimensional_rift Fluffy_Pillow 940643.5/1100000: 86% mana | 1.0/5: 20% soul_shard
1:32.616 conflagrate Fluffy_Pillow 957190.0/1100000: 87% mana | 1.0/5: 20% soul_shard
1:34.035 chaos_bolt Fluffy_Pillow 951736.5/1100000: 87% mana | 2.0/5: 40% soul_shard backdraft
1:35.689 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard backdraft
1:37.015 incinerate Fluffy_Pillow 1034070.0/1100000: 94% mana | 0.0/5: 0% soul_shard backdraft
1:38.341 incinerate Fluffy_Pillow 983532.0/1100000: 89% mana | 0.0/5: 0% soul_shard
1:40.233 incinerate Fluffy_Pillow 939594.0/1100000: 85% mana | 0.0/5: 0% soul_shard
1:42.123 incinerate Fluffy_Pillow 895632.7/1100000: 81% mana | 0.0/5: 0% soul_shard
1:44.013 conflagrate Fluffy_Pillow 851671.4/1100000: 77% mana | 0.0/5: 0% soul_shard
1:45.433 incinerate Fluffy_Pillow 846229.5/1100000: 77% mana | 1.0/5: 20% soul_shard backdraft
1:46.758 immolate Fluffy_Pillow 795679.9/1100000: 72% mana | 1.0/5: 20% soul_shard backdraft
1:48.178 incinerate Fluffy_Pillow 746238.1/1100000: 68% mana | 1.0/5: 20% soul_shard backdraft
1:49.504 incinerate Fluffy_Pillow 695700.2/1100000: 63% mana | 1.0/5: 20% soul_shard
1:51.393 incinerate Fluffy_Pillow 651727.2/1100000: 59% mana | 1.0/5: 20% soul_shard
1:53.284 incinerate Fluffy_Pillow 607777.5/1100000: 55% mana | 1.0/5: 20% soul_shard
1:55.174 conflagrate Fluffy_Pillow 563816.2/1100000: 51% mana | 1.0/5: 20% soul_shard
1:56.594 chaos_bolt Fluffy_Pillow 558374.4/1100000: 51% mana | 2.0/5: 40% soul_shard backdraft
1:58.247 incinerate Fluffy_Pillow 962649.5/1100000: 88% mana | 0.0/5: 0% soul_shard backdraft
1:59.570 incinerate Fluffy_Pillow 912076.5/1100000: 83% mana | 0.0/5: 0% soul_shard backdraft
2:00.893 use_item_nithramus_the_allseer Fluffy_Pillow 861503.6/1100000: 78% mana | 0.0/5: 0% soul_shard
2:00.893 incinerate Fluffy_Pillow 861503.6/1100000: 78% mana | 0.0/5: 0% soul_shard nithramus
2:02.782 incinerate Fluffy_Pillow 817530.6/1100000: 74% mana | 0.0/5: 0% soul_shard nithramus
2:04.674 immolate Fluffy_Pillow 773592.6/1100000: 70% mana | 1.0/5: 20% soul_shard nithramus
2:06.094 conflagrate Fluffy_Pillow 724150.8/1100000: 66% mana | 1.0/5: 20% soul_shard nithramus
2:07.514 chaos_bolt Fluffy_Pillow 718708.9/1100000: 65% mana | 2.0/5: 40% soul_shard backdraft, nithramus
2:09.169 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard backdraft, nithramus
2:10.493 incinerate Fluffy_Pillow 1034046.6/1100000: 94% mana | 1.0/5: 20% soul_shard backdraft, nithramus
2:11.819 incinerate Fluffy_Pillow 983511.0/1100000: 89% mana | 1.0/5: 20% soul_shard nithramus, voidsight
2:13.649 incinerate Fluffy_Pillow 939546.8/1100000: 85% mana | 1.0/5: 20% soul_shard nithramus, voidsight
2:15.481 dimensional_rift Fluffy_Pillow 895606.8/1100000: 81% mana | 2.0/5: 40% soul_shard nithramus, voidsight
2:16.855 conflagrate Fluffy_Pillow 912151.7/1100000: 83% mana | 2.0/5: 40% soul_shard voidsight
2:18.230 chaos_bolt Fluffy_Pillow 906708.7/1100000: 82% mana | 3.0/5: 60% soul_shard backdraft, voidsight
2:19.832 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard backdraft, voidsight
2:21.435 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard voidsight
2:23.265 immolate Fluffy_Pillow 1034036.1/1100000: 94% mana | 1.0/5: 20% soul_shard voidsight
2:24.640 incinerate Fluffy_Pillow 984593.1/1100000: 90% mana | 1.0/5: 20% soul_shard voidsight
2:26.471 incinerate Fluffy_Pillow 940641.0/1100000: 86% mana | 1.0/5: 20% soul_shard voidsight
2:28.303 conflagrate Fluffy_Pillow 896700.9/1100000: 82% mana | 1.0/5: 20% soul_shard voidsight
2:29.678 chaos_bolt Fluffy_Pillow 891257.9/1100000: 81% mana | 2.0/5: 40% soul_shard backdraft, voidsight
2:31.281 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard backdraft, voidsight
2:32.565 incinerate Fluffy_Pillow 1034070.0/1100000: 94% mana | 0.0/5: 0% soul_shard backdraft
2:33.890 incinerate Fluffy_Pillow 983520.4/1100000: 89% mana | 0.0/5: 0% soul_shard
2:35.779 incinerate Fluffy_Pillow 939547.4/1100000: 85% mana | 0.0/5: 0% soul_shard
2:37.670 incinerate Fluffy_Pillow 895597.7/1100000: 81% mana | 0.0/5: 0% soul_shard
2:39.561 conflagrate Fluffy_Pillow 851648.1/1100000: 77% mana | 1.0/5: 20% soul_shard
2:40.981 chaos_bolt Fluffy_Pillow 846206.2/1100000: 77% mana | 2.0/5: 40% soul_shard backdraft
2:42.635 immolate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard backdraft
2:44.057 incinerate Fluffy_Pillow 1034081.6/1100000: 94% mana | 0.0/5: 0% soul_shard backdraft
2:45.380 incinerate Fluffy_Pillow 983508.7/1100000: 89% mana | 0.0/5: 0% soul_shard
2:47.272 incinerate Fluffy_Pillow 939570.7/1100000: 85% mana | 0.0/5: 0% soul_shard
2:49.162 incinerate Fluffy_Pillow 895609.4/1100000: 81% mana | 0.0/5: 0% soul_shard
2:51.051 conflagrate Fluffy_Pillow 851636.4/1100000: 77% mana | 0.0/5: 0% soul_shard
2:52.470 incinerate Fluffy_Pillow 846182.9/1100000: 77% mana | 1.0/5: 20% soul_shard backdraft
2:53.794 incinerate Fluffy_Pillow 795621.6/1100000: 72% mana | 1.0/5: 20% soul_shard backdraft
2:55.118 dimensional_rift Fluffy_Pillow 745060.4/1100000: 68% mana | 1.0/5: 20% soul_shard backdraft
2:56.538 incinerate Fluffy_Pillow 761618.5/1100000: 69% mana | 1.0/5: 20% soul_shard
2:58.428 immolate Fluffy_Pillow 717657.2/1100000: 65% mana | 1.0/5: 20% soul_shard
2:59.847 dimensional_rift Fluffy_Pillow 668203.7/1100000: 61% mana | 1.0/5: 20% soul_shard
3:01.422 conflagrate Fluffy_Pillow 686569.3/1100000: 62% mana | 1.0/5: 20% soul_shard
3:02.921 chaos_bolt Fluffy_Pillow 682048.6/1100000: 62% mana | 2.0/5: 40% soul_shard backdraft
3:04.575 incinerate Fluffy_Pillow 1086335.4/1100000: 99% mana | 0.0/5: 0% soul_shard backdraft
3:05.898 incinerate Fluffy_Pillow 1034035.0/1100000: 94% mana | 0.0/5: 0% soul_shard backdraft
3:07.224 incinerate Fluffy_Pillow 983497.0/1100000: 89% mana | 0.0/5: 0% soul_shard
3:09.114 incinerate Fluffy_Pillow 939535.7/1100000: 85% mana | 0.0/5: 0% soul_shard
3:11.005 incinerate Fluffy_Pillow 895586.1/1100000: 81% mana | 0.0/5: 0% soul_shard
3:12.896 conflagrate Fluffy_Pillow 851636.4/1100000: 77% mana | 0.0/5: 0% soul_shard
3:14.315 summon_doomguard Fluffy_Pillow 846182.9/1100000: 77% mana | 1.0/5: 20% soul_shard backdraft
3:15.734 immolate Fluffy_Pillow 862729.4/1100000: 78% mana | 1.0/5: 20% soul_shard backdraft
3:17.153 incinerate Fluffy_Pillow 813275.9/1100000: 74% mana | 1.0/5: 20% soul_shard backdraft
3:18.477 incinerate Fluffy_Pillow 762714.6/1100000: 69% mana | 1.0/5: 20% soul_shard
3:20.367 incinerate Fluffy_Pillow 718753.3/1100000: 65% mana | 1.0/5: 20% soul_shard
3:22.258 incinerate Fluffy_Pillow 674803.7/1100000: 61% mana | 1.0/5: 20% soul_shard
3:24.148 conflagrate Fluffy_Pillow 630842.3/1100000: 57% mana | 1.0/5: 20% soul_shard
3:25.568 chaos_bolt Fluffy_Pillow 625400.5/1100000: 57% mana | 3.0/5: 60% soul_shard backdraft
3:27.222 incinerate Fluffy_Pillow 1029687.3/1100000: 94% mana | 1.0/5: 20% soul_shard backdraft
3:28.548 incinerate Fluffy_Pillow 979149.3/1100000: 89% mana | 1.0/5: 20% soul_shard backdraft
3:29.872 incinerate Fluffy_Pillow 928588.1/1100000: 84% mana | 1.0/5: 20% soul_shard
3:31.763 incinerate Fluffy_Pillow 884638.4/1100000: 80% mana | 1.0/5: 20% soul_shard
3:33.653 immolate Fluffy_Pillow 840677.1/1100000: 76% mana | 1.0/5: 20% soul_shard
3:35.072 incinerate Fluffy_Pillow 791223.6/1100000: 72% mana | 1.0/5: 20% soul_shard
3:36.961 conflagrate Fluffy_Pillow 747250.6/1100000: 68% mana | 2.0/5: 40% soul_shard
3:38.381 chaos_bolt Fluffy_Pillow 741808.8/1100000: 67% mana | 3.0/5: 60% soul_shard backdraft
3:40.035 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard backdraft
3:41.360 incinerate Fluffy_Pillow 1034058.3/1100000: 94% mana | 1.0/5: 20% soul_shard backdraft
3:42.684 chaos_bolt Fluffy_Pillow 983497.0/1100000: 89% mana | 2.0/5: 40% soul_shard
3:45.046 dimensional_rift Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard
3:46.465 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard
3:48.355 conflagrate Fluffy_Pillow 1034048.2/1100000: 94% mana | 1.0/5: 20% soul_shard voidsight
3:49.731 chaos_bolt Fluffy_Pillow 1028617.2/1100000: 94% mana | 2.0/5: 40% soul_shard backdraft, voidsight
3:51.333 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard backdraft, voidsight
3:52.935 immolate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard voidsight
3:54.309 incinerate Fluffy_Pillow 1034048.2/1100000: 94% mana | 0.0/5: 0% soul_shard voidsight
3:56.140 dimensional_rift Fluffy_Pillow 990096.1/1100000: 90% mana | 0.0/5: 0% soul_shard voidsight
3:57.515 incinerate Fluffy_Pillow 1006653.0/1100000: 92% mana | 0.0/5: 0% soul_shard voidsight
3:59.345 conflagrate Fluffy_Pillow 962688.9/1100000: 88% mana | 0.0/5: 0% soul_shard voidsight
4:00.720 use_item_nithramus_the_allseer Fluffy_Pillow 957245.9/1100000: 87% mana | 1.0/5: 20% soul_shard backdraft, voidsight
4:00.893 incinerate Fluffy_Pillow 959329.0/1100000: 87% mana | 1.0/5: 20% soul_shard backdraft, nithramus, voidsight
4:02.176 incinerate Fluffy_Pillow 908778.2/1100000: 83% mana | 1.0/5: 20% soul_shard backdraft, nithramus, voidsight
4:03.458 incinerate Fluffy_Pillow 858174.6/1100000: 78% mana | 1.0/5: 20% soul_shard backdraft, nithramus
4:04.782 chaos_bolt Fluffy_Pillow 807613.4/1100000: 73% mana | 2.0/5: 40% soul_shard nithramus
4:07.146 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard nithramus
4:09.036 conflagrate Fluffy_Pillow 1034046.6/1100000: 94% mana | 1.0/5: 20% soul_shard nithramus
4:10.669 chaos_bolt Fluffy_Pillow 1031088.5/1100000: 94% mana | 2.0/5: 40% soul_shard backdraft, nithramus
4:12.324 immolate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard backdraft, nithramus
4:13.742 incinerate Fluffy_Pillow 1034035.0/1100000: 94% mana | 1.0/5: 20% soul_shard backdraft, nithramus
4:15.066 incinerate Fluffy_Pillow 983473.7/1100000: 89% mana | 1.0/5: 20% soul_shard nithramus
4:16.957 incinerate Fluffy_Pillow 939524.1/1100000: 85% mana | 1.0/5: 20% soul_shard
4:18.849 incinerate Fluffy_Pillow 895586.1/1100000: 81% mana | 1.0/5: 20% soul_shard
4:20.739 conflagrate Fluffy_Pillow 851624.7/1100000: 77% mana | 1.0/5: 20% soul_shard
4:22.159 chaos_bolt Fluffy_Pillow 846182.9/1100000: 77% mana | 2.0/5: 40% soul_shard backdraft
4:23.814 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard backdraft
4:25.470 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard
4:27.361 incinerate Fluffy_Pillow 1034058.3/1100000: 94% mana | 1.0/5: 20% soul_shard
4:29.252 chaos_bolt Fluffy_Pillow 990108.6/1100000: 90% mana | 2.0/5: 40% soul_shard
4:31.613 immolate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard
4:33.034 conflagrate Fluffy_Pillow 1034070.0/1100000: 94% mana | 0.0/5: 0% soul_shard
4:34.452 dimensional_rift Fluffy_Pillow 1028604.8/1100000: 94% mana | 1.0/5: 20% soul_shard backdraft
4:35.870 incinerate Fluffy_Pillow 1045139.6/1100000: 95% mana | 1.0/5: 20% soul_shard backdraft
4:37.196 incinerate Fluffy_Pillow 994601.7/1100000: 90% mana | 1.0/5: 20% soul_shard backdraft
4:38.523 dimensional_rift Fluffy_Pillow 944075.4/1100000: 86% mana | 1.0/5: 20% soul_shard
4:39.944 chaos_bolt Fluffy_Pillow 960645.2/1100000: 87% mana | 2.0/5: 40% soul_shard
4:42.306 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard
4:44.198 conflagrate Fluffy_Pillow 1034072.2/1100000: 94% mana | 0.0/5: 0% soul_shard voidsight
4:45.574 incinerate Fluffy_Pillow 1028641.3/1100000: 94% mana | 1.0/5: 20% soul_shard backdraft, voidsight
4:46.858 immolate Fluffy_Pillow 978102.5/1100000: 89% mana | 1.0/5: 20% soul_shard backdraft, voidsight
4:48.233 chaos_bolt Fluffy_Pillow 928659.5/1100000: 84% mana | 2.0/5: 40% soul_shard backdraft, voidsight
4:49.834 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard voidsight
4:52.122 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard voidsight
4:53.952 incinerate Fluffy_Pillow 1034036.1/1100000: 94% mana | 1.0/5: 20% soul_shard voidsight
4:55.785 conflagrate Fluffy_Pillow 990108.1/1100000: 90% mana | 1.0/5: 20% soul_shard voidsight
4:57.160 chaos_bolt Fluffy_Pillow 984665.1/1100000: 90% mana | 2.0/5: 40% soul_shard backdraft, voidsight
4:58.764 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard backdraft, voidsight
5:00.048 incinerate Fluffy_Pillow 1034070.0/1100000: 94% mana | 0.0/5: 0% soul_shard backdraft
5:01.374 incinerate Fluffy_Pillow 983532.0/1100000: 89% mana | 0.0/5: 0% soul_shard
5:03.263 incinerate Fluffy_Pillow 939559.0/1100000: 85% mana | 0.0/5: 0% soul_shard
5:05.154 immolate Fluffy_Pillow 895609.4/1100000: 81% mana | 0.0/5: 0% soul_shard
5:06.574 conflagrate Fluffy_Pillow 846167.5/1100000: 77% mana | 0.0/5: 0% soul_shard
5:07.995 incinerate Fluffy_Pillow 840737.4/1100000: 76% mana | 1.0/5: 20% soul_shard backdraft
5:09.319 incinerate Fluffy_Pillow 790176.1/1100000: 72% mana | 1.0/5: 20% soul_shard backdraft
5:10.645 dimensional_rift Fluffy_Pillow 739638.2/1100000: 67% mana | 1.0/5: 20% soul_shard backdraft
5:12.065 incinerate Fluffy_Pillow 756196.3/1100000: 69% mana | 1.0/5: 20% soul_shard
5:13.955 incinerate Fluffy_Pillow 712235.0/1100000: 65% mana | 1.0/5: 20% soul_shard
5:15.844 dimensional_rift Fluffy_Pillow 668262.0/1100000: 61% mana | 1.0/5: 20% soul_shard
5:17.265 conflagrate Fluffy_Pillow 684831.8/1100000: 62% mana | 1.0/5: 20% soul_shard
5:18.684 chaos_bolt Fluffy_Pillow 679378.3/1100000: 62% mana | 2.0/5: 40% soul_shard backdraft
5:20.338 incinerate Fluffy_Pillow 1083665.1/1100000: 99% mana | 1.0/5: 20% soul_shard backdraft
5:21.663 dimensional_rift Fluffy_Pillow 1033115.5/1100000: 94% mana | 1.0/5: 20% soul_shard backdraft
5:23.083 immolate Fluffy_Pillow 1049673.7/1100000: 95% mana | 1.0/5: 20% soul_shard
5:24.503 incinerate Fluffy_Pillow 1000233.7/1100000: 91% mana | 1.0/5: 20% soul_shard voidsight
5:26.336 incinerate Fluffy_Pillow 956305.7/1100000: 87% mana | 1.0/5: 20% soul_shard voidsight
5:28.167 conflagrate Fluffy_Pillow 912353.6/1100000: 83% mana | 1.0/5: 20% soul_shard voidsight
5:29.589 chaos_bolt Fluffy_Pillow 907476.5/1100000: 82% mana | 2.0/5: 40% soul_shard backdraft, voidsight
5:31.192 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard backdraft, voidsight
5:32.473 incinerate Fluffy_Pillow 1034036.1/1100000: 94% mana | 1.0/5: 20% soul_shard backdraft, voidsight
5:33.756 incinerate Fluffy_Pillow 983485.3/1100000: 89% mana | 1.0/5: 20% soul_shard voidsight
5:35.586 chaos_bolt Fluffy_Pillow 939521.1/1100000: 85% mana | 2.0/5: 40% soul_shard voidsight
5:37.874 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard voidsight
5:39.704 conflagrate Fluffy_Pillow 1034035.0/1100000: 94% mana | 1.0/5: 20% soul_shard
5:41.120 chaos_bolt Fluffy_Pillow 1028546.5/1100000: 94% mana | 3.0/5: 60% soul_shard backdraft
5:42.774 immolate Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard backdraft
5:44.193 chaos_bolt Fluffy_Pillow 1034046.6/1100000: 94% mana | 3.0/5: 60% soul_shard backdraft
5:45.848 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
5:48.211 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
5:50.572 conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard
5:51.992 chaos_bolt Fluffy_Pillow 1094558.2/1100000: 100% mana | 3.0/5: 60% soul_shard backdraft
5:53.644 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard backdraft
5:55.301 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard
5:57.192 incinerate Fluffy_Pillow 1034058.3/1100000: 94% mana | 0.0/5: 0% soul_shard
5:59.082 immolate Fluffy_Pillow 990097.0/1100000: 90% mana | 0.0/5: 0% soul_shard
6:00.502 dimensional_rift Fluffy_Pillow 940655.1/1100000: 86% mana | 0.0/5: 0% soul_shard
6:01.922 use_item_nithramus_the_allseer Fluffy_Pillow 957213.3/1100000: 87% mana | 0.0/5: 0% soul_shard
6:01.922 conflagrate Fluffy_Pillow 957213.3/1100000: 87% mana | 0.0/5: 0% soul_shard nithramus
6:03.342 incinerate Fluffy_Pillow 951771.5/1100000: 87% mana | 1.0/5: 20% soul_shard backdraft, nithramus
6:04.668 incinerate Fluffy_Pillow 901233.5/1100000: 82% mana | 1.0/5: 20% soul_shard backdraft, nithramus
6:05.992 incinerate Fluffy_Pillow 850672.3/1100000: 77% mana | 1.0/5: 20% soul_shard backdraft, nithramus
6:07.317 incinerate Fluffy_Pillow 800122.7/1100000: 73% mana | 1.0/5: 20% soul_shard nithramus
6:09.207 incinerate Fluffy_Pillow 756161.3/1100000: 69% mana | 1.0/5: 20% soul_shard nithramus
6:11.098 incinerate Fluffy_Pillow 712211.7/1100000: 65% mana | 1.0/5: 20% soul_shard nithramus
6:12.989 conflagrate Fluffy_Pillow 668262.0/1100000: 61% mana | 1.0/5: 20% soul_shard nithramus
6:14.406 summon_doomguard Fluffy_Pillow 662785.2/1100000: 60% mana | 2.0/5: 40% soul_shard backdraft, nithramus
6:15.825 chaos_bolt Fluffy_Pillow 679331.7/1100000: 62% mana | 2.0/5: 40% soul_shard backdraft, nithramus
6:17.481 chaos_bolt Fluffy_Pillow 1083641.8/1100000: 99% mana | 3.0/5: 60% soul_shard backdraft
6:19.137 immolate Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
6:20.557 chaos_bolt Fluffy_Pillow 1034058.3/1100000: 94% mana | 3.0/5: 60% soul_shard
6:22.918 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard
6:24.809 conflagrate Fluffy_Pillow 1034058.3/1100000: 94% mana | 1.0/5: 20% soul_shard
6:26.228 chaos_bolt Fluffy_Pillow 1028604.8/1100000: 94% mana | 2.0/5: 40% soul_shard backdraft
6:27.883 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard backdraft
6:29.209 incinerate Fluffy_Pillow 1034072.2/1100000: 94% mana | 1.0/5: 20% soul_shard backdraft, voidsight
6:30.492 incinerate Fluffy_Pillow 983521.4/1100000: 89% mana | 1.0/5: 20% soul_shard voidsight
6:32.323 incinerate Fluffy_Pillow 939569.3/1100000: 85% mana | 1.0/5: 20% soul_shard voidsight
6:34.155 immolate Fluffy_Pillow 895629.2/1100000: 81% mana | 1.0/5: 20% soul_shard voidsight
6:35.532 conflagrate Fluffy_Pillow 846210.3/1100000: 77% mana | 2.0/5: 40% soul_shard voidsight
6:36.906 chaos_bolt Fluffy_Pillow 840755.3/1100000: 76% mana | 3.0/5: 60% soul_shard backdraft, voidsight
6:38.507 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard backdraft, voidsight
6:39.789 incinerate Fluffy_Pillow 1034048.2/1100000: 94% mana | 1.0/5: 20% soul_shard backdraft, voidsight
6:41.071 incinerate Fluffy_Pillow 983485.3/1100000: 89% mana | 1.0/5: 20% soul_shard voidsight
6:42.902 incinerate Fluffy_Pillow 939533.2/1100000: 85% mana | 1.0/5: 20% soul_shard voidsight
6:44.734 incinerate Fluffy_Pillow 895390.9/1100000: 81% mana | 1.0/5: 20% soul_shard
6:46.626 conflagrate Fluffy_Pillow 851452.9/1100000: 77% mana | 1.0/5: 20% soul_shard
6:48.045 dimensional_rift Fluffy_Pillow 845999.4/1100000: 77% mana | 2.0/5: 40% soul_shard backdraft
6:49.464 chaos_bolt Fluffy_Pillow 862545.9/1100000: 78% mana | 3.0/5: 60% soul_shard backdraft
6:51.119 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard backdraft
6:52.772 immolate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard
6:54.190 incinerate Fluffy_Pillow 1034035.0/1100000: 94% mana | 1.0/5: 20% soul_shard
6:56.082 chaos_bolt Fluffy_Pillow 990097.0/1100000: 90% mana | 2.0/5: 40% soul_shard
6:58.446 conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard
6:59.867 chaos_bolt Fluffy_Pillow 1094569.8/1100000: 100% mana | 2.0/5: 40% soul_shard backdraft
7:01.521 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard backdraft
7:02.844 incinerate Fluffy_Pillow 1034035.0/1100000: 94% mana | 0.0/5: 0% soul_shard backdraft
7:04.168 incinerate Fluffy_Pillow 983473.7/1100000: 89% mana | 0.0/5: 0% soul_shard
7:06.059 incinerate Fluffy_Pillow 939524.1/1100000: 85% mana | 0.0/5: 0% soul_shard
7:07.949 incinerate Fluffy_Pillow 895562.7/1100000: 81% mana | 0.0/5: 0% soul_shard
7:09.840 conflagrate Fluffy_Pillow 851613.1/1100000: 77% mana | 0.0/5: 0% soul_shard
7:11.260 immolate Fluffy_Pillow 846171.2/1100000: 77% mana | 1.0/5: 20% soul_shard backdraft
7:12.680 incinerate Fluffy_Pillow 796729.4/1100000: 72% mana | 1.0/5: 20% soul_shard backdraft
7:14.004 incinerate Fluffy_Pillow 746168.1/1100000: 68% mana | 1.0/5: 20% soul_shard backdraft
7:15.329 incinerate Fluffy_Pillow 695618.5/1100000: 63% mana | 1.0/5: 20% soul_shard
7:17.221 dimensional_rift Fluffy_Pillow 651680.5/1100000: 59% mana | 1.0/5: 20% soul_shard
7:18.639 incinerate Fluffy_Pillow 668215.4/1100000: 61% mana | 1.0/5: 20% soul_shard
7:20.528 conflagrate Fluffy_Pillow 624242.4/1100000: 57% mana | 1.0/5: 20% soul_shard
7:21.949 chaos_bolt Fluffy_Pillow 618812.2/1100000: 56% mana | 2.0/5: 40% soul_shard backdraft
7:23.605 incinerate Fluffy_Pillow 1023122.3/1100000: 93% mana | 1.0/5: 20% soul_shard backdraft
7:24.931 incinerate Fluffy_Pillow 972584.4/1100000: 88% mana | 1.0/5: 20% soul_shard backdraft
7:26.255 incinerate Fluffy_Pillow 922023.1/1100000: 84% mana | 1.0/5: 20% soul_shard

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4200 3875 0
Agility 7252 6927 0
Stamina 21478 21478 12418
Intellect 23238 21531 13179 (665)
Spirit 0 0 0
Health 1288680 1288680 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 23238 21531 0
Crit 16.05% 16.05% 3868
Haste 6.01% 4.83% 1570
Damage / Heal Versatility 2.69% 2.69% 1077
ManaReg per Second 11661 11531 0
Mastery 81.39% 81.39% 6697
Armor 1328 1328 1328
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 797.00
Local Head Visage of the Black Harvest
ilevel: 810, stats: { 183 Armor, +1340 Sta, +894 Int, +755 Haste, +369 Mastery }
Local Neck Depleted Mana Crystal Pendant
ilevel: 815, stats: { +790 Sta, +1104 Mastery, +506 Crit }
Local Shoulders Mana-Flecked Mantle
ilevel: 800, stats: { 163 Armor, +611 Int, +916 Sta, +581 Mastery, +232 Crit }
Local Chest Ravencourt Formal Robes
ilevel: 840, stats: { 251 Armor, +1182 Int, +1773 Sta, +791 Mastery, +467 Crit }
Local Waist Snowblind Cord
ilevel: 680, stats: { 70 Armor, +200 Int, +300 Sta, +76 Haste, +190 Mastery }
Local Legs Bonespeaker Leggings
ilevel: 815, stats: { 201 Armor, +936 Int, +1404 Sta, +818 Crit, +327 Mastery }
Local Feet Footwraps of the Receding Nightmare
ilevel: 680, stats: { 86 Armor, +200 Int, +300 Sta, +76 Crit, +190 Haste }
Local Wrists Wristbands of the Black Harvest
ilevel: 810, stats: { 99 Armor, +754 Sta, +503 Int, +411 Mastery, +221 Vers }
Local Hands Vault-Minder's Handwraps
ilevel: 825, stats: { 149 Armor, +771 Int, +1157 Sta, +637 Vers, +254 Crit }
Local Finger1 Demar's Band of Amore
ilevel: 835, stats: { +952 Sta, +1737 Mastery }
Local Finger2 Nithramus, the All-Seer
ilevel: 780, stats: { +380 Int, +570 Sta, +286 Mastery, +198 Vers }, enchant: { +150 Crit }
Local Trinket1 Leycoral Shard
ilevel: 820, stats: { +933 Int, +834 Crit }
Local Trinket2 Orb of Voidsight
ilevel: 815, stats: { +890 Int }
Local Back Cloak of Unwavering Loyalty
ilevel: 840, stats: { 126 Armor, +665 StrAgiInt, +997 Sta, +455 Crit, +252 Mastery }
Local Main Hand Scepter of Sargeras
ilevel: 795, weapon: { 2009 - 3015, 3.6 }, stats: { +777 Int, +1165 Sta, +518 Haste, +518 Mastery, +4237 Int }, relics: { +25 ilevels, +20 ilevels }

Talents

Level
15 Backdraft (Destruction Warlock) Roaring Blaze (Destruction Warlock) Shadowburn (Destruction Warlock)
30 Reverse Entropy (Destruction Warlock) Cataclysm (Destruction Warlock) Mana Tap
45 Demon Skin Mortal Coil Shadowfury
60 Eradication (Destruction Warlock) Fire and Brimstone (Destruction Warlock) Soul Harvest
75 Demonic Circle Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Wreak Havoc (Destruction Warlock) Channel Demonfire (Destruction Warlock) Soul Conduit

Profile

warlock="Dèmonos"
origin="https://eu.api.battle.net/wow/character/hyjal/Dèmonos/advanced"
thumbnail="http://eu.battle.net/static-render/eu/hyjal/26/121914138-avatar.jpg"
level=110
race=human
role=spell
position=back
professions=tailoring=9/enchanting=610
talents=http://eu.battle.net/wow/en/tool/talent-calculator#Vb!0000122
artifact=38:0:0:0:0:803:1:804:3:805:3:808:3:811:2:814:1:816:1:1355:1
spec=destruction

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies<3
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>=3
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/mana_tap,if=talent.mana_tap.enabled&!buff.mana_tap.remains
actions.precombat+=/incinerate

# Executed every time the actor is available.
actions=use_item,name=nithramus_the_allseer
actions+=/dimensional_rift,if=charges=3
actions+=/immolate,if=remains<=tick_time
actions+=/immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&(action.conflagrate.charges=2|(action.conflagrate.charges>=1&action.conflagrate.recharge_time<cast_time+gcd))
actions+=/berserking
actions+=/blood_fury
actions+=/arcane_torrent
actions+=/potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=30)
actions+=/conflagrate,if=talent.roaring_blaze.enabled&(charges=2|(action.conflagrate.charges>=1&action.conflagrate.recharge_time<gcd))
actions+=/conflagrate,if=talent.roaring_blaze.enabled&prev_gcd.conflagrate
actions+=/conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack=2
actions+=/conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack=3&buff.bloodlust.remains
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/service_pet
actions+=/summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<3
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>=3
actions+=/soul_harvest
actions+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions+=/chaos_bolt,if=soul_shard>3
actions+=/dimensional_rift
actions+=/mana_tap,if=buff.mana_tap.remains<=buff.mana_tap.duration*0.3&(mana.pct<20|buff.mana_tap.remains<=action.chaos_bolt.cast_time)&target.time_to_die>buff.mana_tap.duration*0.3
actions+=/chaos_bolt
actions+=/cataclysm
actions+=/conflagrate,if=!talent.roaring_blaze.enabled
actions+=/immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
actions+=/life_tap,if=talent.mana_tap.enabled&mana.pct<=10
actions+=/incinerate
actions+=/life_tap

head=visage_of_the_black_harvest,id=139765,bonus_id=3386/3381
neck=depleted_mana_crystal_pendant,id=134319,bonus_id=3394/1477/1675
shoulders=manaflecked_mantle,id=121754
back=cloak_of_unwavering_loyalty,id=134412,bonus_id=1727/1492/1813
chest=ravencourt_formal_robes,id=139246,bonus_id=1727/1808/1492/1813
wrists=wristbands_of_the_black_harvest,id=139770,bonus_id=3385/3381
hands=vaultminders_handwraps,id=136763,bonus_id=1826/1487/3338
waist=snowblind_cord,id=121678,bonus_id=767
legs=bonespeaker_leggings,id=134218,bonus_id=3394/1477/1675
feet=footwraps_of_the_receding_nightmare,id=141548,bonus_id=1793
finger1=demars_band_of_amore,id=141581,bonus_id=1497
finger2=nithramus_the_allseer,id=124635,bonus_id=649/636,enchant=150crit
trinket1=leycoral_shard,id=134248,bonus_id=1825/603/1482/3339
trinket2=orb_of_voidsight,id=133596
main_hand=scepter_of_sargeras,id=128941,gem_id=133139/132848/0/0,relic_id=1793:1605:1809/1793:1741:1585:1809/0/0

# Gear Summary
# gear_ilvl=797.33
# gear_stamina=12418
# gear_intellect=13179
# gear_crit_rating=3792
# gear_haste_rating=1539
# gear_mastery_rating=6566
# gear_versatility_rating=1056
# gear_armor=1328
# set_bonus=tier19oh_2pc=1
default_pet=imp

Eldiabløød

Eldiabløød : 154054 dps

  • Race: Human
  • Class: Warlock
  • Spec: Destruction
  • Level: 110
  • Role: Spell
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
154054.5 154054.5 76.8 / 0.050% 15502.0 / 10.1% 4.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
26292.8 26292.8 Mana 0.00% 38.4 100.0% 100%
Origin https://eu.api.battle.net/wow/character/hyjal/Eldiabløød/advanced
Talents
  • 15: Roaring Blaze (Destruction Warlock)
  • 30: Reverse Entropy (Destruction Warlock)
  • 45: Demon Skin
  • 60: Eradication (Destruction Warlock)
  • 75: Burning Rush
  • 90: Grimoire of Service
  • 100: Soul Conduit
  • Talent Calculator
Artifact
Professions
  • enchanting: 712

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Eldiabløød 154054
Chaos Bolt 36561 23.7% 47.1 9.37sec 349260 161421 Direct 46.9 0 351121 351121 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.12 46.87 0.00 0.00 2.1637 0.0000 16457659.93 16457659.93 0.00 161420.82 161420.82
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 46.87 100.00% 351121.14 233482 510937 350975.15 317130 387584 16457660 16457660 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:116858
  • school:chromatic
  • resource:soul_shard
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:soul_shard>3
Spelldata
  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.300000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Conflagrate 9941 6.5% 43.9 10.23sec 101859 78388 Direct 43.9 83875 167947 101859 21.4%  

Stats details: conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.93 43.93 0.00 0.00 1.2994 0.0000 4474398.03 4474398.03 0.00 78388.19 78388.19
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.53 78.61% 83874.68 55336 121095 83870.10 73957 93766 2896250 2896250 0.00
crit 9.40 21.39% 167947.34 110680 242187 167877.32 0 217629 1578148 1578148 0.00
 
 

Action details: conflagrate

Static Values
  • id:17962
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:22000.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.roaring_blaze.enabled&(charges=2|(action.conflagrate.charges>=1&action.conflagrate.recharge_time<gcd))
Spelldata
  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=1} Fire damage.{$?s196406=false}[ Reduces the cast time of Incinerate and Chaos Bolt by {$117828s1=30}% for {$117828d=5 seconds}.][] |cFFFFFFFFGenerates 1 Soul Shard.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.041000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Deadly Grace 3216 2.1% 18.3 8.82sec 77800 0 Direct 18.3 64215 128431 77804 21.2%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.33 18.33 0.00 0.00 0.0000 0.0000 1425812.19 1425812.19 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.45 78.85% 64215.30 64215 64215 64215.30 64215 64215 927888 927888 0.00
crit 3.88 21.15% 128430.60 128431 128431 126478.26 0 128431 497924 497924 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:5.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=47572 to 71358} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:47572.00
  • base_dd_max:71358.00
 
Immolate 24704 16.0% 29.2 15.57sec 381252 293439 Direct 29.2 52272 104583 63462 21.4%  
Periodic 175.4 43534 87098 52847 21.4% 99.1%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.17 29.17 175.42 175.42 1.2993 2.5442 11121634.73 11121634.73 0.00 22968.67 293439.08
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 22.93 78.61% 52272.00 34488 75470 52270.42 44898 59100 1198614 1198614 0.00
crit 6.24 21.39% 104583.03 68974 150940 104559.54 0 141057 652660 652660 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 137.9 78.62% 43534.23 18 99800 43545.11 40430 46935 6004260 6004260 0.00
crit 37.5 21.38% 87098.45 33 199591 87117.19 67789 105664 3266101 3266101 0.00
 
 

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=tick_time
Spelldata
  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=1} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFF{$193541s1=15}% chance to generate 1 Soul Shard. Chance doubled on critical strikes.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.650000
  • base_td:0.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Incinerate 34548 22.5% 134.6 3.22sec 115593 71634 Direct 135.0 94966 189870 115236 21.4%  

Stats details: incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 134.62 135.04 0.00 0.00 1.6137 0.0000 15561425.01 15561425.01 0.00 71633.73 71633.73
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 106.20 78.64% 94966.11 62058 135806 94987.84 89472 102310 10084896 10084896 0.00
crit 28.84 21.36% 189869.93 124117 271612 189933.90 167118 214849 5476529 5476529 0.00
 
 

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.84
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.100000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - imp 11753 / 11753
Firebolt 11753 7.6% 133.1 3.38sec 39742 26218 Direct 132.4 32927 65847 39952 21.3%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 133.10 132.40 0.00 0.00 1.5158 0.0000 5289661.13 5289661.13 0.00 26218.11 26218.11
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 104.15 78.66% 32927.32 21377 35211 32927.32 32539 33338 3429419 3429419 0.00
crit 28.25 21.34% 65847.29 42755 70421 65847.84 63527 68220 1860243 1860243 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?c3[ Damage increased by {$s2=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.820000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - service_imp 33990 / 10426
Firebolt 33990 6.8% 58.6 7.23sec 80146 54148 Direct 58.3 66372 132742 80559 21.4%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.60 58.30 0.00 0.00 1.4801 0.0000 4696798.20 4696798.20 0.00 54148.01 54148.01
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 45.84 78.62% 66371.76 42755 70421 66356.94 64921 67626 3042422 3042422 0.00
crit 12.46 21.38% 132742.05 85510 140842 132700.37 122229 140842 1654376 1654376 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?c3[ Damage increased by {$s2=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.820000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - doomguard 26204 / 4108
Doom Bolt 26204 2.7% 28.3 13.45sec 65199 27021 Direct 28.2 53928 107838 65440 21.4%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.26 28.15 0.00 0.00 2.4130 0.0000 1842274.21 1842274.21 0.00 27020.74 27020.74
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 22.14 78.65% 53927.50 49532 65267 53840.87 50636 58212 1193973 1193973 0.00
crit 6.01 21.35% 107837.56 99064 130534 107469.97 0 130534 648302 648302 0.00
 
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.900000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - shadowy_tear 44349 / 7577
Shadow Bolt 44349 4.9% 6.4 66.63sec 530260 0 Periodic 53.2 52704 105329 63993 21.5% 19.6%

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.42 0.00 53.42 53.22 0.0000 1.6497 3405577.75 3405577.75 0.00 38643.54 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.8 78.55% 52703.74 234 57252 52705.30 42062 57252 2203027 2203027 0.00
crit 11.4 21.45% 105329.39 468 114503 105112.58 0 114503 1202551 1202551 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:196657
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196657
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - chaos_tear 67709 / 4593
Chaos Bolt 67709 3.0% 6.3 64.62sec 325709 125640 Direct 6.3 0 327305 327305 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.34 6.30 0.00 0.00 2.5925 0.0000 2063639.81 2063639.81 0.00 125640.17 125640.17
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 6.30 100.00% 327305.45 316418 347447 327386.29 316418 347447 2063640 2063640 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:215279
  • school:chromatic
  • resource:none
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.500
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215279
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:5.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - chaos_portal 98066 / 6642
Chaos Barrage 98066 4.3% 6.4 66.16sec 466269 0 Periodic 166.7 14720 29440 17881 21.5% 7.7%

Stats details: chaos_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.39 0.00 167.29 166.70 0.0000 0.2081 2980755.84 2980755.84 0.00 85604.71 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 130.9 78.53% 14720.45 65 15745 14715.12 0 15745 1926949 1926949 0.00
crit 35.8 21.47% 29439.59 129 31490 29429.65 0 31490 1053807 1053807 0.00
 
 

Action details: chaos_barrage

Static Values
  • id:187394
  • school:magic
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187394
  • name:Chaos Barrage
  • school:magic
  • tooltip:
  • description:Deals {$s1=1} Chaos damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.50
  • base_tick_time:0.25
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Eldiabløød
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Eldiabløød
  • harmful:false
  • if_expr:
 
Dimensional Rift 19.2 24.76sec

Stats details: dimensional_rift

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.20 0.00 0.00 0.00 1.3008 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dimensional_rift

Static Values
  • id:196586
  • school:chaos
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=3
Spelldata
  • id:196586
  • name:Dimensional Rift
  • school:chaos
  • tooltip:
  • description:Rips a hole in time and space, opening a portal that damages your target.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Eldiabløød
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Eldiabløød
  • harmful:false
  • if_expr:
 
Life Tap 0.0 0.00sec

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 1.3416 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mana_tap.enabled&mana.pct<=10
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:
  • description:Restores {$s1=30}% of your maximum mana, at the cost of {$s2=10}% of your maximum health.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Grimoire: Imp (service_imp) 5.3 93.13sec

Stats details: service_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.27 0.00 0.00 0.00 1.2831 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: service_imp

Static Values
  • id:111859
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:111859
  • name:Grimoire: Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp who attacks the target for {$108501s1=25} sec. Imps cast ranged Firebolts and cleanse a hostile magic effect from their master.
 
Summon Doomguard 2.9 184.65sec

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.89 0.00 0.00 0.00 1.2349 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&active_enemies<3
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:
  • description:Summons a Doomguard for {$60478d=25 seconds} to assault the target with its Doom Bolts.
 
Summon Imp 1.0 0.00sec

Stats details: summon_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_imp

Static Values
  • id:688
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
Spelldata
  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.$?s74434[ |cFFFFFFFFSoulburn:|r |cFF8282FFInstant cast.|r][]
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 11.18% 0.0(0.0) 1.0

Buff details

  • buff initial source:Eldiabløød
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Potion of Deadly Grace 2.0 0.0 122.0sec 0.0sec 10.83% 10.89% 0.0(0.0) 2.0

Buff details

  • buff initial source:Eldiabløød
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:10.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Valarjar's Path 4.3 0.0 120.6sec 120.7sec 27.55% 27.61% 0.0(0.0) 4.0

Buff details

  • buff initial source:Eldiabløød
  • cooldown name:buff_valarjars_path
  • max_stacks:1
  • duration:30.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:2344.80

Stack Uptimes

  • valarjars_path_1:27.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:215956
  • name:Valarjar's Path
  • tooltip:Primary stat increased by {$s4=2039}.
  • description:Sound the horn, increasing your primary stat by {$215956s1=2039} for {$215956d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:120.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Eldiabløød
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Eldiabløød
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Eldiabløød
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Eldiabløød
chaos_bolt Soul Shard 47.1 94.2 2.0 2.0 174624.4
conflagrate Mana 43.9 966384.1 22000.0 21999.6 4.6
immolate Mana 29.2 1925297.9 66000.0 65999.7 5.8
incinerate Mana 135.6 8951010.1 66000.0 66489.6 1.7
service_imp Soul Shard 5.3 5.3 1.0 1.0 0.0
summon_doomguard Soul Shard 2.9 2.9 1.0 1.0 0.0
pet - imp
firebolt Energy 133.1 5324.0 40.0 40.0 993.5
pet - service_imp
firebolt Energy 58.6 2344.1 40.0 40.0 2003.7
pet - doomguard
doom_bolt Energy 28.3 989.0 35.0 35.0 1862.7
Resource Gains Type Count Total Average Overflow
immolate Soul Shard 31.91 31.79 (31.56%) 1.00 0.12 0.37%
conflagrate Soul Shard 43.93 43.74 (43.42%) 1.00 0.19 0.44%
life_tap Mana 0.00 923.35 (0.01%) 330000.00 0.00 0.00%
mp5_regen Mana 497.67 4749599.58 (40.74%) 9543.70 954119.37 16.73%
soul_conduit Soul Shard 20.50 20.50 (20.36%) 1.00 0.00 0.00%
reverse_entropy Mana 47.12 6906784.49 (59.25%) 146569.24 11235575.86 61.93%
soulsnatcher Soul Shard 4.70 4.70 (4.66%) 1.00 0.00 0.07%
pet - imp
energy_regen Energy 2749.18 5157.95 (100.00%) 1.88 22.74 0.44%
pet - service_imp
energy_regen Energy 543.20 1511.13 (100.00%) 2.78 91.84 5.73%
pet - doomguard
energy_regen Energy 28.26 888.50 (100.00%) 31.44 128.56 12.64%
Resource RPS-Gain RPS-Loss
Health 0.92 0.95
Mana 25881.27 26292.78
Soul Shard 0.22 0.23
Combat End Resource Mean Min Max
Mana 908378.65 242809.02 1100000.00
Soul Shard 1.30 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 15.5%

Procs

Count Interval
shadowy_tear 6.4 64.7sec
chaos_tear 6.4 64.6sec
chaos_portal 6.4 64.9sec
dimension_ripper 6.7 55.8sec
soul_conduit 20.5 23.1sec

Statistics & Data Analysis

Fight Length
Sample Data Eldiabløød Fight Length
Count 9999
Mean 450.42
Minimum 350.15
Maximum 555.44
Spread ( max - min ) 205.29
Range [ ( max - min ) / 2 * 100% ] 22.79%
DPS
Sample Data Eldiabløød Damage Per Second
Count 9999
Mean 154054.48
Minimum 139931.44
Maximum 169729.39
Spread ( max - min ) 29797.95
Range [ ( max - min ) / 2 * 100% ] 9.67%
Standard Deviation 3918.0632
5th Percentile 147862.95
95th Percentile 160702.85
( 95th Percentile - 5th Percentile ) 12839.91
Mean Distribution
Standard Deviation 39.1826
95.00% Confidence Intervall ( 153977.68 - 154131.28 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 24
0.1% Error 2484
0.1 Scale Factor Error with Delta=300 131046
0.05 Scale Factor Error with Delta=300 524187
0.01 Scale Factor Error with Delta=300 13104683
Priority Target DPS
Sample Data Eldiabløød Priority Target Damage Per Second
Count 9999
Mean 154054.48
Minimum 139931.44
Maximum 169729.39
Spread ( max - min ) 29797.95
Range [ ( max - min ) / 2 * 100% ] 9.67%
Standard Deviation 3918.0632
5th Percentile 147862.95
95th Percentile 160702.85
( 95th Percentile - 5th Percentile ) 12839.91
Mean Distribution
Standard Deviation 39.1826
95.00% Confidence Intervall ( 153977.68 - 154131.28 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 24
0.1% Error 2484
0.1 Scale Factor Error with Delta=300 131046
0.05 Scale Factor Error with Delta=300 524187
0.01 Scale Factor Error with Delta=300 13104683
DPS(e)
Sample Data Eldiabløød Damage Per Second (Effective)
Count 9999
Mean 154054.48
Minimum 139931.44
Maximum 169729.39
Spread ( max - min ) 29797.95
Range [ ( max - min ) / 2 * 100% ] 9.67%
Damage
Sample Data Eldiabløød Damage
Count 9999
Mean 49040929.89
Minimum 36547085.24
Maximum 65873670.00
Spread ( max - min ) 29326584.76
Range [ ( max - min ) / 2 * 100% ] 29.90%
DTPS
Sample Data Eldiabløød Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Eldiabløød Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Eldiabløød Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Eldiabløød Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Eldiabløød Healing Taken Per Second
Count 9999
Mean 0.93
Minimum 0.00
Maximum 429.75
Spread ( max - min ) 429.75
Range [ ( max - min ) / 2 * 100% ] 23155.89%
TMI
Sample Data Eldiabløød Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data EldiabløødTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Eldiabløød Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies<3
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>=3
5 0.00 augmentation,type=defiled
6 0.00 snapshot_stats
7 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
8 0.00 potion,name=deadly_grace
9 0.00 mana_tap,if=talent.mana_tap.enabled&!buff.mana_tap.remains
A 0.00 incinerate
Default action list Executed every time the actor is available.
# count action,conditions
B 4.31 use_item,name=horn_of_valor
C 1.00 dimensional_rift,if=charges=3
D 14.77 immolate,if=remains<=tick_time
E 14.49 immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&(action.conflagrate.charges=2|(action.conflagrate.charges>=1&action.conflagrate.recharge_time<cast_time+gcd))
0.00 berserking
0.00 blood_fury
0.00 arcane_torrent
F 1.00 potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=30)
G 14.45 conflagrate,if=talent.roaring_blaze.enabled&(charges=2|(action.conflagrate.charges>=1&action.conflagrate.recharge_time<gcd))
H 14.40 conflagrate,if=talent.roaring_blaze.enabled&prev_gcd.conflagrate
I 14.08 conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack=2
J 1.00 conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack=3&buff.bloodlust.remains
0.00 conflagrate,if=!talent.roaring_blaze.enabled&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 conflagrate,if=!talent.roaring_blaze.enabled&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
K 5.27 service_pet
0.00 summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
L 2.89 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<3
0.00 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>=3
0.00 soul_harvest
0.00 channel_demonfire,if=dot.immolate.remains>cast_time
M 4.52 chaos_bolt,if=soul_shard>3
N 18.20 dimensional_rift
0.00 mana_tap,if=buff.mana_tap.remains<=buff.mana_tap.duration*0.3&(mana.pct<20|buff.mana_tap.remains<=action.chaos_bolt.cast_time)&target.time_to_die>buff.mana_tap.duration*0.3
O 42.83 chaos_bolt
0.00 cataclysm
0.00 conflagrate,if=!talent.roaring_blaze.enabled
0.00 immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
0.00 life_tap,if=talent.mana_tap.enabled&mana.pct<=10
P 135.10 incinerate
Q 0.00 life_tap

Sample Sequence

01258ABCDEGHKLMNNOIPPPPPJOPPDPPPPPOEGHMOPPPINOOPPDPOPPEGHMOPPPIPPPPPDNNOOEGHKOPPPPIOPPPDBPFPPPPEGHONOPOIPPPPNDPPPPPEGHNOPPPIOPPNPDPLPPPEGHKPPPPOIOPPPDPPPNPEGHNOPPPPIBOPPPDPPPNPEGHMOPPOINPPPPDPPPPKEGHOPPPPIPPPPPDPNPPOEGHMOOPIOPPPPDOOPPEGHMNBOPPILPOOPDKPPPPEGHOOOPIOPPNPDPOPPPEGHOOOPIOPPOPDPPO

Sample Sequence Table

time name target resources buffs
Pre flask Eldiabløød 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre food Eldiabløød 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre summon_imp Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre augmentation Eldiabløød 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard potion_of_deadly_grace
0:00.000 incinerate Fluffy_Pillow 1034000.0/1100000: 94% mana | 3.0/5: 60% soul_shard potion_of_deadly_grace
0:00.000 use_item_horn_of_valor Fluffy_Pillow 1034000.0/1100000: 94% mana | 3.0/5: 60% soul_shard potion_of_deadly_grace
0:00.000 dimensional_rift Fluffy_Pillow 1034000.0/1100000: 94% mana | 3.0/5: 60% soul_shard valarjars_path, potion_of_deadly_grace
0:01.263 immolate Fluffy_Pillow 1054249.9/1100000: 96% mana | 3.0/5: 60% soul_shard bloodlust, valarjars_path, potion_of_deadly_grace
0:02.297 immolate Fluffy_Pillow 1004828.2/1100000: 91% mana | 3.0/5: 60% soul_shard bloodlust, valarjars_path, potion_of_deadly_grace
0:03.330 conflagrate Fluffy_Pillow 955390.4/1100000: 87% mana | 3.0/5: 60% soul_shard bloodlust, valarjars_path, potion_of_deadly_grace
0:04.363 conflagrate Fluffy_Pillow 949952.7/1100000: 86% mana | 4.0/5: 80% soul_shard bloodlust, valarjars_path, potion_of_deadly_grace
0:05.398 service_imp Fluffy_Pillow 944547.0/1100000: 86% mana | 5.0/5: 100% soul_shard bloodlust, valarjars_path, potion_of_deadly_grace
0:06.430 summon_doomguard Fluffy_Pillow 961093.2/1100000: 87% mana | 4.0/5: 80% soul_shard bloodlust, valarjars_path, potion_of_deadly_grace
0:07.465 chaos_bolt Fluffy_Pillow 977687.5/1100000: 89% mana | 4.0/5: 80% soul_shard bloodlust, valarjars_path, potion_of_deadly_grace
0:09.185 dimensional_rift Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, valarjars_path, potion_of_deadly_grace
0:10.217 dimensional_rift Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, valarjars_path, potion_of_deadly_grace
0:11.251 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, valarjars_path, potion_of_deadly_grace
0:12.970 conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard bloodlust, valarjars_path, potion_of_deadly_grace
0:14.005 incinerate Fluffy_Pillow 1094594.3/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, valarjars_path, potion_of_deadly_grace
0:15.271 incinerate Fluffy_Pillow 1034064.1/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, valarjars_path, potion_of_deadly_grace
0:16.537 incinerate Fluffy_Pillow 988362.1/1100000: 90% mana | 1.0/5: 20% soul_shard bloodlust, valarjars_path, potion_of_deadly_grace
0:17.804 incinerate Fluffy_Pillow 942676.1/1100000: 86% mana | 1.0/5: 20% soul_shard bloodlust, valarjars_path, potion_of_deadly_grace
0:19.069 incinerate Fluffy_Pillow 896958.1/1100000: 82% mana | 1.0/5: 20% soul_shard bloodlust, valarjars_path, potion_of_deadly_grace
0:20.334 conflagrate Fluffy_Pillow 851240.0/1100000: 77% mana | 1.0/5: 20% soul_shard bloodlust, valarjars_path, potion_of_deadly_grace
0:21.368 chaos_bolt Fluffy_Pillow 845818.3/1100000: 77% mana | 2.0/5: 40% soul_shard bloodlust, valarjars_path, potion_of_deadly_grace
0:23.088 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, valarjars_path
0:24.355 incinerate Fluffy_Pillow 1034080.2/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, valarjars_path
0:25.621 immolate Fluffy_Pillow 988378.1/1100000: 90% mana | 1.0/5: 20% soul_shard bloodlust, valarjars_path
0:26.656 incinerate Fluffy_Pillow 938972.5/1100000: 85% mana | 1.0/5: 20% soul_shard bloodlust, valarjars_path
0:27.924 incinerate Fluffy_Pillow 893302.5/1100000: 81% mana | 1.0/5: 20% soul_shard bloodlust, valarjars_path
0:29.190 incinerate Fluffy_Pillow 847600.5/1100000: 77% mana | 1.0/5: 20% soul_shard bloodlust, valarjars_path
0:30.455 incinerate Fluffy_Pillow 801882.4/1100000: 73% mana | 1.0/5: 20% soul_shard bloodlust
0:31.720 incinerate Fluffy_Pillow 756164.4/1100000: 69% mana | 1.0/5: 20% soul_shard bloodlust
0:32.987 chaos_bolt Fluffy_Pillow 710478.4/1100000: 65% mana | 2.0/5: 40% soul_shard bloodlust
0:34.706 immolate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust
0:35.738 conflagrate Fluffy_Pillow 1034048.1/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust
0:36.771 conflagrate Fluffy_Pillow 1028610.4/1100000: 94% mana | 2.0/5: 40% soul_shard bloodlust
0:37.806 chaos_bolt Fluffy_Pillow 1023204.7/1100000: 93% mana | 4.0/5: 80% soul_shard bloodlust
0:39.525 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard bloodlust
0:41.246 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard
0:42.891 incinerate Fluffy_Pillow 1034049.3/1100000: 94% mana | 1.0/5: 20% soul_shard
0:44.537 incinerate Fluffy_Pillow 988349.8/1100000: 90% mana | 1.0/5: 20% soul_shard
0:46.182 conflagrate Fluffy_Pillow 942637.9/1100000: 86% mana | 1.0/5: 20% soul_shard
0:47.522 dimensional_rift Fluffy_Pillow 937164.4/1100000: 85% mana | 3.0/5: 60% soul_shard
0:48.863 chaos_bolt Fluffy_Pillow 953703.2/1100000: 87% mana | 3.0/5: 60% soul_shard
0:51.096 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard
0:53.328 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard
0:54.972 incinerate Fluffy_Pillow 1034037.0/1100000: 94% mana | 1.0/5: 20% soul_shard
0:56.617 immolate Fluffy_Pillow 988325.1/1100000: 90% mana | 1.0/5: 20% soul_shard
0:57.958 incinerate Fluffy_Pillow 938863.9/1100000: 85% mana | 1.0/5: 20% soul_shard
0:59.603 chaos_bolt Fluffy_Pillow 893152.0/1100000: 81% mana | 2.0/5: 40% soul_shard
1:01.838 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard
1:03.486 incinerate Fluffy_Pillow 1034086.3/1100000: 94% mana | 1.0/5: 20% soul_shard
1:05.132 immolate Fluffy_Pillow 988386.8/1100000: 90% mana | 1.0/5: 20% soul_shard
1:06.473 conflagrate Fluffy_Pillow 938925.6/1100000: 85% mana | 1.0/5: 20% soul_shard
1:07.814 conflagrate Fluffy_Pillow 933464.4/1100000: 85% mana | 3.0/5: 60% soul_shard
1:09.156 chaos_bolt Fluffy_Pillow 928015.6/1100000: 84% mana | 4.0/5: 80% soul_shard
1:11.390 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard
1:13.622 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard
1:15.268 incinerate Fluffy_Pillow 1034061.7/1100000: 94% mana | 0.0/5: 0% soul_shard
1:16.914 incinerate Fluffy_Pillow 988362.1/1100000: 90% mana | 0.0/5: 0% soul_shard
1:18.560 conflagrate Fluffy_Pillow 942662.6/1100000: 86% mana | 0.0/5: 0% soul_shard
1:19.902 incinerate Fluffy_Pillow 937213.7/1100000: 85% mana | 1.0/5: 20% soul_shard
1:21.547 incinerate Fluffy_Pillow 891501.8/1100000: 81% mana | 1.0/5: 20% soul_shard
1:23.192 incinerate Fluffy_Pillow 845789.9/1100000: 77% mana | 1.0/5: 20% soul_shard
1:24.838 incinerate Fluffy_Pillow 800090.4/1100000: 73% mana | 1.0/5: 20% soul_shard
1:26.483 incinerate Fluffy_Pillow 754378.5/1100000: 69% mana | 1.0/5: 20% soul_shard
1:28.128 immolate Fluffy_Pillow 708666.6/1100000: 64% mana | 1.0/5: 20% soul_shard
1:29.470 dimensional_rift Fluffy_Pillow 659217.8/1100000: 60% mana | 2.0/5: 40% soul_shard
1:30.811 dimensional_rift Fluffy_Pillow 675756.6/1100000: 61% mana | 3.0/5: 60% soul_shard
1:32.151 chaos_bolt Fluffy_Pillow 692283.1/1100000: 63% mana | 3.0/5: 60% soul_shard
1:34.384 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard
1:36.615 immolate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard
1:37.957 conflagrate Fluffy_Pillow 1034061.7/1100000: 94% mana | 2.0/5: 40% soul_shard
1:39.298 conflagrate Fluffy_Pillow 1028600.5/1100000: 94% mana | 3.0/5: 60% soul_shard
1:40.639 service_imp Fluffy_Pillow 1023139.3/1100000: 93% mana | 4.0/5: 80% soul_shard
1:41.979 chaos_bolt Fluffy_Pillow 1039665.8/1100000: 95% mana | 3.0/5: 60% soul_shard
1:44.211 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard
1:45.858 incinerate Fluffy_Pillow 1034074.0/1100000: 94% mana | 1.0/5: 20% soul_shard
1:47.503 incinerate Fluffy_Pillow 988362.1/1100000: 90% mana | 1.0/5: 20% soul_shard
1:49.150 incinerate Fluffy_Pillow 942674.9/1100000: 86% mana | 1.0/5: 20% soul_shard
1:50.795 conflagrate Fluffy_Pillow 896963.0/1100000: 82% mana | 1.0/5: 20% soul_shard
1:52.137 chaos_bolt Fluffy_Pillow 891514.2/1100000: 81% mana | 2.0/5: 40% soul_shard
1:54.370 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard
1:56.018 incinerate Fluffy_Pillow 1034086.3/1100000: 94% mana | 0.0/5: 0% soul_shard
1:57.663 incinerate Fluffy_Pillow 988374.4/1100000: 90% mana | 0.0/5: 0% soul_shard
1:59.307 immolate Fluffy_Pillow 942650.2/1100000: 86% mana | 0.0/5: 0% soul_shard
2:00.649 use_item_horn_of_valor Fluffy_Pillow 893201.4/1100000: 81% mana | 0.0/5: 0% soul_shard
2:00.649 incinerate Fluffy_Pillow 893201.4/1100000: 81% mana | 0.0/5: 0% soul_shard valarjars_path
2:02.296 potion Fluffy_Pillow 847514.2/1100000: 77% mana | 1.0/5: 20% soul_shard valarjars_path
2:02.296 incinerate Fluffy_Pillow 847514.2/1100000: 77% mana | 1.0/5: 20% soul_shard valarjars_path, potion_of_deadly_grace
2:03.942 incinerate Fluffy_Pillow 801814.6/1100000: 73% mana | 1.0/5: 20% soul_shard valarjars_path, potion_of_deadly_grace
2:05.586 incinerate Fluffy_Pillow 756090.4/1100000: 69% mana | 1.0/5: 20% soul_shard valarjars_path, potion_of_deadly_grace
2:07.233 incinerate Fluffy_Pillow 710403.2/1100000: 65% mana | 1.0/5: 20% soul_shard valarjars_path, potion_of_deadly_grace
2:08.877 immolate Fluffy_Pillow 664679.0/1100000: 60% mana | 1.0/5: 20% soul_shard valarjars_path, potion_of_deadly_grace
2:10.218 conflagrate Fluffy_Pillow 615217.8/1100000: 56% mana | 1.0/5: 20% soul_shard valarjars_path, potion_of_deadly_grace
2:11.559 conflagrate Fluffy_Pillow 609756.6/1100000: 55% mana | 2.0/5: 40% soul_shard valarjars_path, potion_of_deadly_grace
2:12.900 chaos_bolt Fluffy_Pillow 604295.4/1100000: 55% mana | 3.0/5: 60% soul_shard valarjars_path, potion_of_deadly_grace
2:15.134 dimensional_rift Fluffy_Pillow 1016847.8/1100000: 92% mana | 2.0/5: 40% soul_shard valarjars_path, potion_of_deadly_grace
2:16.477 chaos_bolt Fluffy_Pillow 1033411.3/1100000: 94% mana | 2.0/5: 40% soul_shard valarjars_path, potion_of_deadly_grace
2:18.710 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard valarjars_path, potion_of_deadly_grace
2:20.356 chaos_bolt Fluffy_Pillow 1034061.7/1100000: 94% mana | 2.0/5: 40% soul_shard valarjars_path, potion_of_deadly_grace
2:22.588 conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard valarjars_path, potion_of_deadly_grace
2:23.929 incinerate Fluffy_Pillow 1094538.8/1100000: 100% mana | 1.0/5: 20% soul_shard valarjars_path, potion_of_deadly_grace
2:25.576 incinerate Fluffy_Pillow 1034074.0/1100000: 94% mana | 1.0/5: 20% soul_shard valarjars_path, potion_of_deadly_grace
2:27.222 incinerate Fluffy_Pillow 988374.4/1100000: 90% mana | 1.0/5: 20% soul_shard valarjars_path, potion_of_deadly_grace
2:28.867 incinerate Fluffy_Pillow 942662.6/1100000: 86% mana | 1.0/5: 20% soul_shard valarjars_path
2:30.514 dimensional_rift Fluffy_Pillow 896975.3/1100000: 82% mana | 1.0/5: 20% soul_shard valarjars_path
2:31.856 immolate Fluffy_Pillow 913526.5/1100000: 83% mana | 1.0/5: 20% soul_shard
2:33.196 incinerate Fluffy_Pillow 864053.0/1100000: 79% mana | 1.0/5: 20% soul_shard
2:34.842 incinerate Fluffy_Pillow 818353.4/1100000: 74% mana | 1.0/5: 20% soul_shard
2:36.488 incinerate Fluffy_Pillow 772653.9/1100000: 70% mana | 1.0/5: 20% soul_shard
2:38.133 incinerate Fluffy_Pillow 726942.0/1100000: 66% mana | 1.0/5: 20% soul_shard
2:39.776 incinerate Fluffy_Pillow 681205.4/1100000: 62% mana | 1.0/5: 20% soul_shard
2:41.420 immolate Fluffy_Pillow 635481.2/1100000: 58% mana | 1.0/5: 20% soul_shard
2:42.761 conflagrate Fluffy_Pillow 586020.0/1100000: 53% mana | 1.0/5: 20% soul_shard
2:44.103 conflagrate Fluffy_Pillow 580571.2/1100000: 53% mana | 2.0/5: 40% soul_shard
2:45.444 dimensional_rift Fluffy_Pillow 575110.0/1100000: 52% mana | 3.0/5: 60% soul_shard
2:46.784 chaos_bolt Fluffy_Pillow 591636.5/1100000: 54% mana | 3.0/5: 60% soul_shard
2:49.018 incinerate Fluffy_Pillow 1004188.9/1100000: 91% mana | 1.0/5: 20% soul_shard
2:50.663 incinerate Fluffy_Pillow 958477.0/1100000: 87% mana | 1.0/5: 20% soul_shard
2:52.309 incinerate Fluffy_Pillow 912777.4/1100000: 83% mana | 1.0/5: 20% soul_shard
2:53.954 conflagrate Fluffy_Pillow 867065.5/1100000: 79% mana | 1.0/5: 20% soul_shard
2:55.304 chaos_bolt Fluffy_Pillow 861715.4/1100000: 78% mana | 2.0/5: 40% soul_shard
2:57.538 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard
2:59.182 incinerate Fluffy_Pillow 1034037.0/1100000: 94% mana | 1.0/5: 20% soul_shard
3:00.827 dimensional_rift Fluffy_Pillow 988325.1/1100000: 90% mana | 1.0/5: 20% soul_shard
3:02.168 incinerate Fluffy_Pillow 1004863.9/1100000: 91% mana | 1.0/5: 20% soul_shard
3:03.815 immolate Fluffy_Pillow 959176.7/1100000: 87% mana | 1.0/5: 20% soul_shard
3:05.157 incinerate Fluffy_Pillow 909727.9/1100000: 83% mana | 1.0/5: 20% soul_shard
3:06.803 summon_doomguard Fluffy_Pillow 864028.3/1100000: 79% mana | 1.0/5: 20% soul_shard
3:08.146 incinerate Fluffy_Pillow 880591.8/1100000: 80% mana | 0.0/5: 0% soul_shard
3:09.791 incinerate Fluffy_Pillow 834879.9/1100000: 76% mana | 0.0/5: 0% soul_shard
3:11.437 incinerate Fluffy_Pillow 789180.4/1100000: 72% mana | 0.0/5: 0% soul_shard
3:13.081 immolate Fluffy_Pillow 743456.1/1100000: 68% mana | 0.0/5: 0% soul_shard
3:14.423 conflagrate Fluffy_Pillow 694007.3/1100000: 63% mana | 0.0/5: 0% soul_shard
3:15.765 conflagrate Fluffy_Pillow 688558.5/1100000: 63% mana | 1.0/5: 20% soul_shard
3:17.106 service_imp Fluffy_Pillow 683097.3/1100000: 62% mana | 2.0/5: 40% soul_shard
3:18.448 incinerate Fluffy_Pillow 699648.4/1100000: 64% mana | 1.0/5: 20% soul_shard
3:20.093 incinerate Fluffy_Pillow 653936.5/1100000: 59% mana | 1.0/5: 20% soul_shard
3:21.738 incinerate Fluffy_Pillow 608224.7/1100000: 55% mana | 1.0/5: 20% soul_shard
3:23.382 incinerate Fluffy_Pillow 562500.4/1100000: 51% mana | 1.0/5: 20% soul_shard
3:25.029 chaos_bolt Fluffy_Pillow 516813.2/1100000: 47% mana | 2.0/5: 40% soul_shard
3:27.262 conflagrate Fluffy_Pillow 929353.3/1100000: 84% mana | 1.0/5: 20% soul_shard
3:28.604 chaos_bolt Fluffy_Pillow 923904.4/1100000: 84% mana | 2.0/5: 40% soul_shard
3:30.838 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard
3:32.483 incinerate Fluffy_Pillow 1034049.3/1100000: 94% mana | 0.0/5: 0% soul_shard
3:34.128 incinerate Fluffy_Pillow 988337.4/1100000: 90% mana | 0.0/5: 0% soul_shard
3:35.772 immolate Fluffy_Pillow 942613.2/1100000: 86% mana | 0.0/5: 0% soul_shard
3:37.113 incinerate Fluffy_Pillow 893152.0/1100000: 81% mana | 0.0/5: 0% soul_shard
3:38.759 incinerate Fluffy_Pillow 847452.5/1100000: 77% mana | 0.0/5: 0% soul_shard
3:40.405 incinerate Fluffy_Pillow 801752.9/1100000: 73% mana | 0.0/5: 0% soul_shard
3:42.051 dimensional_rift Fluffy_Pillow 756053.4/1100000: 69% mana | 0.0/5: 0% soul_shard
3:43.394 incinerate Fluffy_Pillow 772616.9/1100000: 70% mana | 1.0/5: 20% soul_shard
3:45.039 immolate Fluffy_Pillow 726905.0/1100000: 66% mana | 1.0/5: 20% soul_shard
3:46.379 conflagrate Fluffy_Pillow 677431.5/1100000: 62% mana | 1.0/5: 20% soul_shard
3:47.722 conflagrate Fluffy_Pillow 671995.0/1100000: 61% mana | 2.0/5: 40% soul_shard
3:49.064 dimensional_rift Fluffy_Pillow 666546.1/1100000: 61% mana | 3.0/5: 60% soul_shard
3:50.406 chaos_bolt Fluffy_Pillow 683097.3/1100000: 62% mana | 3.0/5: 60% soul_shard
3:52.640 incinerate Fluffy_Pillow 1095649.6/1100000: 100% mana | 1.0/5: 20% soul_shard
3:54.286 incinerate Fluffy_Pillow 1034061.7/1100000: 94% mana | 1.0/5: 20% soul_shard
3:55.931 incinerate Fluffy_Pillow 988349.8/1100000: 90% mana | 1.0/5: 20% soul_shard
3:57.578 incinerate Fluffy_Pillow 942662.6/1100000: 86% mana | 1.0/5: 20% soul_shard
3:59.222 conflagrate Fluffy_Pillow 896938.3/1100000: 82% mana | 1.0/5: 20% soul_shard
4:00.563 use_item_horn_of_valor Fluffy_Pillow 891477.2/1100000: 81% mana | 2.0/5: 40% soul_shard
4:00.649 chaos_bolt Fluffy_Pillow 892537.8/1100000: 81% mana | 2.0/5: 40% soul_shard valarjars_path
4:02.885 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard valarjars_path
4:04.529 incinerate Fluffy_Pillow 1034037.0/1100000: 94% mana | 1.0/5: 20% soul_shard valarjars_path
4:06.175 incinerate Fluffy_Pillow 988337.4/1100000: 90% mana | 1.0/5: 20% soul_shard valarjars_path
4:07.820 immolate Fluffy_Pillow 942625.6/1100000: 86% mana | 1.0/5: 20% soul_shard valarjars_path
4:09.163 incinerate Fluffy_Pillow 893189.0/1100000: 81% mana | 1.0/5: 20% soul_shard valarjars_path
4:10.807 incinerate Fluffy_Pillow 847464.8/1100000: 77% mana | 1.0/5: 20% soul_shard valarjars_path
4:12.452 incinerate Fluffy_Pillow 801752.9/1100000: 73% mana | 1.0/5: 20% soul_shard valarjars_path
4:14.096 dimensional_rift Fluffy_Pillow 756028.7/1100000: 69% mana | 1.0/5: 20% soul_shard valarjars_path
4:15.439 incinerate Fluffy_Pillow 772592.2/1100000: 70% mana | 1.0/5: 20% soul_shard valarjars_path
4:17.085 immolate Fluffy_Pillow 726892.7/1100000: 66% mana | 1.0/5: 20% soul_shard valarjars_path
4:18.426 conflagrate Fluffy_Pillow 677431.5/1100000: 62% mana | 2.0/5: 40% soul_shard valarjars_path
4:19.768 conflagrate Fluffy_Pillow 671982.6/1100000: 61% mana | 3.0/5: 60% soul_shard valarjars_path
4:21.110 chaos_bolt Fluffy_Pillow 666533.8/1100000: 61% mana | 4.0/5: 80% soul_shard valarjars_path
4:23.344 chaos_bolt Fluffy_Pillow 1079086.2/1100000: 98% mana | 2.0/5: 40% soul_shard valarjars_path
4:25.577 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard valarjars_path
4:27.225 incinerate Fluffy_Pillow 1034086.3/1100000: 94% mana | 1.0/5: 20% soul_shard valarjars_path
4:28.870 chaos_bolt Fluffy_Pillow 988374.4/1100000: 90% mana | 2.0/5: 40% soul_shard valarjars_path
4:31.103 conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard
4:32.443 dimensional_rift Fluffy_Pillow 1094526.5/1100000: 100% mana | 1.0/5: 20% soul_shard
4:33.785 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard
4:35.432 incinerate Fluffy_Pillow 1034074.0/1100000: 94% mana | 1.0/5: 20% soul_shard
4:37.077 incinerate Fluffy_Pillow 988362.1/1100000: 90% mana | 1.0/5: 20% soul_shard
4:38.723 incinerate Fluffy_Pillow 942662.6/1100000: 86% mana | 1.0/5: 20% soul_shard
4:40.370 immolate Fluffy_Pillow 896975.3/1100000: 82% mana | 1.0/5: 20% soul_shard
4:41.712 incinerate Fluffy_Pillow 847526.5/1100000: 77% mana | 1.0/5: 20% soul_shard
4:43.359 incinerate Fluffy_Pillow 801839.3/1100000: 73% mana | 1.0/5: 20% soul_shard
4:45.004 incinerate Fluffy_Pillow 756127.4/1100000: 69% mana | 1.0/5: 20% soul_shard
4:46.650 incinerate Fluffy_Pillow 710427.8/1100000: 65% mana | 1.0/5: 20% soul_shard
4:48.295 service_imp Fluffy_Pillow 664716.0/1100000: 60% mana | 1.0/5: 20% soul_shard
4:49.636 immolate Fluffy_Pillow 681254.8/1100000: 62% mana | 0.0/5: 0% soul_shard
4:50.978 conflagrate Fluffy_Pillow 631805.9/1100000: 57% mana | 0.0/5: 0% soul_shard
4:52.319 conflagrate Fluffy_Pillow 626344.7/1100000: 57% mana | 1.0/5: 20% soul_shard
4:53.660 chaos_bolt Fluffy_Pillow 620883.6/1100000: 56% mana | 2.0/5: 40% soul_shard
4:55.894 incinerate Fluffy_Pillow 1033435.9/1100000: 94% mana | 0.0/5: 0% soul_shard
4:57.538 incinerate Fluffy_Pillow 987711.7/1100000: 90% mana | 0.0/5: 0% soul_shard
4:59.184 incinerate Fluffy_Pillow 942012.2/1100000: 86% mana | 0.0/5: 0% soul_shard
5:00.830 incinerate Fluffy_Pillow 896312.6/1100000: 81% mana | 0.0/5: 0% soul_shard
5:02.475 conflagrate Fluffy_Pillow 850600.7/1100000: 77% mana | 0.0/5: 0% soul_shard
5:03.815 incinerate Fluffy_Pillow 845127.2/1100000: 77% mana | 1.0/5: 20% soul_shard
5:05.460 incinerate Fluffy_Pillow 799415.3/1100000: 73% mana | 1.0/5: 20% soul_shard
5:07.107 incinerate Fluffy_Pillow 753728.1/1100000: 69% mana | 1.0/5: 20% soul_shard
5:08.751 incinerate Fluffy_Pillow 708003.9/1100000: 64% mana | 1.0/5: 20% soul_shard
5:10.397 incinerate Fluffy_Pillow 662304.3/1100000: 60% mana | 1.0/5: 20% soul_shard
5:12.044 immolate Fluffy_Pillow 616617.1/1100000: 56% mana | 1.0/5: 20% soul_shard
5:13.386 incinerate Fluffy_Pillow 567168.3/1100000: 52% mana | 1.0/5: 20% soul_shard
5:15.032 dimensional_rift Fluffy_Pillow 521468.7/1100000: 47% mana | 1.0/5: 20% soul_shard
5:16.374 incinerate Fluffy_Pillow 538019.9/1100000: 49% mana | 1.0/5: 20% soul_shard
5:18.021 incinerate Fluffy_Pillow 492332.7/1100000: 45% mana | 1.0/5: 20% soul_shard
5:19.669 chaos_bolt Fluffy_Pillow 446657.8/1100000: 41% mana | 2.0/5: 40% soul_shard
5:21.902 immolate Fluffy_Pillow 859197.8/1100000: 78% mana | 2.0/5: 40% soul_shard
5:23.245 conflagrate Fluffy_Pillow 809761.3/1100000: 74% mana | 2.0/5: 40% soul_shard
5:24.588 conflagrate Fluffy_Pillow 804324.8/1100000: 73% mana | 3.0/5: 60% soul_shard
5:25.931 chaos_bolt Fluffy_Pillow 798888.3/1100000: 73% mana | 4.0/5: 80% soul_shard
5:28.164 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard
5:30.397 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard
5:32.630 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard
5:34.278 conflagrate Fluffy_Pillow 1034086.3/1100000: 94% mana | 1.0/5: 20% soul_shard
5:35.833 chaos_bolt Fluffy_Pillow 1031264.5/1100000: 94% mana | 2.0/5: 40% soul_shard
5:38.067 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard
5:39.712 incinerate Fluffy_Pillow 1034049.3/1100000: 94% mana | 1.0/5: 20% soul_shard
5:41.357 incinerate Fluffy_Pillow 988337.4/1100000: 90% mana | 1.0/5: 20% soul_shard
5:43.002 incinerate Fluffy_Pillow 942625.6/1100000: 86% mana | 1.0/5: 20% soul_shard
5:44.646 immolate Fluffy_Pillow 896901.3/1100000: 82% mana | 2.0/5: 40% soul_shard
5:45.988 chaos_bolt Fluffy_Pillow 847452.5/1100000: 77% mana | 2.0/5: 40% soul_shard
5:48.222 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard
5:50.454 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard
5:52.100 incinerate Fluffy_Pillow 1034061.7/1100000: 94% mana | 1.0/5: 20% soul_shard
5:53.744 immolate Fluffy_Pillow 988337.4/1100000: 90% mana | 1.0/5: 20% soul_shard
5:55.086 conflagrate Fluffy_Pillow 938888.6/1100000: 85% mana | 1.0/5: 20% soul_shard
5:56.428 conflagrate Fluffy_Pillow 933439.8/1100000: 85% mana | 2.0/5: 40% soul_shard
5:57.769 chaos_bolt Fluffy_Pillow 927978.6/1100000: 84% mana | 4.0/5: 80% soul_shard
6:00.001 dimensional_rift Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard
6:01.341 use_item_horn_of_valor Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard
6:01.341 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard valarjars_path
6:03.576 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard valarjars_path
6:05.221 incinerate Fluffy_Pillow 1034049.3/1100000: 94% mana | 0.0/5: 0% soul_shard valarjars_path
6:06.866 conflagrate Fluffy_Pillow 988337.4/1100000: 90% mana | 0.0/5: 0% soul_shard valarjars_path
6:08.207 summon_doomguard Fluffy_Pillow 982876.3/1100000: 89% mana | 2.0/5: 40% soul_shard valarjars_path
6:09.548 incinerate Fluffy_Pillow 999415.1/1100000: 91% mana | 1.0/5: 20% soul_shard valarjars_path
6:11.193 chaos_bolt Fluffy_Pillow 953703.2/1100000: 87% mana | 2.0/5: 40% soul_shard valarjars_path
6:13.426 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard valarjars_path
6:15.660 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard valarjars_path
6:17.305 immolate Fluffy_Pillow 1034049.3/1100000: 94% mana | 1.0/5: 20% soul_shard valarjars_path
6:18.646 service_imp Fluffy_Pillow 984588.2/1100000: 90% mana | 1.0/5: 20% soul_shard valarjars_path
6:19.988 incinerate Fluffy_Pillow 1001139.3/1100000: 91% mana | 0.0/5: 0% soul_shard valarjars_path
6:21.634 incinerate Fluffy_Pillow 955439.8/1100000: 87% mana | 0.0/5: 0% soul_shard valarjars_path
6:23.280 incinerate Fluffy_Pillow 909740.2/1100000: 83% mana | 0.0/5: 0% soul_shard valarjars_path
6:24.926 incinerate Fluffy_Pillow 864040.6/1100000: 79% mana | 0.0/5: 0% soul_shard valarjars_path
6:26.572 immolate Fluffy_Pillow 818341.1/1100000: 74% mana | 0.0/5: 0% soul_shard valarjars_path
6:27.914 conflagrate Fluffy_Pillow 768892.3/1100000: 70% mana | 0.0/5: 0% soul_shard valarjars_path
6:29.255 conflagrate Fluffy_Pillow 763431.1/1100000: 69% mana | 1.0/5: 20% soul_shard valarjars_path
6:30.598 chaos_bolt Fluffy_Pillow 757994.6/1100000: 69% mana | 3.0/5: 60% soul_shard valarjars_path
6:32.831 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
6:35.064 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard
6:37.295 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard
6:38.941 conflagrate Fluffy_Pillow 1034061.7/1100000: 94% mana | 1.0/5: 20% soul_shard
6:40.282 chaos_bolt Fluffy_Pillow 1028600.5/1100000: 94% mana | 2.0/5: 40% soul_shard
6:42.516 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard
6:44.162 incinerate Fluffy_Pillow 1034061.7/1100000: 94% mana | 1.0/5: 20% soul_shard
6:45.807 dimensional_rift Fluffy_Pillow 988349.8/1100000: 90% mana | 1.0/5: 20% soul_shard
6:47.148 incinerate Fluffy_Pillow 1004888.6/1100000: 91% mana | 1.0/5: 20% soul_shard
6:48.792 immolate Fluffy_Pillow 959164.4/1100000: 87% mana | 1.0/5: 20% soul_shard
6:50.133 incinerate Fluffy_Pillow 909703.2/1100000: 83% mana | 1.0/5: 20% soul_shard
6:51.779 chaos_bolt Fluffy_Pillow 864003.7/1100000: 79% mana | 2.0/5: 40% soul_shard
6:54.013 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard
6:55.660 incinerate Fluffy_Pillow 1034074.0/1100000: 94% mana | 0.0/5: 0% soul_shard
6:57.305 incinerate Fluffy_Pillow 988362.1/1100000: 90% mana | 0.0/5: 0% soul_shard
6:58.951 immolate Fluffy_Pillow 942662.6/1100000: 86% mana | 0.0/5: 0% soul_shard
7:00.293 conflagrate Fluffy_Pillow 893213.7/1100000: 81% mana | 0.0/5: 0% soul_shard
7:01.633 conflagrate Fluffy_Pillow 887740.2/1100000: 81% mana | 1.0/5: 20% soul_shard
7:02.974 chaos_bolt Fluffy_Pillow 882279.0/1100000: 80% mana | 2.0/5: 40% soul_shard
7:05.208 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard
7:07.440 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard
7:09.672 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard
7:11.319 conflagrate Fluffy_Pillow 1034074.0/1100000: 94% mana | 1.0/5: 20% soul_shard
7:12.661 chaos_bolt Fluffy_Pillow 1028625.2/1100000: 94% mana | 2.0/5: 40% soul_shard
7:14.894 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard
7:16.538 incinerate Fluffy_Pillow 1034037.0/1100000: 94% mana | 1.0/5: 20% soul_shard
7:18.182 chaos_bolt Fluffy_Pillow 988312.8/1100000: 90% mana | 2.0/5: 40% soul_shard
7:20.415 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard
7:22.059 immolate Fluffy_Pillow 1034037.0/1100000: 94% mana | 1.0/5: 20% soul_shard
7:23.400 incinerate Fluffy_Pillow 984575.8/1100000: 90% mana | 1.0/5: 20% soul_shard
7:25.046 incinerate Fluffy_Pillow 938876.3/1100000: 85% mana | 1.0/5: 20% soul_shard
7:26.692 chaos_bolt Fluffy_Pillow 893176.7/1100000: 81% mana | 2.0/5: 40% soul_shard

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4200 3875 0
Agility 7252 6927 0
Stamina 25455 25455 15591
Intellect 25106 23399 14958 (578)
Spirit 0 0 0
Health 1527300 1527300 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 25106 23399 0
Crit 21.38% 21.38% 5732
Haste 12.12% 10.94% 3557
Damage / Heal Versatility 3.84% 3.84% 1534
ManaReg per Second 12333 12204 0
Mastery 77.94% 77.94% 6294
Armor 1492 1492 1492
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 828.00
Local Head Bonespeaker Cowl
ilevel: 850, stats: { 211 Armor, +1297 Int, +1945 Sta, +904 Crit, +400 Mastery }
Local Neck Hatecoil Commander's Amulet
ilevel: 845, stats: { +1045 Sta, +1081 Haste, +721 Mastery }
Local Shoulders Magnificent Aeroglide Shoulderpads
ilevel: 825, stats: { 178 Armor, +771 Int, +1157 Sta, +580 Crit, +312 Vers }
Local Shirt Last Season's Shirt
ilevel: 1
Local Chest Ravencourt Formal Robes
ilevel: 815, stats: { 230 Armor, +936 Int, +1404 Sta, +720 Mastery, +425 Crit }
Local Waist Waistband of Spiritual Doom
ilevel: 840, stats: { 141 Armor, +1329 Sta, +886 Int, +633 Haste, +310 Crit }
Local Legs Rising Ocean Legwraps
ilevel: 825, stats: { 208 Armor, +1028 Int, +1542 Sta, +696 Mastery, +493 Crit }
Local Feet Offal Galoshes
ilevel: 805, stats: { 152 Armor, +640 Int, +960 Sta, +485 Mastery, +343 Vers }
Local Wrists Harrowing Soulspun Bracers
ilevel: 825, stats: { 104 Armor, +578 Int, +867 Sta, +449 Crit, +220 Mastery }
Local Hands Bonespeaker Gloves
ilevel: 825, stats: { 149 Armor, +771 Int, +1157 Sta, +599 Crit, +293 Mastery }
Local Finger1 Signet of the Highborne Magi
ilevel: 835, stats: { +952 Sta, +1092 Mastery, +645 Crit }, enchant: { +150 Crit }
Local Finger2 Grasping Tentacle Loop
ilevel: 825, stats: { +867 Sta, +955 Mastery, +716 Haste }
Local Trinket1 Nightborne Researcher's Phial
ilevel: 830, stats: { +1023 Int, +865 Crit }
Local Trinket2 Horn of Valor
ilevel: 825, stats: { +849 Vers }
Local Back Goldscar Pelt
ilevel: 825, stats: { 119 Armor, +578 StrAgiInt, +867 Sta, +200 Crit, +468 Haste }
Local Main Hand Scepter of Sargeras
ilevel: 822, weapon: { 2584 - 3878, 3.6 }, stats: { +999 Int, +1499 Sta, +589 Haste, +589 Mastery, +5451 Int }, relics: { +36 ilevels, +36 ilevels }

Talents

Level
15 Backdraft (Destruction Warlock) Roaring Blaze (Destruction Warlock) Shadowburn (Destruction Warlock)
30 Reverse Entropy (Destruction Warlock) Cataclysm (Destruction Warlock) Mana Tap
45 Demon Skin Mortal Coil Shadowfury
60 Eradication (Destruction Warlock) Fire and Brimstone (Destruction Warlock) Soul Harvest
75 Demonic Circle Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Wreak Havoc (Destruction Warlock) Channel Demonfire (Destruction Warlock) Soul Conduit

Profile

warlock="Eldiabløød"
origin="https://eu.api.battle.net/wow/character/hyjal/Eldiabløød/advanced"
thumbnail="http://eu.battle.net/static-render/eu/hyjal/7/115092743-avatar.jpg"
level=110
race=human
role=spell
position=back
professions=enchanting=712
talents=http://eu.battle.net/wow/en/tool/talent-calculator#Vb!1000112
artifact=38:0:0:0:0:803:1:804:3:805:3:806:3:808:2:810:1:812:1:814:1:816:1:1355:1
spec=destruction

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies<3
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>=3
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/mana_tap,if=talent.mana_tap.enabled&!buff.mana_tap.remains
actions.precombat+=/incinerate

# Executed every time the actor is available.
actions=use_item,name=horn_of_valor
actions+=/dimensional_rift,if=charges=3
actions+=/immolate,if=remains<=tick_time
actions+=/immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&(action.conflagrate.charges=2|(action.conflagrate.charges>=1&action.conflagrate.recharge_time<cast_time+gcd))
actions+=/berserking
actions+=/blood_fury
actions+=/arcane_torrent
actions+=/potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=30)
actions+=/conflagrate,if=talent.roaring_blaze.enabled&(charges=2|(action.conflagrate.charges>=1&action.conflagrate.recharge_time<gcd))
actions+=/conflagrate,if=talent.roaring_blaze.enabled&prev_gcd.conflagrate
actions+=/conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack=2
actions+=/conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack=3&buff.bloodlust.remains
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/service_pet
actions+=/summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<3
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>=3
actions+=/soul_harvest
actions+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions+=/chaos_bolt,if=soul_shard>3
actions+=/dimensional_rift
actions+=/mana_tap,if=buff.mana_tap.remains<=buff.mana_tap.duration*0.3&(mana.pct<20|buff.mana_tap.remains<=action.chaos_bolt.cast_time)&target.time_to_die>buff.mana_tap.duration*0.3
actions+=/chaos_bolt
actions+=/cataclysm
actions+=/conflagrate,if=!talent.roaring_blaze.enabled
actions+=/immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
actions+=/life_tap,if=talent.mana_tap.enabled&mana.pct<=10
actions+=/incinerate
actions+=/life_tap

head=bonespeaker_cowl,id=134216,bonus_id=1727/1512/3336
neck=hatecoil_commanders_amulet,id=134492,bonus_id=1727/1497/3336
shoulders=magnificent_aeroglide_shoulderpads,id=134430,bonus_id=1726/1477
back=goldscar_pelt,id=133639,bonus_id=1726/1477
chest=ravencourt_formal_robes,id=139246,bonus_id=1826/1467/3339
shirt=last_seasons_shirt,id=98091
wrists=harrowing_soulspun_bracers,id=134437,bonus_id=1726/1477
hands=bonespeaker_gloves,id=134217,bonus_id=1726/1487/1675
waist=waistband_of_spiritual_doom,id=137507,bonus_id=1726/1492/3337
legs=rising_ocean_legwraps,id=134428,bonus_id=1726/1477
feet=offal_galoshes,id=134416,bonus_id=1826/1457
finger1=signet_of_the_highborne_magi,id=134537,bonus_id=1726/1487/3339,enchant=150crit
finger2=grasping_tentacle_loop,id=133634,bonus_id=1726/1808/1477
trinket1=nightborne_researchers_phial,id=134292,bonus_id=3397/603/1492/1675
trinket2=horn_of_valor,id=133642,bonus_id=1826/1477/3338
main_hand=scepter_of_sargeras,id=128941,gem_id=137351/137316/0/0,relic_id=1726:1477/1826:1477:3338/0/0

# Gear Summary
# gear_ilvl=827.80
# gear_stamina=15591
# gear_intellect=14958
# gear_crit_rating=5620
# gear_haste_rating=3487
# gear_mastery_rating=6171
# gear_versatility_rating=1504
# gear_armor=1492
default_pet=imp

Elidi

Elidi : 188906 dps

  • Race: Night Elf
  • Class: Warrior
  • Spec: Arms
  • Level: 110
  • Role: Attack
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
188906.4 188906.4 182.3 / 0.097% 36196.2 / 19.2% 20811.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
9.1 9.1 Rage 15.29% 45.1 100.0% 100%
Origin https://eu.api.battle.net/wow/character/hyjal/Elidi/advanced
Talents
  • 15: Dauntless (Arms Warrior)
  • 30: Double Time
  • 45: Fervor of Battle (Arms Warrior)
  • 60: Bounding Stride
  • 75: In For The Kill (Arms Warrior)
  • 90: Trauma (Arms Warrior)
  • 100: Opportunity Strikes (Arms Warrior)
  • Talent Calculator
Artifact
Professions
  • mining: 770
  • engineering: 756

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Elidi 188906
auto_attack_mh 18158 9.6% 158.7 2.86sec 51503 18173 Direct 158.7 41324 82412 51502 24.8%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 158.70 158.70 0.00 0.00 2.8340 0.0000 8173367.75 12015624.80 31.98 18173.34 18173.34
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 119.38 75.23% 41324.07 26911 47124 41326.41 37664 45156 4933458 7252651 31.98
crit 39.31 24.77% 82412.25 53822 94248 82409.71 68998 93852 3239909 4762974 31.98
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Bladestorm 0 (4158) 0.0% (2.2%) 5.1 97.43sec 367272 172640

Stats details: bladestorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.08 0.00 17.37 0.00 2.1274 0.5492 0.00 0.00 0.00 172640.09 172640.09
 
 

Action details: bladestorm

Static Values
  • id:227847
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:raid_event.adds.in>90|!raid_event.adds.exists|spell_targets.bladestorm_mh>desired_targets
Spelldata
  • id:227847
  • name:Bladestorm
  • school:physical
  • tooltip:Dealing damage to all nearby enemies every $t1 sec. Immune to crowd control.
  • description:Become an unstoppable storm of destructive force, striking all targets within $50622A1 yards {$?s23881=false}[with both weapons for ${7*($50622sw2+$95738sw2)} Physical damage][for ${7*$168969sw2} Physical damage] over {$d=6 seconds}. You are immune to movement impairing and loss of control effects, but can use defensive abilities and can avoid attacks.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Bladestorm (_mh) 4158 2.2% 0.0 0.00sec 0 0 Direct 17.4 73269 164288 107511 37.6%  

Stats details: bladestorm_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 17.37 0.00 0.00 0.0000 0.0000 1867102.56 2744817.62 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.83 62.38% 73269.12 56017 96302 73989.50 57387 96302 793752 1166890 31.98
crit 6.53 37.62% 164288.29 112275 192604 166253.10 0 192604 1073351 1577927 31.92
 
 

Action details: bladestorm_mh

Static Values
  • id:50622
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:50622
  • name:Bladestorm
  • school:physical
  • tooltip:
  • description:You become a whirling storm of destructive force, striking all nearby targets with your main hand weapon for $sw2 Physical damage.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.17
 
Colossus Smash 16418 8.7% 49.9 8.98sec 148172 123808 Direct 49.9 118854 236493 148172 24.9%  

Stats details: colossus_smash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.87 49.87 0.00 0.00 1.1968 0.0000 7388643.42 10862005.70 31.98 123808.50 123808.50
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.44 75.08% 118854.37 78029 136488 118518.24 94721 131520 4449687 6541462 31.98
crit 12.43 24.92% 236492.61 156059 272976 235860.10 160716 272976 2938956 4320544 31.98
 
 

Action details: colossus_smash

Static Values
  • id:167105
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.colossus_smash.down
Spelldata
  • id:167105
  • name:Colossus Smash
  • school:physical
  • tooltip:
  • description:Smashes the enemy's armor, dealing $sw1 Physical damage, and increasing damage you deal to them by {$208086s3=15}% for {$208086d=8 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.02
 
Deadly Grace 2783 1.5% 13.7 1.71sec 90195 0 Direct 13.7 66851 133701 90196 34.9%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.68 13.68 0.00 0.00 0.0000 0.0000 1234111.08 1234111.08 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.90 65.08% 66850.55 66851 66851 66850.55 66851 66851 595290 595290 0.00
crit 4.78 34.92% 133701.11 133701 133701 133701.11 133701 133701 638821 638821 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:5.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=47572 to 71358} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:47572.00
  • base_dd_max:71358.00
 
Execute 28689 15.2% 29.2 2.94sec 441559 360403 Direct 29.2 286188 628961 441570 45.3%  

Stats details: execute

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.21 29.21 0.00 0.00 1.2252 0.0000 12899893.53 18964065.41 31.98 360402.69 360402.69
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.97 54.67% 286187.81 71728 372987 286417.20 212200 351468 4571005 6719810 31.98
crit 13.24 45.33% 628961.18 143457 745974 630671.48 455378 745974 8328889 12244255 31.98
 
 

Action details: execute

Static Values
  • id:163201
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:equipped.137060
Spelldata
  • id:163201
  • name:Execute
  • school:physical
  • tooltip:
  • description:Attempts to finish off a foe, causing $sw2 Physical damage, and consuming up to $m3 additional Rage to deal up to ${$sw2*3} additional damage. Only usable on enemies that have less than 20% health.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.62
 
Heroic Leap 866 0.5% 14.1 32.88sec 27575 0 Direct 14.1 20694 40951 27609 34.1%  

Stats details: heroic_leap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.13 14.11 0.00 0.00 0.0000 0.0000 389593.57 572739.45 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.29 65.86% 20693.52 12149 20729 20692.15 19020 20729 192324 282735 31.98
crit 4.82 34.14% 40951.23 24736 41458 40865.85 35149 41264 197270 290005 31.98
 
 

Action details: heroic_leap

Static Values
  • id:6544
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.colossus_smash.up
Spelldata
  • id:6544
  • name:Heroic Leap
  • school:physical
  • tooltip:
  • description:Leap through the air toward a target location, slamming down with destructive force to deal {$52174s1=1} Physical damage to all enemies within $52174a1 yards{$?s23922=false}[, and resetting the remaining cooldown on Taunt][].
 
Mortal Strike 46372 24.6% 80.7 4.44sec 258530 218305 Direct 80.7 169373 387656 258531 40.8%  

Stats details: mortal_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 80.75 80.75 0.00 0.00 1.1843 0.0000 20875184.47 30688498.53 31.98 218304.87 218304.87
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 47.77 59.16% 169373.46 96436 216453 169301.58 138204 196644 8090641 11894009 31.98
crit 32.98 40.84% 387655.54 192872 432907 387492.70 309664 427555 12784543 18794490 31.98
 
 

Action details: mortal_strike

Static Values
  • id:12294
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.battle_cry.up&buff.focused_rage.stack>=1&buff.battle_cry.remains<gcd
Spelldata
  • id:12294
  • name:Mortal Strike
  • school:physical
  • tooltip:
  • description:A vicious strike that deals $sw3 Physical damage and reduces the effectiveness of healing on the target for {$115804d=10 seconds}.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.76
 
Opportunity Strikes 17454 9.2% 98.4 4.32sec 79843 0 Direct 98.4 64014 127074 79842 25.1%  

Stats details: opportunity_strikes

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.38 98.38 0.00 0.00 0.0000 0.0000 7854806.49 11547309.56 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.68 74.90% 64013.89 40589 70843 63998.65 56556 69822 4716889 6934273 31.98
crit 24.69 25.10% 127074.23 81179 141685 126986.69 100035 141685 3137918 4613036 31.98
 
 

Action details: opportunity_strikes

Static Values
  • id:203178
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:203178
  • name:Opportunity Strikes
  • school:physical
  • tooltip:
  • description:{$@spelldesc203179=Your melee abilities have up to a {$h=60}% chance, based on the target's missing health, to trigger an extra attack that deals $203178sw1 Physical damage.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.60
 
Slam 39536 20.9% 141.1 2.51sec 126203 106237 Direct 141.1 101417 201023 126201 24.9%  

Stats details: slam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 141.10 141.10 0.00 0.00 1.1879 0.0000 17807768.83 26179106.98 31.98 106237.02 106237.02
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 105.99 75.12% 101416.67 66652 115078 101446.65 91212 111591 10749807 15803235 31.98
crit 35.11 24.88% 201022.54 133304 230157 201054.95 163055 229885 7057961 10375872 31.98
 
 

Action details: slam

Static Values
  • id:1464
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.battle_cry_deadly_calm.up|buff.focused_rage.stack=3|rage.deficit<=30
Spelldata
  • id:1464
  • name:Slam
  • school:physical
  • tooltip:
  • description:Slams an opponent, causing $sw2 Physical damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.60
 
Trauma 9996 5.3% 0.0 0.00sec 0 0 Periodic 177.6 19659 42491 25358 25.0% 78.9%

Stats details: trauma

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 177.59 177.59 0.0000 2.0000 4503312.19 4503312.19 0.00 12679.31 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 133.3 75.04% 19658.92 4578 52785 19667.10 16755 23187 2619795 2619795 0.00
crit 44.3 24.96% 42490.94 9155 99513 42487.61 33272 54028 1883517 1883517 0.00
 
 

Action details: trauma

Static Values
  • id:215537
  • school:physical
  • resource:none
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215537
  • name:Trauma
  • school:physical
  • tooltip:Bleeding for $w1 every $t1 sec.
  • description:{$@spelldesc215538=Slam and Whirlwind now cause the target to bleed for {$s1=20}% additional damage over {$215537d=6 seconds}. Multiple uses accumulate increased damage.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Warbreaker 4475 2.4% 7.6 63.01sec 266104 224033 Direct 7.6 196255 386307 266083 36.7%  

Stats details: warbreaker

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.55 7.55 0.00 0.00 1.1878 0.0000 2010245.03 2010245.03 0.00 224032.66 224032.66
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.78 63.25% 196254.50 135930 227818 192353.16 0 227818 937797 937797 0.00
crit 2.78 36.75% 386306.73 271860 455637 372264.95 0 455637 1072448 1072448 0.00
 
 

Action details: warbreaker

Static Values
  • id:209577
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.colossus_smash.down
Spelldata
  • id:209577
  • name:Warbreaker
  • school:shadow
  • tooltip:
  • description:Stomp the ground, causing a ring of corrupted spikes to erupt upwards, dealing $sw1 Shadow damage and applying the Colossus Smash effect to all nearby enemies.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.50
 
Simple Action Stats Execute Interval
Elidi
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Elidi
  • harmful:false
  • if_expr:
 
Battle Cry 8.0 60.32sec

Stats details: battle_cry

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.97 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: battle_cry

Static Values
  • id:1719
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.bloodlust.up|time>=1)&!gcd.remains
Spelldata
  • id:1719
  • name:Battle Cry
  • school:physical
  • tooltip:Critical strike chance increased by $w1%.
  • description:Lets loose a battle cry, granting {$s1=100}% increased critical strike chance for {$d=5 seconds}.$?a202751[ |cFFFFFFFFGenerates ${{$202751s2=1000}/10} Rage.|r][]
 
Charge 1.0 0.00sec

Stats details: charge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: charge

Static Values
  • id:100
  • school:physical
  • resource:none
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:17.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:100
  • name:Charge
  • school:physical
  • tooltip:
  • description:Charge to an enemy, {$?s103828=false}[stunning][rooting] it for {$?s103828=false}[{$7922d=1.500 seconds}][{$105771d=1.500 seconds}]. |cFFFFFFFFGenerates {$/10;s2=20} Rage.|r
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Elidi
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Elidi
  • harmful:false
  • if_expr:
 
nitro_boosts 1.0 0.00sec

Stats details: nitro_boosts

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: nitro_boosts

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
 
potion 1.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Battle Cry 8.0 0.0 60.3sec 60.3sec 8.80% 8.86% 0.0(0.0) 7.9

Buff details

  • buff initial source:Elidi
  • cooldown name:buff_battle_cry
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • battle_cry_1:8.80%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1719
  • name:Battle Cry
  • tooltip:Critical strike chance increased by $w1%.
  • description:Lets loose a battle cry, granting {$s1=100}% increased critical strike chance for {$d=5 seconds}.$?a202751[ |cFFFFFFFFGenerates ${{$202751s2=1000}/10} Rage.|r][]
  • max_stacks:0
  • duration:5.00
  • cooldown:60.00
  • default_chance:0.00%
Bladestorm 5.1 0.0 97.4sec 97.4sec 2.12% 2.12% 0.0(0.0) 0.0

Buff details

  • buff initial source:Elidi
  • cooldown name:buff_bladestorm
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bladestorm_1:2.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:227847
  • name:Bladestorm
  • tooltip:Dealing damage to all nearby enemies every $t1 sec. Immune to crowd control.
  • description:Become an unstoppable storm of destructive force, striking all targets within $50622A1 yards {$?s23881=false}[with both weapons for ${7*($50622sw2+$95738sw2)} Physical damage][for ${7*$168969sw2} Physical damage] over {$d=6 seconds}. You are immune to movement impairing and loss of control effects, but can use defensive abilities and can avoid attacks.
  • max_stacks:0
  • duration:6.00
  • cooldown:90.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 11.92% 0.0(0.0) 1.0

Buff details

  • buff initial source:Elidi
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Chaotic Energy 1.0 157.7 0.0sec 2.9sec 100.00% 100.00% 138.7(138.7) 0.0

Buff details

  • buff initial source:Elidi
  • cooldown name:buff_chaotic_energy
  • max_stacks:20
  • duration:23.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:strength
  • amount:72.98

Stack Uptimes

  • chaotic_energy_1:0.36%
  • chaotic_energy_2:0.51%
  • chaotic_energy_3:0.51%
  • chaotic_energy_4:0.51%
  • chaotic_energy_5:0.51%
  • chaotic_energy_6:0.51%
  • chaotic_energy_7:0.51%
  • chaotic_energy_8:0.51%
  • chaotic_energy_9:0.51%
  • chaotic_energy_10:0.51%
  • chaotic_energy_11:0.51%
  • chaotic_energy_12:0.51%
  • chaotic_energy_13:0.51%
  • chaotic_energy_14:0.51%
  • chaotic_energy_15:0.51%
  • chaotic_energy_16:0.51%
  • chaotic_energy_17:0.51%
  • chaotic_energy_18:0.51%
  • chaotic_energy_19:0.59%
  • chaotic_energy_20:90.40%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:214831
  • name:Chaotic Energy
  • tooltip:Strength or Agility increased by $w3.
  • description:{$@spelldesc214829=Your melee autoattacks grant you Chaotic Energy, increasing your Strength or Agility by {$214831s3=50}, stacking up to {$214831u=20} times. If you do not autoattack an enemy for 4 sec, this effect will decrease by 1 stack every sec.}
  • max_stacks:20
  • duration:23.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Claw 17.0 4.4 26.3sec 20.6sec 25.63% 25.68% 4.4(4.4) 16.7

Buff details

  • buff initial source:Elidi
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:550.00
  • stat:haste_rating
  • amount:550.00

Stack Uptimes

  • mark_of_the_claw_1:25.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=550}.
  • description:Critical strike and haste increased by {$s1=550}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Nitro Boosts 1.0 0.0 0.0sec 0.0sec 1.13% 1.19% 0.0(0.0) 1.0

Buff details

  • buff initial source:Elidi
  • cooldown name:buff_nitro_boosts
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • nitro_boosts_1:1.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:54861
  • name:Nitro Boosts
  • tooltip:Speed increased by {$s1=150}%.
  • description:Increase your speed by {$s1=150}% for {$d=5 seconds}.
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deadly Grace 1.0 0.0 0.0sec 0.0sec 5.19% 5.26% 0.0(0.0) 1.0

Buff details

  • buff initial source:Elidi
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:5.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
precise_strikes 57.4 0.0 7.8sec 7.9sec 16.30% 16.33% 0.0(0.0) 0.0

Buff details

  • buff initial source:Elidi
  • cooldown name:buff_precise_strikes
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.30

Stack Uptimes

  • precise_strikes_1:16.30%

Trigger Attempt Success

  • trigger_pct:100.00%
Shattered Defenses 57.4 0.0 7.8sec 7.9sec 16.30% 34.14% 0.0(0.0) 0.0

Buff details

  • buff initial source:Elidi
  • cooldown name:buff_shattered_defenses
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30

Stack Uptimes

  • shattered_defenses_1:16.30%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:209706
  • name:Shattered Defenses
  • tooltip:Damage and critical strike chance of your next Mortal Strike or Execute increased by {$s1=30}%.
  • description:{$@spelldesc209574=After using Colossus Smash, your next Mortal Strike or Execute gains {$209706s1=30}% increased critical strike chance and deals {$209706s2=30}% additional damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Elidi
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Countless Armies

Buff details

  • buff initial source:Elidi
  • cooldown name:buff_flask_of_the_countless_armies
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:strength
  • amount:1300.00

Stack Uptimes

  • flask_of_the_countless_armies_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188034
  • name:Flask of the Countless Armies
  • tooltip:Strength increased by $w1.
  • description:Increases Strength by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (nightborne_delicacy_platter)

Buff details

  • buff initial source:Elidi
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:375.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Windwalking (_movement_aura)

Buff details

  • buff initial source:Elidi
  • cooldown name:buff_windwalking_movement_aura
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • windwalking_movement_aura_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:166646
  • name:Windwalking
  • tooltip:Movement speed increased by {$s1=10}%.
  • description:
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Battle Cry0.5090.0015.2272.2260.0008.475
Heroic Leap3.4510.00125.02537.6882.919112.576
Colossus Smash1.1970.0015.04156.38123.08791.382
Warbreaker3.8720.00145.71519.7000.00085.538
Mortal Strike1.4110.0012.93598.19439.979155.593
Bladestorm8.6920.001121.80130.3900.000132.504

Resources

Resource Usage Type Count Total Average RPE APR
Elidi
execute Rage 29.2 752.3 25.8 25.8 17146.8
mortal_strike Rage 80.7 1074.5 13.3 13.3 19427.0
slam Rage 141.1 2257.7 16.0 16.0 7887.7
Resource Gains Type Count Total Average Overflow
charge Rage 1.00 20.00 (0.48%) 20.00 0.00 0.00%
in_for_the_kill Rage 0.03 0.48 (0.01%) 18.34 0.04 8.30%
melee_crit Rage 39.31 1271.69 (30.78%) 32.35 178.94 12.34%
melee_main_hand Rage 119.39 2839.73 (68.73%) 23.79 168.80 5.61%
Resource RPS-Gain RPS-Loss
Rage 9.17 9.07
Combat End Resource Mean Min Max
Rage 48.04 0.00 110.00

Benefits & Uptimes

Benefits %
Uptimes %
Rage Cap 6.6%

Procs

Count Interval
tactician 46.6 9.4sec

Statistics & Data Analysis

Fight Length
Sample Data Elidi Fight Length
Count 9999
Mean 450.42
Minimum 350.15
Maximum 555.44
Spread ( max - min ) 205.29
Range [ ( max - min ) / 2 * 100% ] 22.79%
DPS
Sample Data Elidi Damage Per Second
Count 9999
Mean 188906.37
Minimum 158220.20
Maximum 229176.65
Spread ( max - min ) 70956.46
Range [ ( max - min ) / 2 * 100% ] 18.78%
Standard Deviation 9302.8474
5th Percentile 174028.03
95th Percentile 204658.65
( 95th Percentile - 5th Percentile ) 30630.62
Mean Distribution
Standard Deviation 93.0331
95.00% Confidence Intervall ( 188724.03 - 189088.71 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 93
0.1% Error 9316
0.1 Scale Factor Error with Delta=300 738780
0.05 Scale Factor Error with Delta=300 2955122
0.01 Scale Factor Error with Delta=300 73878056
Priority Target DPS
Sample Data Elidi Priority Target Damage Per Second
Count 9999
Mean 188906.37
Minimum 158220.20
Maximum 229176.65
Spread ( max - min ) 70956.46
Range [ ( max - min ) / 2 * 100% ] 18.78%
Standard Deviation 9302.8474
5th Percentile 174028.03
95th Percentile 204658.65
( 95th Percentile - 5th Percentile ) 30630.62
Mean Distribution
Standard Deviation 93.0331
95.00% Confidence Intervall ( 188724.03 - 189088.71 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 93
0.1% Error 9316
0.1 Scale Factor Error with Delta=300 738780
0.05 Scale Factor Error with Delta=300 2955122
0.01 Scale Factor Error with Delta=300 73878056
DPS(e)
Sample Data Elidi Damage Per Second (Effective)
Count 9999
Mean 188906.37
Minimum 158220.20
Maximum 229176.65
Spread ( max - min ) 70956.46
Range [ ( max - min ) / 2 * 100% ] 18.78%
Damage
Sample Data Elidi Damage
Count 9999
Mean 85004028.93
Minimum 58672600.25
Maximum 116819185.33
Spread ( max - min ) 58146585.08
Range [ ( max - min ) / 2 * 100% ] 34.20%
DTPS
Sample Data Elidi Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Elidi Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Elidi Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Elidi Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Elidi Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Elidi Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data ElidiTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Elidi Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=countless_armies
1 0.00 food,type=nightborne_delicacy_platter
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=deadly_grace
Default action list Executed every time the actor is available.
# count action,conditions
5 1.00 charge
6 1.00 auto_attack
0.00 potion,name=deadly_grace,if=(target.health.pct<20&buff.battle_cry.up)|target.time_to_die<=26
7 7.97 battle_cry,if=(buff.bloodlust.up|time>=1)&!gcd.remains
0.00 avatar,if=(buff.bloodlust.up|time>=1)&!gcd.remains
0.00 blood_fury,if=buff.battle_cry.up|target.time_to_die<=16
0.00 berserking,if=buff.battle_cry.up|target.time_to_die<=11
0.00 arcane_torrent,if=buff.battle_cry_deadly_calm.down&rage.deficit>40
8 1.00 use_item,name=leyscarred_waistplate
0.00 hamstring,if=buff.battle_cry_deadly_calm.remains>cooldown.hamstring.remains
9 14.13 heroic_leap,if=debuff.colossus_smash.up
0.00 rend,if=remains<gcd
0.00 focused_rage,if=buff.battle_cry_deadly_calm.remains>cooldown.focused_rage.remains&(buff.focused_rage.stack<3|cooldown.mortal_strike.remains)
A 15.82 colossus_smash,if=debuff.colossus_smash.down
B 2.60 warbreaker,if=debuff.colossus_smash.down
0.00 ravager
0.00 overpower
C 0.00 run_action_list,name=cleave,if=spell_targets.whirlwind>=2&talent.sweeping_strikes.enabled
D 0.00 run_action_list,name=aoe,if=spell_targets.whirlwind>=2&!talent.sweeping_strikes.enabled
E 0.00 run_action_list,name=execute,if=target.health.pct<=20
F 0.00 run_action_list,name=single
actions.single
# count action,conditions
0.00 mortal_strike,if=buff.battle_cry.up&buff.focused_rage.stack>=1&buff.battle_cry.remains<gcd
G 25.47 colossus_smash,if=buff.shattered_defenses.down
H 4.15 warbreaker,if=buff.shattered_defenses.down&cooldown.mortal_strike.remains<gcd
0.00 focused_rage,if=buff.focused_rage.stack<3&(buff.shattered_defenses.up|cooldown.colossus_smash.remains)
I 80.75 mortal_strike
J 141.10 slam,if=buff.battle_cry_deadly_calm.up|buff.focused_rage.stack=3|rage.deficit<=30
0.00 execute,if=equipped.137060
0.00 slam,if=equipped.137060
0.00 focused_rage,if=equipped.137060
K 4.12 bladestorm,interrupt=1,if=raid_event.adds.in>90|!raid_event.adds.exists|spell_targets.bladestorm_mh>desired_targets
actions.single+=/heroic_charge,if=rage.deficit>=40&(!cooldown.heroic_leap.remains|swing.mh.remains>1.2) #Remove the # above to run out of melee and charge back in for rage.
actions.execute
# count action,conditions
0.00 focused_rage,if=buff.focused_rage.stack<3&debuff.colossus_smash.down
0.00 mortal_strike,if=buff.battle_cry.up&(buff.focused_rage.stack=3|buff.focused_rage.stack=2&buff.battle_cry.remains<gcd)
0.00 execute,if=buff.battle_cry_deadly_calm.up
L 8.58 colossus_smash,if=buff.shattered_defenses.down
M 0.80 warbreaker,if=buff.shattered_defenses.down&rage<=30
N 11.97 execute,if=buff.shattered_defenses.up
0.00 mortal_strike,if=buff.focused_rage.stack=3
O 17.25 execute,if=debuff.colossus_smash.up
P 0.97 bladestorm,interrupt=1,if=raid_event.adds.in>90|!raid_event.adds.exists|spell_targets.bladestorm_mh>desired_targets
actions.single+=/heroic_charge,if=rage.deficit>=40&(!cooldown.heroic_leap.remains|swing.mh.remains>1.2) #Remove the # above to run out of melee and charge back in for rage.

Sample Sequence

012456A79IKJHIJJJIJGIJJIJJIAIJJIJJJIJJIJJIJJJIJJIJJA9IJGI8GIJ7JJIJBJIJJJIJJJIAIJ9JJIJAIJKJGIJJJIJJAIJJG9IJJJI7JAIJGIJJHIJJGIJJJ9GIJGIGIGIJJGIJJGIGIJGIJJJ9IJAIG7IJJJIKJAIJJHIJJJIJJIJJA9IJJIJJJIJAIJJJIGIJJI79GIGIGIJJJIBJIGJIGJIGJJIJ9JJIKJAIJJJIJJJIJAIJJI7JJJIJJIA9IJJHIJJJIJJJAIJJIJAIJJ9JIAIJJJIJAIJOL7NOOOLNOLNO9LNMNLNOPOOA9NLNOOLNOOO7OBNL9NLNOO

Sample Sequence Table

time name target resources buffs
Pre flask Elidi 0.0/110: 0% rage
Pre food Elidi 0.0/110: 0% rage
Pre augmentation Elidi 0.0/110: 0% rage
Pre potion Fluffy_Pillow 0.0/110: 0% rage potion_of_deadly_grace
0:00.000 charge Fluffy_Pillow 0.0/110: 0% rage potion_of_deadly_grace
0:00.000 auto_attack Fluffy_Pillow 20.0/110: 18% rage potion_of_deadly_grace
0:00.000 colossus_smash Fluffy_Pillow 45.2/110: 41% rage chaotic_energy, potion_of_deadly_grace
0:01.229 battle_cry Fluffy_Pillow 70.4/110: 64% rage bloodlust, shattered_defenses, chaotic_energy(2), potion_of_deadly_grace
0:01.229 heroic_leap Fluffy_Pillow 70.4/110: 64% rage bloodlust, battle_cry, shattered_defenses, chaotic_energy(2), potion_of_deadly_grace
0:01.229 mortal_strike Fluffy_Pillow 70.4/110: 64% rage bloodlust, battle_cry, shattered_defenses, chaotic_energy(2), potion_of_deadly_grace
0:02.175 bladestorm Fluffy_Pillow 59.2/110: 54% rage bloodlust, battle_cry, chaotic_energy(2), potion_of_deadly_grace
0:03.730 slam Fluffy_Pillow 96.1/110: 87% rage bloodlust, battle_cry, chaotic_energy(3), potion_of_deadly_grace
0:04.678 warbreaker Fluffy_Pillow 80.1/110: 73% rage bloodlust, battle_cry, chaotic_energy(3), potion_of_deadly_grace
0:05.625 mortal_strike Fluffy_Pillow 110.0/110: 100% rage bloodlust, precise_strikes, battle_cry, shattered_defenses, chaotic_energy(4), potion_of_deadly_grace
0:06.572 slam Fluffy_Pillow 98.8/110: 90% rage bloodlust, chaotic_energy(4), potion_of_deadly_grace
0:07.518 slam Fluffy_Pillow 82.8/110: 75% rage bloodlust, chaotic_energy(4), potion_of_deadly_grace
0:08.465 slam Fluffy_Pillow 92.0/110: 84% rage bloodlust, chaotic_energy(5), potion_of_deadly_grace
0:09.412 mortal_strike Fluffy_Pillow 76.0/110: 69% rage bloodlust, chaotic_energy(5), potion_of_deadly_grace
0:10.359 slam Fluffy_Pillow 85.2/110: 77% rage bloodlust, chaotic_energy(6), potion_of_deadly_grace
0:11.305 colossus_smash Fluffy_Pillow 69.2/110: 63% rage bloodlust, chaotic_energy(6), potion_of_deadly_grace
0:12.251 mortal_strike Fluffy_Pillow 69.2/110: 63% rage bloodlust, precise_strikes, shattered_defenses, chaotic_energy(6), potion_of_deadly_grace
0:13.198 slam Fluffy_Pillow 83.2/110: 76% rage bloodlust, chaotic_energy(7), potion_of_deadly_grace
0:14.143 Waiting 0.500 sec 67.2/110: 61% rage bloodlust, chaotic_energy(7), potion_of_deadly_grace
0:14.643 slam Fluffy_Pillow 92.4/110: 84% rage bloodlust, chaotic_energy(8), potion_of_deadly_grace
0:15.589 Waiting 0.200 sec 76.4/110: 69% rage bloodlust, chaotic_energy(8), potion_of_deadly_grace
0:15.789 mortal_strike Fluffy_Pillow 76.4/110: 69% rage bloodlust, chaotic_energy(8), potion_of_deadly_grace
0:16.968 slam Fluffy_Pillow 85.6/110: 78% rage bloodlust, chaotic_energy(9), potion_of_deadly_grace
0:17.914 Waiting 1.200 sec 69.6/110: 63% rage bloodlust, chaotic_energy(9), potion_of_deadly_grace
0:19.114 slam Fluffy_Pillow 94.8/110: 86% rage bloodlust, chaotic_energy(10), mark_of_the_claw, potion_of_deadly_grace
0:20.048 mortal_strike Fluffy_Pillow 78.8/110: 72% rage bloodlust, chaotic_energy(10), mark_of_the_claw, potion_of_deadly_grace
0:20.981 colossus_smash Fluffy_Pillow 62.8/110: 57% rage bloodlust, chaotic_energy(10), mark_of_the_claw, potion_of_deadly_grace
0:21.913 mortal_strike Fluffy_Pillow 88.0/110: 80% rage bloodlust, precise_strikes, shattered_defenses, chaotic_energy(11), mark_of_the_claw, potion_of_deadly_grace
0:22.849 Waiting 0.800 sec 76.8/110: 70% rage bloodlust, chaotic_energy(11), mark_of_the_claw, potion_of_deadly_grace
0:23.649 slam Fluffy_Pillow 102.0/110: 93% rage bloodlust, chaotic_energy(12), mark_of_the_claw
0:24.583 slam Fluffy_Pillow 86.0/110: 78% rage bloodlust, chaotic_energy(12), mark_of_the_claw
0:25.517 mortal_strike Fluffy_Pillow 70.0/110: 64% rage bloodlust, chaotic_energy(12)
0:26.587 slam Fluffy_Pillow 91.2/110: 83% rage bloodlust, chaotic_energy(13)
0:27.533 Waiting 0.600 sec 75.2/110: 68% rage bloodlust, chaotic_energy(13)
0:28.133 slam Fluffy_Pillow 100.4/110: 91% rage bloodlust, chaotic_energy(14)
0:29.080 slam Fluffy_Pillow 84.4/110: 77% rage bloodlust, chaotic_energy(14)
0:30.025 mortal_strike Fluffy_Pillow 68.4/110: 62% rage bloodlust, chaotic_energy(14)
0:30.971 slam Fluffy_Pillow 90.1/110: 82% rage bloodlust, chaotic_energy(15)
0:31.919 Waiting 0.700 sec 74.1/110: 67% rage bloodlust, chaotic_energy(15)
0:32.619 slam Fluffy_Pillow 99.3/110: 90% rage bloodlust, chaotic_energy(16)
0:33.565 mortal_strike Fluffy_Pillow 83.3/110: 76% rage bloodlust, chaotic_energy(16)
0:34.744 Waiting 0.200 sec 67.3/110: 61% rage bloodlust, chaotic_energy(16)
0:34.944 slam Fluffy_Pillow 92.5/110: 84% rage bloodlust, chaotic_energy(17)
0:35.891 Waiting 1.300 sec 76.5/110: 70% rage bloodlust, chaotic_energy(17)
0:37.191 slam Fluffy_Pillow 101.7/110: 92% rage bloodlust, chaotic_energy(18)
0:38.139 mortal_strike Fluffy_Pillow 85.7/110: 78% rage bloodlust, chaotic_energy(18)
0:39.084 Waiting 0.300 sec 69.7/110: 63% rage bloodlust, chaotic_energy(18)
0:39.384 slam Fluffy_Pillow 107.2/110: 97% rage bloodlust, chaotic_energy(19)
0:40.329 slam Fluffy_Pillow 91.2/110: 83% rage bloodlust, chaotic_energy(19)
0:41.275 Waiting 0.600 sec 75.2/110: 68% rage chaotic_energy(19)
0:41.875 slam Fluffy_Pillow 100.4/110: 91% rage chaotic_energy(20)
0:43.104 mortal_strike Fluffy_Pillow 84.4/110: 77% rage chaotic_energy(20)
0:44.332 Waiting 0.500 sec 68.4/110: 62% rage chaotic_energy(20)
0:44.832 slam Fluffy_Pillow 105.2/110: 96% rage chaotic_energy(20)
0:46.061 slam Fluffy_Pillow 89.2/110: 81% rage chaotic_energy(20)
0:47.290 Waiting 0.500 sec 73.2/110: 67% rage chaotic_energy(20)
0:47.790 mortal_strike Fluffy_Pillow 98.4/110: 89% rage chaotic_energy(20), mark_of_the_claw
0:49.216 slam Fluffy_Pillow 82.4/110: 75% rage chaotic_energy(20), mark_of_the_claw
0:50.428 Waiting 0.200 sec 66.4/110: 60% rage chaotic_energy(20), mark_of_the_claw
0:50.628 slam Fluffy_Pillow 91.6/110: 83% rage chaotic_energy(20), mark_of_the_claw
0:51.841 colossus_smash Fluffy_Pillow 75.6/110: 69% rage chaotic_energy(20), mark_of_the_claw
0:53.053 heroic_leap Fluffy_Pillow 75.6/110: 69% rage precise_strikes, shattered_defenses, chaotic_energy(20), mark_of_the_claw
0:53.053 mortal_strike Fluffy_Pillow 75.6/110: 69% rage precise_strikes, shattered_defenses, chaotic_energy(20), mark_of_the_claw
0:54.266 slam Fluffy_Pillow 100.6/110: 91% rage chaotic_energy(20)
0:55.495 colossus_smash Fluffy_Pillow 84.6/110: 77% rage chaotic_energy(20)
0:56.725 mortal_strike Fluffy_Pillow 109.8/110: 100% rage precise_strikes, shattered_defenses, chaotic_energy(20), mark_of_the_claw
0:57.939 use_item_leyscarred_waistplate Fluffy_Pillow 98.6/110: 90% rage chaotic_energy(20), mark_of_the_claw
0:57.939 colossus_smash Fluffy_Pillow 98.6/110: 90% rage nitro_boosts, chaotic_energy(20), mark_of_the_claw
0:59.153 mortal_strike Fluffy_Pillow 98.6/110: 90% rage nitro_boosts, precise_strikes, shattered_defenses, chaotic_energy(20), mark_of_the_claw
1:00.364 slam Fluffy_Pillow 110.0/110: 100% rage nitro_boosts, chaotic_energy(20), mark_of_the_claw
1:01.575 battle_cry Fluffy_Pillow 94.0/110: 85% rage nitro_boosts, chaotic_energy(20), mark_of_the_claw
1:01.575 slam Fluffy_Pillow 94.0/110: 85% rage nitro_boosts, battle_cry, chaotic_energy(20), mark_of_the_claw
1:02.788 slam Fluffy_Pillow 110.0/110: 100% rage nitro_boosts, battle_cry, chaotic_energy(20)
1:04.018 mortal_strike Fluffy_Pillow 94.0/110: 85% rage battle_cry, chaotic_energy(20), mark_of_the_claw
1:05.231 slam Fluffy_Pillow 110.0/110: 100% rage battle_cry, chaotic_energy(20), mark_of_the_claw
1:06.444 warbreaker Fluffy_Pillow 94.0/110: 85% rage battle_cry, chaotic_energy(20), mark_of_the_claw
1:07.657 slam Fluffy_Pillow 94.0/110: 85% rage precise_strikes, shattered_defenses, chaotic_energy(20), mark_of_the_claw
1:08.870 mortal_strike Fluffy_Pillow 110.0/110: 100% rage precise_strikes, shattered_defenses, chaotic_energy(20)
1:10.101 slam Fluffy_Pillow 98.8/110: 90% rage chaotic_energy(20)
1:11.330 slam Fluffy_Pillow 108.0/110: 98% rage chaotic_energy(20)
1:12.559 slam Fluffy_Pillow 92.0/110: 84% rage chaotic_energy(20)
1:13.788 mortal_strike Fluffy_Pillow 76.0/110: 69% rage chaotic_energy(20)
1:15.017 slam Fluffy_Pillow 97.0/110: 88% rage chaotic_energy(20)
1:16.248 slam Fluffy_Pillow 81.0/110: 74% rage chaotic_energy(20)
1:17.478 slam Fluffy_Pillow 90.2/110: 82% rage chaotic_energy(20)
1:18.705 mortal_strike Fluffy_Pillow 74.2/110: 67% rage chaotic_energy(20)
1:19.936 colossus_smash Fluffy_Pillow 83.4/110: 76% rage chaotic_energy(20), mark_of_the_claw
1:21.149 mortal_strike Fluffy_Pillow 83.4/110: 76% rage precise_strikes, shattered_defenses, chaotic_energy(20), mark_of_the_claw
1:22.364 Waiting 0.400 sec 72.2/110: 66% rage chaotic_energy(20), mark_of_the_claw
1:22.764 slam Fluffy_Pillow 97.4/110: 89% rage chaotic_energy(20), mark_of_the_claw
1:23.977 heroic_leap Fluffy_Pillow 81.4/110: 74% rage chaotic_energy(20), mark_of_the_claw
1:23.977 slam Fluffy_Pillow 81.4/110: 74% rage chaotic_energy(20), mark_of_the_claw
1:25.189 Waiting 0.500 sec 65.4/110: 59% rage chaotic_energy(20), mark_of_the_claw
1:25.689 slam Fluffy_Pillow 90.6/110: 82% rage chaotic_energy(20), mark_of_the_claw
1:26.902 mortal_strike Fluffy_Pillow 74.6/110: 68% rage chaotic_energy(20)
1:28.132 Waiting 0.500 sec 58.6/110: 53% rage chaotic_energy(20)
1:28.632 slam Fluffy_Pillow 83.8/110: 76% rage chaotic_energy(20)
1:29.862 colossus_smash Fluffy_Pillow 67.8/110: 62% rage chaotic_energy(20)
1:31.092 mortal_strike Fluffy_Pillow 67.8/110: 62% rage precise_strikes, shattered_defenses, chaotic_energy(20)
1:32.322 slam Fluffy_Pillow 81.8/110: 74% rage chaotic_energy(20)
1:33.552 bladestorm Fluffy_Pillow 65.8/110: 60% rage chaotic_energy(20)
1:35.368 slam Fluffy_Pillow 91.0/110: 83% rage chaotic_energy(20)
1:36.596 colossus_smash Fluffy_Pillow 75.0/110: 68% rage chaotic_energy(20)
1:37.826 mortal_strike Fluffy_Pillow 100.2/110: 91% rage precise_strikes, shattered_defenses, chaotic_energy(20)
1:39.054 slam Fluffy_Pillow 89.0/110: 81% rage chaotic_energy(20)
1:40.283 Waiting 0.100 sec 73.0/110: 66% rage chaotic_energy(20)
1:40.383 slam Fluffy_Pillow 98.2/110: 89% rage chaotic_energy(20)
1:41.611 slam Fluffy_Pillow 82.2/110: 75% rage chaotic_energy(20)
1:42.840 mortal_strike Fluffy_Pillow 66.2/110: 60% rage chaotic_energy(20)
1:44.071 Waiting 2.100 sec 75.4/110: 69% rage chaotic_energy(20), mark_of_the_claw
1:46.171 slam Fluffy_Pillow 100.6/110: 91% rage chaotic_energy(20), mark_of_the_claw
1:47.384 slam Fluffy_Pillow 84.6/110: 77% rage chaotic_energy(20), mark_of_the_claw
1:48.597 colossus_smash Fluffy_Pillow 68.6/110: 62% rage chaotic_energy(20), mark_of_the_claw
1:49.811 mortal_strike Fluffy_Pillow 93.8/110: 85% rage precise_strikes, shattered_defenses, chaotic_energy(20)
1:51.041 slam Fluffy_Pillow 82.6/110: 75% rage chaotic_energy(20)
1:52.270 slam Fluffy_Pillow 91.8/110: 83% rage chaotic_energy(20)
1:53.499 colossus_smash Fluffy_Pillow 75.8/110: 69% rage chaotic_energy(20)
1:54.728 heroic_leap Fluffy_Pillow 75.8/110: 69% rage precise_strikes, shattered_defenses, chaotic_energy(20)
1:54.728 mortal_strike Fluffy_Pillow 75.8/110: 69% rage precise_strikes, shattered_defenses, chaotic_energy(20)
1:55.957 slam Fluffy_Pillow 89.8/110: 82% rage chaotic_energy(20)
1:57.186 Waiting 0.700 sec 73.8/110: 67% rage chaotic_energy(20), mark_of_the_claw
1:57.886 slam Fluffy_Pillow 99.0/110: 90% rage chaotic_energy(20), mark_of_the_claw
1:59.099 slam Fluffy_Pillow 83.0/110: 75% rage chaotic_energy(20), mark_of_the_claw
2:00.312 mortal_strike Fluffy_Pillow 67.0/110: 61% rage chaotic_energy(20), mark_of_the_claw
2:01.526 battle_cry Fluffy_Pillow 76.2/110: 69% rage chaotic_energy(20), mark_of_the_claw
2:01.575 Waiting 2.100 sec 76.2/110: 69% rage battle_cry, chaotic_energy(20), mark_of_the_claw
2:03.675 slam Fluffy_Pillow 110.0/110: 100% rage battle_cry, chaotic_energy(20), mark_of_the_claw
2:04.887 colossus_smash Fluffy_Pillow 94.0/110: 85% rage battle_cry, chaotic_energy(20)
2:06.119 mortal_strike Fluffy_Pillow 94.0/110: 85% rage precise_strikes, battle_cry, shattered_defenses, chaotic_energy(20)
2:07.349 slam Fluffy_Pillow 108.0/110: 98% rage chaotic_energy(20)
2:08.578 colossus_smash Fluffy_Pillow 92.0/110: 84% rage chaotic_energy(20)
2:09.808 mortal_strike Fluffy_Pillow 110.0/110: 100% rage precise_strikes, shattered_defenses, chaotic_energy(20)
2:11.037 slam Fluffy_Pillow 98.8/110: 90% rage chaotic_energy(20)
2:12.266 slam Fluffy_Pillow 82.8/110: 75% rage chaotic_energy(20)
2:13.496 warbreaker Fluffy_Pillow 92.0/110: 84% rage chaotic_energy(20)
2:14.724 mortal_strike Fluffy_Pillow 92.0/110: 84% rage precise_strikes, shattered_defenses, chaotic_energy(20)
2:15.951 slam Fluffy_Pillow 106.0/110: 96% rage chaotic_energy(20)
2:17.182 slam Fluffy_Pillow 90.0/110: 82% rage chaotic_energy(20)
2:18.412 colossus_smash Fluffy_Pillow 99.2/110: 90% rage chaotic_energy(20)
2:19.641 mortal_strike Fluffy_Pillow 99.2/110: 90% rage precise_strikes, shattered_defenses, chaotic_energy(20)
2:20.870 slam Fluffy_Pillow 88.0/110: 80% rage chaotic_energy(20)
2:22.098 slam Fluffy_Pillow 97.2/110: 88% rage chaotic_energy(20)
2:23.326 slam Fluffy_Pillow 81.2/110: 74% rage chaotic_energy(20)
2:24.555 heroic_leap Fluffy_Pillow 101.3/110: 92% rage chaotic_energy(20)
2:24.728 colossus_smash Fluffy_Pillow 101.3/110: 92% rage chaotic_energy(20)
2:25.957 mortal_strike Fluffy_Pillow 101.3/110: 92% rage precise_strikes, shattered_defenses, chaotic_energy(20)
2:27.185 slam Fluffy_Pillow 110.0/110: 100% rage chaotic_energy(20)
2:28.414 colossus_smash Fluffy_Pillow 94.0/110: 85% rage chaotic_energy(20)
2:29.643 mortal_strike Fluffy_Pillow 94.0/110: 85% rage precise_strikes, shattered_defenses, chaotic_energy(20)
2:30.874 colossus_smash Fluffy_Pillow 108.0/110: 98% rage chaotic_energy(20)
2:32.104 mortal_strike Fluffy_Pillow 108.0/110: 98% rage precise_strikes, shattered_defenses, chaotic_energy(20)
2:33.334 colossus_smash Fluffy_Pillow 110.0/110: 100% rage chaotic_energy(20)
2:34.563 mortal_strike Fluffy_Pillow 110.0/110: 100% rage precise_strikes, shattered_defenses, chaotic_energy(20)
2:35.793 slam Fluffy_Pillow 98.8/110: 90% rage chaotic_energy(20), mark_of_the_claw
2:37.006 slam Fluffy_Pillow 108.0/110: 98% rage chaotic_energy(20), mark_of_the_claw
2:38.218 colossus_smash Fluffy_Pillow 92.0/110: 84% rage chaotic_energy(20), mark_of_the_claw
2:39.431 mortal_strike Fluffy_Pillow 110.0/110: 100% rage precise_strikes, shattered_defenses, chaotic_energy(20), mark_of_the_claw
2:40.644 slam Fluffy_Pillow 98.8/110: 90% rage chaotic_energy(20)
2:41.872 slam Fluffy_Pillow 108.0/110: 98% rage chaotic_energy(20)
2:43.102 colossus_smash Fluffy_Pillow 92.0/110: 84% rage chaotic_energy(20)
2:44.330 mortal_strike Fluffy_Pillow 92.0/110: 84% rage precise_strikes, shattered_defenses, chaotic_energy(20)
2:45.559 colossus_smash Fluffy_Pillow 106.0/110: 96% rage chaotic_energy(20)
2:46.789 mortal_strike Fluffy_Pillow 106.0/110: 96% rage precise_strikes, shattered_defenses, chaotic_energy(20)
2:48.017 slam Fluffy_Pillow 110.0/110: 100% rage chaotic_energy(20)
2:49.248 colossus_smash Fluffy_Pillow 94.0/110: 85% rage chaotic_energy(20)
2:50.477 mortal_strike Fluffy_Pillow 94.0/110: 85% rage precise_strikes, shattered_defenses, chaotic_energy(20)
2:51.707 slam Fluffy_Pillow 108.0/110: 98% rage chaotic_energy(20)
2:52.936 slam Fluffy_Pillow 92.0/110: 84% rage chaotic_energy(20)
2:54.166 slam Fluffy_Pillow 101.2/110: 92% rage chaotic_energy(20)
2:55.394 heroic_leap Fluffy_Pillow 85.2/110: 77% rage chaotic_energy(20), mark_of_the_claw
2:55.394 mortal_strike Fluffy_Pillow 85.2/110: 77% rage chaotic_energy(20), mark_of_the_claw
2:56.608 slam Fluffy_Pillow 94.4/110: 86% rage chaotic_energy(20), mark_of_the_claw
2:57.819 colossus_smash Fluffy_Pillow 78.4/110: 71% rage chaotic_energy(20), mark_of_the_claw
2:59.032 mortal_strike Fluffy_Pillow 78.4/110: 71% rage precise_strikes, shattered_defenses, chaotic_energy(20), mark_of_the_claw
3:00.245 colossus_smash Fluffy_Pillow 92.4/110: 84% rage chaotic_energy(20)
3:01.475 battle_cry Fluffy_Pillow 92.4/110: 84% rage precise_strikes, shattered_defenses, chaotic_energy(20)
3:01.575 mortal_strike Fluffy_Pillow 92.4/110: 84% rage precise_strikes, battle_cry, shattered_defenses, chaotic_energy(20)
3:02.805 slam Fluffy_Pillow 110.0/110: 100% rage battle_cry, chaotic_energy(20)
3:04.037 slam Fluffy_Pillow 94.0/110: 85% rage battle_cry, chaotic_energy(20)
3:05.267 slam Fluffy_Pillow 110.0/110: 100% rage battle_cry, chaotic_energy(20)
3:06.497 mortal_strike Fluffy_Pillow 94.0/110: 85% rage battle_cry, chaotic_energy(20)
3:07.727 bladestorm Fluffy_Pillow 78.0/110: 71% rage chaotic_energy(20)
3:09.569 slam Fluffy_Pillow 103.2/110: 94% rage chaotic_energy(20)
3:10.798 colossus_smash Fluffy_Pillow 87.2/110: 79% rage chaotic_energy(20)
3:12.027 mortal_strike Fluffy_Pillow 110.0/110: 100% rage precise_strikes, shattered_defenses, chaotic_energy(20), mark_of_the_claw
3:13.239 slam Fluffy_Pillow 98.8/110: 90% rage chaotic_energy(20), mark_of_the_claw
3:14.452 slam Fluffy_Pillow 110.0/110: 100% rage chaotic_energy(20), mark_of_the_claw
3:15.663 warbreaker Fluffy_Pillow 94.0/110: 85% rage chaotic_energy(20), mark_of_the_claw
3:16.875 mortal_strike Fluffy_Pillow 94.0/110: 85% rage precise_strikes, shattered_defenses, chaotic_energy(20), mark_of_the_claw
3:18.086 slam Fluffy_Pillow 108.0/110: 98% rage chaotic_energy(20), mark_of_the_claw
3:19.297 slam Fluffy_Pillow 92.0/110: 84% rage chaotic_energy(20), mark_of_the_claw
3:20.508 slam Fluffy_Pillow 101.2/110: 92% rage chaotic_energy(20), mark_of_the_claw
3:21.720 mortal_strike Fluffy_Pillow 85.2/110: 77% rage chaotic_energy(20), mark_of_the_claw
3:22.934 slam Fluffy_Pillow 94.4/110: 86% rage chaotic_energy(20), mark_of_the_claw
3:24.144 Waiting 1.500 sec 78.4/110: 71% rage chaotic_energy(20), mark_of_the_claw
3:25.644 slam Fluffy_Pillow 103.6/110: 94% rage chaotic_energy(20), mark_of_the_claw
3:26.856 mortal_strike Fluffy_Pillow 87.6/110: 80% rage chaotic_energy(20)
3:28.087 Waiting 0.500 sec 71.6/110: 65% rage chaotic_energy(20)
3:28.587 slam Fluffy_Pillow 96.8/110: 88% rage chaotic_energy(20)
3:29.817 slam Fluffy_Pillow 80.8/110: 73% rage chaotic_energy(20)
3:31.047 colossus_smash Fluffy_Pillow 64.8/110: 59% rage chaotic_energy(20)
3:32.278 heroic_leap Fluffy_Pillow 90.0/110: 82% rage precise_strikes, shattered_defenses, chaotic_energy(20)
3:32.278 mortal_strike Fluffy_Pillow 90.0/110: 82% rage precise_strikes, shattered_defenses, chaotic_energy(20)
3:33.508 Waiting 1.000 sec 78.8/110: 72% rage chaotic_energy(20)
3:34.508 slam Fluffy_Pillow 104.0/110: 95% rage chaotic_energy(20)
3:35.738 slam Fluffy_Pillow 88.0/110: 80% rage chaotic_energy(20)
3:36.965 mortal_strike Fluffy_Pillow 72.0/110: 65% rage chaotic_energy(20)
3:38.412 slam Fluffy_Pillow 92.2/110: 84% rage chaotic_energy(20)
3:39.641 Waiting 0.700 sec 76.2/110: 69% rage chaotic_energy(20)
3:40.341 slam Fluffy_Pillow 101.4/110: 92% rage chaotic_energy(20)
3:41.573 slam Fluffy_Pillow 85.4/110: 78% rage chaotic_energy(20)
3:42.802 mortal_strike Fluffy_Pillow 69.4/110: 63% rage chaotic_energy(20)
3:44.032 Waiting 2.200 sec 78.6/110: 71% rage chaotic_energy(20)
3:46.232 slam Fluffy_Pillow 103.8/110: 94% rage chaotic_energy(20)
3:47.460 colossus_smash Fluffy_Pillow 87.8/110: 80% rage chaotic_energy(20)
3:48.689 mortal_strike Fluffy_Pillow 87.8/110: 80% rage precise_strikes, shattered_defenses, chaotic_energy(20)
3:49.919 slam Fluffy_Pillow 110.0/110: 100% rage chaotic_energy(20)
3:51.149 slam Fluffy_Pillow 94.0/110: 85% rage chaotic_energy(20)
3:52.377 slam Fluffy_Pillow 103.2/110: 94% rage chaotic_energy(20)
3:53.607 mortal_strike Fluffy_Pillow 87.2/110: 79% rage chaotic_energy(20)
3:54.835 colossus_smash Fluffy_Pillow 71.2/110: 65% rage chaotic_energy(20)
3:56.064 mortal_strike Fluffy_Pillow 96.4/110: 88% rage precise_strikes, shattered_defenses, chaotic_energy(20)
3:57.294 slam Fluffy_Pillow 85.2/110: 77% rage chaotic_energy(20), mark_of_the_claw
3:58.508 slam Fluffy_Pillow 94.4/110: 86% rage chaotic_energy(20), mark_of_the_claw
3:59.721 Waiting 1.000 sec 78.4/110: 71% rage chaotic_energy(20), mark_of_the_claw
4:00.721 mortal_strike Fluffy_Pillow 78.4/110: 71% rage chaotic_energy(20), mark_of_the_claw
4:02.112 battle_cry Fluffy_Pillow 94.0/110: 85% rage chaotic_energy(20)
4:02.112 heroic_leap Fluffy_Pillow 94.0/110: 85% rage battle_cry, chaotic_energy(20)
4:02.278 colossus_smash Fluffy_Pillow 94.0/110: 85% rage battle_cry, chaotic_energy(20)
4:03.508 mortal_strike Fluffy_Pillow 94.0/110: 85% rage precise_strikes, battle_cry, shattered_defenses, chaotic_energy(20)
4:04.740 colossus_smash Fluffy_Pillow 110.0/110: 100% rage battle_cry, chaotic_energy(20)
4:05.969 mortal_strike Fluffy_Pillow 110.0/110: 100% rage precise_strikes, battle_cry, shattered_defenses, chaotic_energy(20)
4:07.200 colossus_smash Fluffy_Pillow 110.0/110: 100% rage chaotic_energy(20)
4:08.429 mortal_strike Fluffy_Pillow 110.0/110: 100% rage precise_strikes, shattered_defenses, chaotic_energy(20)
4:09.658 slam Fluffy_Pillow 110.0/110: 100% rage chaotic_energy(20)
4:10.887 slam Fluffy_Pillow 94.0/110: 85% rage chaotic_energy(20)
4:12.116 Waiting 0.500 sec 78.0/110: 71% rage chaotic_energy(20)
4:12.616 slam Fluffy_Pillow 103.2/110: 94% rage chaotic_energy(20)
4:13.847 mortal_strike Fluffy_Pillow 87.2/110: 79% rage chaotic_energy(20)
4:15.076 Waiting 0.400 sec 71.2/110: 65% rage chaotic_energy(20)
4:15.476 warbreaker Fluffy_Pillow 71.2/110: 65% rage chaotic_energy(20)
4:16.893 slam Fluffy_Pillow 109.0/110: 99% rage precise_strikes, shattered_defenses, chaotic_energy(20)
4:18.122 mortal_strike Fluffy_Pillow 93.0/110: 85% rage precise_strikes, shattered_defenses, chaotic_energy(20)
4:19.350 colossus_smash Fluffy_Pillow 107.0/110: 97% rage chaotic_energy(20)
4:20.578 slam Fluffy_Pillow 107.0/110: 97% rage precise_strikes, shattered_defenses, chaotic_energy(20)
4:21.808 mortal_strike Fluffy_Pillow 110.0/110: 100% rage precise_strikes, shattered_defenses, chaotic_energy(20)
4:23.035 colossus_smash Fluffy_Pillow 98.8/110: 90% rage chaotic_energy(20)
4:24.265 slam Fluffy_Pillow 98.8/110: 90% rage precise_strikes, shattered_defenses, chaotic_energy(20)
4:25.496 mortal_strike Fluffy_Pillow 110.0/110: 100% rage precise_strikes, shattered_defenses, chaotic_energy(20)
4:26.725 colossus_smash Fluffy_Pillow 98.8/110: 90% rage chaotic_energy(20)
4:27.954 slam Fluffy_Pillow 110.0/110: 100% rage precise_strikes, shattered_defenses, chaotic_energy(20)
4:29.183 slam Fluffy_Pillow 94.0/110: 85% rage precise_strikes, shattered_defenses, chaotic_energy(20)
4:30.412 mortal_strike Fluffy_Pillow 103.2/110: 94% rage precise_strikes, shattered_defenses, chaotic_energy(20)
4:31.641 slam Fluffy_Pillow 92.0/110: 84% rage chaotic_energy(20)
4:32.871 heroic_leap Fluffy_Pillow 76.0/110: 69% rage chaotic_energy(20)
4:32.871 Waiting 0.300 sec 76.0/110: 69% rage chaotic_energy(20)
4:33.171 slam Fluffy_Pillow 101.2/110: 92% rage chaotic_energy(20)
4:34.400 slam Fluffy_Pillow 85.2/110: 77% rage chaotic_energy(20)
4:35.629 mortal_strike Fluffy_Pillow 69.2/110: 63% rage chaotic_energy(20)
4:36.861 Waiting 0.700 sec 78.4/110: 71% rage chaotic_energy(20)
4:37.561 bladestorm Fluffy_Pillow 78.4/110: 71% rage chaotic_energy(20)
4:39.637 slam Fluffy_Pillow 103.6/110: 94% rage chaotic_energy(20)
4:40.865 colossus_smash Fluffy_Pillow 87.6/110: 80% rage chaotic_energy(20)
4:42.095 mortal_strike Fluffy_Pillow 110.0/110: 100% rage precise_strikes, shattered_defenses, chaotic_energy(20), mark_of_the_claw
4:43.307 slam Fluffy_Pillow 98.8/110: 90% rage chaotic_energy(20), mark_of_the_claw
4:44.519 slam Fluffy_Pillow 82.8/110: 75% rage chaotic_energy(20), mark_of_the_claw
4:45.731 slam Fluffy_Pillow 104.6/110: 95% rage chaotic_energy(20), mark_of_the_claw
4:46.944 mortal_strike Fluffy_Pillow 88.6/110: 81% rage chaotic_energy(20)
4:48.174 slam Fluffy_Pillow 109.7/110: 100% rage chaotic_energy(20)
4:49.405 slam Fluffy_Pillow 93.7/110: 85% rage chaotic_energy(20)
4:50.634 Waiting 0.100 sec 77.7/110: 71% rage chaotic_energy(20)
4:50.734 slam Fluffy_Pillow 102.9/110: 94% rage chaotic_energy(20)
4:51.964 mortal_strike Fluffy_Pillow 86.9/110: 79% rage chaotic_energy(20)
4:53.193 Waiting 0.500 sec 70.9/110: 64% rage chaotic_energy(20)
4:53.693 slam Fluffy_Pillow 96.1/110: 87% rage chaotic_energy(20)
4:54.922 colossus_smash Fluffy_Pillow 80.1/110: 73% rage chaotic_energy(20)
4:56.153 mortal_strike Fluffy_Pillow 80.1/110: 73% rage precise_strikes, shattered_defenses, chaotic_energy(20)
4:57.383 slam Fluffy_Pillow 94.1/110: 86% rage chaotic_energy(20)
4:58.612 Waiting 1.000 sec 78.1/110: 71% rage chaotic_energy(20)
4:59.612 slam Fluffy_Pillow 103.3/110: 94% rage chaotic_energy(20)
5:00.840 mortal_strike Fluffy_Pillow 87.3/110: 79% rage chaotic_energy(20)
5:02.284 battle_cry Fluffy_Pillow 71.3/110: 65% rage chaotic_energy(20)
5:02.284 Waiting 0.200 sec 71.3/110: 65% rage battle_cry, chaotic_energy(20)
5:02.484 slam Fluffy_Pillow 107.8/110: 98% rage battle_cry, chaotic_energy(20)
5:03.714 slam Fluffy_Pillow 91.8/110: 83% rage battle_cry, chaotic_energy(20)
5:04.942 Waiting 0.500 sec 75.8/110: 69% rage battle_cry, chaotic_energy(20)
5:05.442 slam Fluffy_Pillow 110.0/110: 100% rage battle_cry, chaotic_energy(20)
5:06.671 mortal_strike Fluffy_Pillow 94.0/110: 85% rage battle_cry, chaotic_energy(20)
5:07.901 Waiting 0.500 sec 78.0/110: 71% rage chaotic_energy(20)
5:08.401 slam Fluffy_Pillow 103.2/110: 94% rage chaotic_energy(20)
5:09.630 slam Fluffy_Pillow 87.2/110: 79% rage chaotic_energy(20)
5:10.860 Waiting 0.500 sec 71.2/110: 65% rage chaotic_energy(20)
5:11.360 mortal_strike Fluffy_Pillow 96.4/110: 88% rage chaotic_energy(20)
5:12.802 colossus_smash Fluffy_Pillow 80.4/110: 73% rage chaotic_energy(20)
5:14.032 heroic_leap Fluffy_Pillow 80.4/110: 73% rage precise_strikes, shattered_defenses, chaotic_energy(20)
5:14.032 mortal_strike Fluffy_Pillow 80.4/110: 73% rage precise_strikes, shattered_defenses, chaotic_energy(20)
5:15.261 slam Fluffy_Pillow 105.6/110: 96% rage chaotic_energy(20)
5:16.490 slam Fluffy_Pillow 89.6/110: 81% rage chaotic_energy(20)
5:17.719 warbreaker Fluffy_Pillow 98.8/110: 90% rage chaotic_energy(20)
5:18.950 mortal_strike Fluffy_Pillow 98.8/110: 90% rage precise_strikes, shattered_defenses, chaotic_energy(20)
5:20.179 slam Fluffy_Pillow 110.0/110: 100% rage chaotic_energy(20)
5:21.409 slam Fluffy_Pillow 94.0/110: 85% rage chaotic_energy(20)
5:22.640 Waiting 0.500 sec 78.0/110: 71% rage chaotic_energy(20)
5:23.140 slam Fluffy_Pillow 103.2/110: 94% rage chaotic_energy(20)
5:24.368 mortal_strike Fluffy_Pillow 87.2/110: 79% rage chaotic_energy(20)
5:25.599 Waiting 0.500 sec 71.2/110: 65% rage chaotic_energy(20)
5:26.099 slam Fluffy_Pillow 96.4/110: 88% rage chaotic_energy(20)
5:27.327 slam Fluffy_Pillow 80.4/110: 73% rage chaotic_energy(20)
5:28.556 Waiting 0.400 sec 64.4/110: 59% rage chaotic_energy(20), mark_of_the_claw
5:28.956 slam Fluffy_Pillow 89.6/110: 81% rage chaotic_energy(20), mark_of_the_claw
5:30.168 colossus_smash Fluffy_Pillow 73.6/110: 67% rage chaotic_energy(20), mark_of_the_claw
5:31.381 mortal_strike Fluffy_Pillow 73.6/110: 67% rage precise_strikes, shattered_defenses, chaotic_energy(20), mark_of_the_claw
5:32.594 slam Fluffy_Pillow 87.6/110: 80% rage chaotic_energy(20), mark_of_the_claw
5:33.805 Waiting 1.000 sec 71.6/110: 65% rage chaotic_energy(20)
5:34.805 slam Fluffy_Pillow 96.8/110: 88% rage chaotic_energy(20)
5:36.035 mortal_strike Fluffy_Pillow 80.8/110: 73% rage chaotic_energy(20)
5:37.485 Waiting 0.300 sec 64.8/110: 59% rage chaotic_energy(20)
5:37.785 slam Fluffy_Pillow 90.0/110: 82% rage chaotic_energy(20)
5:39.015 colossus_smash Fluffy_Pillow 74.0/110: 67% rage chaotic_energy(20)
5:40.244 mortal_strike Fluffy_Pillow 74.0/110: 67% rage precise_strikes, shattered_defenses, chaotic_energy(20)
5:41.474 slam Fluffy_Pillow 88.0/110: 80% rage chaotic_energy(20)
5:42.704 Waiting 0.900 sec 72.0/110: 65% rage chaotic_energy(20)
5:43.604 slam Fluffy_Pillow 97.2/110: 88% rage chaotic_energy(20)
5:44.833 heroic_leap Fluffy_Pillow 81.2/110: 74% rage chaotic_energy(20)
5:44.833 slam Fluffy_Pillow 81.2/110: 74% rage chaotic_energy(20)
5:46.062 mortal_strike Fluffy_Pillow 65.2/110: 59% rage chaotic_energy(20)
5:47.292 colossus_smash Fluffy_Pillow 86.2/110: 78% rage chaotic_energy(20)
5:48.522 mortal_strike Fluffy_Pillow 86.2/110: 78% rage precise_strikes, shattered_defenses, chaotic_energy(20)
5:49.751 slam Fluffy_Pillow 110.0/110: 100% rage chaotic_energy(20)
5:50.981 slam Fluffy_Pillow 94.0/110: 85% rage chaotic_energy(20)
5:52.211 Waiting 0.200 sec 78.0/110: 71% rage chaotic_energy(20)
5:52.411 slam Fluffy_Pillow 103.2/110: 94% rage chaotic_energy(20)
5:53.641 mortal_strike Fluffy_Pillow 87.2/110: 79% rage chaotic_energy(20)
5:54.870 Waiting 0.500 sec 71.2/110: 65% rage chaotic_energy(20)
5:55.370 slam Fluffy_Pillow 96.4/110: 88% rage chaotic_energy(20)
5:56.599 colossus_smash Fluffy_Pillow 80.4/110: 73% rage chaotic_energy(20)
5:57.830 mortal_strike Fluffy_Pillow 80.4/110: 73% rage precise_strikes, shattered_defenses, chaotic_energy(20)
5:59.059 slam Fluffy_Pillow 94.4/110: 86% rage chaotic_energy(20)
6:00.288 Waiting 0.500 sec 78.4/110: 71% rage chaotic_energy(20)
6:00.788 execute Fluffy_Pillow 78.4/110: 71% rage chaotic_energy(20)
6:02.017 colossus_smash Fluffy_Pillow 71.6/110: 65% rage chaotic_energy(20)
6:03.246 battle_cry Fluffy_Pillow 71.6/110: 65% rage precise_strikes, shattered_defenses, chaotic_energy(20)
6:03.246 execute Fluffy_Pillow 71.6/110: 65% rage precise_strikes, battle_cry, shattered_defenses, chaotic_energy(20)
6:04.477 execute Fluffy_Pillow 85.6/110: 78% rage battle_cry, chaotic_energy(20)
6:05.707 execute Fluffy_Pillow 53.6/110: 49% rage battle_cry, chaotic_energy(20)
6:06.937 execute Fluffy_Pillow 21.6/110: 20% rage battle_cry, chaotic_energy(20), mark_of_the_claw
6:08.150 colossus_smash Fluffy_Pillow 37.2/110: 34% rage battle_cry, chaotic_energy(20), mark_of_the_claw
6:09.362 execute Fluffy_Pillow 37.2/110: 34% rage precise_strikes, shattered_defenses, chaotic_energy(20), mark_of_the_claw
6:10.574 execute Fluffy_Pillow 40.0/110: 36% rage chaotic_energy(20), mark_of_the_claw
6:11.786 colossus_smash Fluffy_Pillow 8.0/110: 7% rage chaotic_energy(20)
6:13.017 execute Fluffy_Pillow 44.9/110: 41% rage precise_strikes, shattered_defenses, chaotic_energy(20)
6:14.246 execute Fluffy_Pillow 22.5/110: 20% rage chaotic_energy(20)
6:15.476 heroic_leap Fluffy_Pillow 0.0/110: 0% rage chaotic_energy(20)
6:15.476 colossus_smash Fluffy_Pillow 0.0/110: 0% rage chaotic_energy(20)
6:16.704 execute Fluffy_Pillow 25.2/110: 23% rage precise_strikes, shattered_defenses, chaotic_energy(20)
6:17.933 warbreaker Fluffy_Pillow 2.8/110: 3% rage chaotic_energy(20)
6:19.164 execute Fluffy_Pillow 28.0/110: 25% rage precise_strikes, shattered_defenses, chaotic_energy(20)
6:20.394 colossus_smash Fluffy_Pillow 5.6/110: 5% rage chaotic_energy(20)
6:21.623 execute Fluffy_Pillow 5.6/110: 5% rage precise_strikes, shattered_defenses, chaotic_energy(20)
6:22.853 execute Fluffy_Pillow 25.2/110: 23% rage chaotic_energy(20)
6:24.083 bladestorm Fluffy_Pillow 0.0/110: 0% rage chaotic_energy(20)
6:26.092 execute Fluffy_Pillow 25.2/110: 23% rage chaotic_energy(20)
6:27.322 Waiting 0.300 sec 0.0/110: 0% rage chaotic_energy(20)
6:27.622 execute Fluffy_Pillow 25.2/110: 23% rage chaotic_energy(20)
6:28.852 Waiting 21.300 sec 0.0/110: 0% rage chaotic_energy(20)
6:50.152 colossus_smash Fluffy_Pillow 110.0/110: 100% rage chaotic_energy(20)
6:51.624 heroic_leap Fluffy_Pillow 110.0/110: 100% rage precise_strikes, shattered_defenses, chaotic_energy(20)
6:51.624 execute Fluffy_Pillow 110.0/110: 100% rage precise_strikes, shattered_defenses, chaotic_energy(20)
6:52.853 colossus_smash Fluffy_Pillow 87.6/110: 80% rage chaotic_energy(20)
6:54.083 execute Fluffy_Pillow 110.0/110: 100% rage precise_strikes, shattered_defenses, chaotic_energy(20)
6:55.314 execute Fluffy_Pillow 87.6/110: 80% rage chaotic_energy(20)
6:56.544 execute Fluffy_Pillow 55.6/110: 51% rage chaotic_energy(20)
6:57.775 colossus_smash Fluffy_Pillow 48.8/110: 44% rage chaotic_energy(20)
6:59.003 execute Fluffy_Pillow 48.8/110: 44% rage precise_strikes, shattered_defenses, chaotic_energy(20)
7:00.231 execute Fluffy_Pillow 63.7/110: 58% rage chaotic_energy(20)
7:01.460 execute Fluffy_Pillow 31.7/110: 29% rage chaotic_energy(20), mark_of_the_claw
7:02.673 Waiting 0.100 sec 0.0/110: 0% rage chaotic_energy(20), mark_of_the_claw
7:02.773 execute Fluffy_Pillow 25.2/110: 23% rage chaotic_energy(20), mark_of_the_claw
7:03.985 battle_cry Fluffy_Pillow 0.0/110: 0% rage chaotic_energy(20), mark_of_the_claw
7:03.985 Waiting 1.700 sec 0.0/110: 0% rage battle_cry, chaotic_energy(20), mark_of_the_claw
7:05.685 execute Fluffy_Pillow 37.1/110: 34% rage battle_cry, chaotic_energy(20), mark_of_the_claw
7:06.898 Waiting 10.800 sec 5.1/110: 5% rage battle_cry, chaotic_energy(20), mark_of_the_claw
7:17.698 warbreaker Fluffy_Pillow 110.0/110: 100% rage chaotic_energy(20)
7:19.165 execute Fluffy_Pillow 110.0/110: 100% rage precise_strikes, shattered_defenses, chaotic_energy(20)
7:20.393 colossus_smash Fluffy_Pillow 110.0/110: 100% rage chaotic_energy(20)
7:21.623 heroic_leap Fluffy_Pillow 110.0/110: 100% rage precise_strikes, shattered_defenses, chaotic_energy(20)
7:21.624 execute Fluffy_Pillow 110.0/110: 100% rage precise_strikes, shattered_defenses, chaotic_energy(20)
7:22.855 colossus_smash Fluffy_Pillow 87.6/110: 80% rage chaotic_energy(20)
7:24.086 execute Fluffy_Pillow 110.0/110: 100% rage precise_strikes, shattered_defenses, chaotic_energy(20)
7:25.316 execute Fluffy_Pillow 87.6/110: 80% rage chaotic_energy(20)
7:26.547 execute Fluffy_Pillow 80.8/110: 73% rage chaotic_energy(20)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 24386 22680 11373 (7922)
Agility 6581 6256 0
Stamina 28153 28153 18222
Intellect 5325 5000 0
Spirit 0 0 0
Health 1689180 1689180 0
Rage 110 110 0
Crit 16.92% 16.92% 3821
Haste 22.38% 22.38% 7273
Damage / Heal Versatility 2.20% 2.20% 880
Attack Power 24386 22680 0
Mastery 52.60% 50.46% 6030
Armor 3981 3981 3981
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 844.00
Local Head Helmet of Reverent Loyalty
ilevel: 840, stats: { 542 Armor, +1182 StrInt, +1773 Sta, +736 Haste, +521 Mastery }
Local Neck Raging Furystone Gorget of the Feverflare
ilevel: 850, stats: { +1094 Sta, +734 Haste, +1101 Mastery }, gems: { +100 Haste }, enchant: mark_of_the_claw
Local Shoulders Skoldiir Shoulderguards
ilevel: 840, stats: { 501 Armor, +886 StrInt, +1329 Sta, +613 Crit, +330 Mastery }
Local Chest Inferno Breastplate
ilevel: 845, stats: { 675 Armor, +1238 StrInt, +1857 Sta, +777 Haste, +503 Crit }
Local Waist Ley-Scarred Waistplate
ilevel: 840, stats: { 376 Armor, +886 StrInt, +1329 Sta, +674 Mastery, +269 Crit }
Local Legs Legguards of Illusory Burdens
ilevel: 840, stats: { 584 Armor, +1772 Sta, +1182 StrInt, +844 Crit, +413 Haste }
Local Feet Coralplate Sandstompers
ilevel: 835, stats: { 454 Armor, +846 StrInt, +1269 Sta, +542 Mastery, +384 Vers }
Local Wrists Battlelord's Wristguards
ilevel: 840, stats: { 292 Armor, +997 Sta, +665 Str, +414 Haste, +293 Crit }, gems: { +150 Haste }
Local Hands Stormwake Handguards
ilevel: 850, stats: { 427 Armor, +973 StrInt, +1459 Sta, +658 Mastery, +322 Crit }
Local Finger1 Grasping Tentacle Loop
ilevel: 835, stats: { +952 Sta, +992 Mastery, +744 Haste }, enchant: { +150 Haste }
Local Finger2 Roggstone Signet
ilevel: 835, stats: { +952 Sta, +1241 Haste, +496 Vers }
Local Trinket1 Chaos Talisman
ilevel: 850, stats: { +932 Haste }
Local Trinket2 An'she's Invigoring Charm
ilevel: 835, stats: { +1073 Str, +882 Haste }
Local Back Imbued Silkweave Flourish of the Peerless
ilevel: 850, stats: { 130 Armor, +729 StrAgiInt, +1094 Sta, +262 Crit, +525 Mastery }, enchant: { +150 Str }
Local Main Hand Strom'kar, the Warbreaker
ilevel: 870, weapon: { 8086 - 12131, 3.6 }, stats: { +1563 Str, +2345 Sta, +715 Crit, +687 Mastery }, relics: { +37 ilevels, +43 ilevels, +40 ilevels }

Talents

Level
15 Dauntless (Arms Warrior) Overpower (Arms Warrior) Sweeping Strikes (Arms Warrior)
30 Shockwave (Arms Warrior) Storm Bolt (Arms Warrior) Double Time
45 Fervor of Battle (Arms Warrior) Rend (Arms Warrior) Avatar
60 Second Wind Bounding Stride Defensive Stance (Arms Warrior)
75 In For The Kill (Arms Warrior) Mortal Combo (Arms Warrior) Focused Rage (Arms Warrior)
90 Deadly Calm (Arms Warrior) Trauma (Arms Warrior) Titanic Might (Arms Warrior)
100 Anger Management Opportunity Strikes (Arms Warrior) Ravager (Arms Warrior)

Profile

warrior="Elidi"
origin="https://eu.api.battle.net/wow/character/hyjal/Elidi/advanced"
thumbnail="http://eu.battle.net/static-render/eu/hyjal/63/114172479-avatar.jpg"
level=110
race=night_elf
timeofday=day
role=attack
position=back
professions=engineering=756/mining=770
talents=http://eu.battle.net/wow/en/tool/talent-calculator#Za!0201011
artifact=36:0:0:0:0:1136:1:1137:1:1142:1:1145:3:1148:3:1149:2:1150:3:1356:1
spec=arms

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=countless_armies
actions.precombat+=/food,type=nightborne_delicacy_platter
actions.precombat+=/augmentation,type=defiled
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=deadly_grace

# Executed every time the actor is available.
actions=charge
actions+=/auto_attack
actions+=/potion,name=deadly_grace,if=(target.health.pct<20&buff.battle_cry.up)|target.time_to_die<=26
actions+=/battle_cry,if=(buff.bloodlust.up|time>=1)&!gcd.remains
actions+=/avatar,if=(buff.bloodlust.up|time>=1)&!gcd.remains
actions+=/blood_fury,if=buff.battle_cry.up|target.time_to_die<=16
actions+=/berserking,if=buff.battle_cry.up|target.time_to_die<=11
actions+=/arcane_torrent,if=buff.battle_cry_deadly_calm.down&rage.deficit>40
actions+=/use_item,name=leyscarred_waistplate
actions+=/hamstring,if=buff.battle_cry_deadly_calm.remains>cooldown.hamstring.remains
actions+=/heroic_leap,if=debuff.colossus_smash.up
actions+=/rend,if=remains<gcd
actions+=/focused_rage,if=buff.battle_cry_deadly_calm.remains>cooldown.focused_rage.remains&(buff.focused_rage.stack<3|cooldown.mortal_strike.remains)
actions+=/colossus_smash,if=debuff.colossus_smash.down
actions+=/warbreaker,if=debuff.colossus_smash.down
actions+=/ravager
actions+=/overpower
actions+=/run_action_list,name=cleave,if=spell_targets.whirlwind>=2&talent.sweeping_strikes.enabled
actions+=/run_action_list,name=aoe,if=spell_targets.whirlwind>=2&!talent.sweeping_strikes.enabled
actions+=/run_action_list,name=execute,if=target.health.pct<=20
actions+=/run_action_list,name=single

actions.single=mortal_strike,if=buff.battle_cry.up&buff.focused_rage.stack>=1&buff.battle_cry.remains<gcd
actions.single+=/colossus_smash,if=buff.shattered_defenses.down
actions.single+=/warbreaker,if=buff.shattered_defenses.down&cooldown.mortal_strike.remains<gcd
actions.single+=/focused_rage,if=buff.focused_rage.stack<3&(buff.shattered_defenses.up|cooldown.colossus_smash.remains)
actions.single+=/mortal_strike
actions.single+=/slam,if=buff.battle_cry_deadly_calm.up|buff.focused_rage.stack=3|rage.deficit<=30
actions.single+=/execute,if=equipped.137060
actions.single+=/slam,if=equipped.137060
actions.single+=/focused_rage,if=equipped.137060
# actions.single+=/heroic_charge,if=rage.deficit>=40&(!cooldown.heroic_leap.remains|swing.mh.remains>1.2)
#Remove the # above to run out of melee and charge back in for rage.
actions.single+=/bladestorm,interrupt=1,if=raid_event.adds.in>90|!raid_event.adds.exists|spell_targets.bladestorm_mh>desired_targets

actions.cleave=mortal_strike
actions.cleave+=/execute,if=buff.stone_heart.react
actions.cleave+=/colossus_smash,if=buff.shattered_defenses.down&buff.precise_strikes.down
actions.cleave+=/warbreaker,if=buff.shattered_defenses.down
actions.cleave+=/focused_rage,if=buff.shattered_defenses.down
actions.cleave+=/whirlwind,if=talent.fervor_of_battle.enabled&(debuff.colossus_smash.up|rage.deficit<50)&(!talent.focused_rage.enabled|buff.battle_cry_deadly_calm.up|buff.cleave.up)
actions.cleave+=/rend,if=remains<=duration*0.3
actions.cleave+=/bladestorm
actions.cleave+=/cleave
actions.cleave+=/whirlwind,if=rage>=100|buff.focused_rage.stack=3
actions.cleave+=/shockwave
actions.cleave+=/storm_bolt

actions.aoe=mortal_strike
actions.aoe+=/execute,if=buff.stone_heart.react
actions.aoe+=/colossus_smash,if=buff.shattered_defenses.down&buff.precise_strikes.down
actions.aoe+=/warbreaker,if=buff.shattered_defenses.down
actions.aoe+=/whirlwind,if=talent.fervor_of_battle.enabled&(debuff.colossus_smash.up|rage.deficit<50)&(!talent.focused_rage.enabled|buff.battle_cry_deadly_calm.up|buff.cleave.up)
actions.aoe+=/rend,if=remains<=duration*0.3
actions.aoe+=/bladestorm
actions.aoe+=/cleave
actions.aoe+=/whirlwind,if=rage>=60
actions.aoe+=/shockwave
actions.aoe+=/storm_bolt

actions.execute=focused_rage,if=buff.focused_rage.stack<3&debuff.colossus_smash.down
actions.execute+=/mortal_strike,if=buff.battle_cry.up&(buff.focused_rage.stack=3|buff.focused_rage.stack=2&buff.battle_cry.remains<gcd)
actions.execute+=/execute,if=buff.battle_cry_deadly_calm.up
actions.execute+=/colossus_smash,if=buff.shattered_defenses.down
actions.execute+=/warbreaker,if=buff.shattered_defenses.down&rage<=30
actions.execute+=/execute,if=buff.shattered_defenses.up
actions.execute+=/mortal_strike,if=buff.focused_rage.stack=3
actions.execute+=/execute,if=debuff.colossus_smash.up
# actions.single+=/heroic_charge,if=rage.deficit>=40&(!cooldown.heroic_leap.remains|swing.mh.remains>1.2)
#Remove the # above to run out of melee and charge back in for rage.
actions.execute+=/bladestorm,interrupt=1,if=raid_event.adds.in>90|!raid_event.adds.exists|spell_targets.bladestorm_mh>desired_targets

head=helmet_of_reverent_loyalty,id=134513,bonus_id=1727/1492/1813
neck=raging_furystone_gorget,id=130243,bonus_id=1767/689/600/669,gems=100haste,enchant=mark_of_the_claw
shoulders=skoldiir_shoulderguards,id=134184,bonus_id=1727/1502/1813
back=imbued_silkweave_flourish,id=127034,bonus_id=689/3346/3408/600/669,enchant=150str
chest=inferno_breastplate,id=134503,bonus_id=1727/1497/3336
wrists=battlelords_wristguards,id=139688,bonus_id=3385/3384,gems=150haste
hands=stormwake_handguards,id=134508,bonus_id=1727/1502/3336
waist=leyscarred_waistplate,id=134313,bonus_id=3395/1502/3337,addon=nitro_boosts
legs=legguards_of_illusory_burdens,id=137528,bonus_id=1727/1492/1813
feet=coralplate_sandstompers,id=134229,bonus_id=3432/1497/1674
finger1=grasping_tentacle_loop,id=133634,bonus_id=1726/1487/3339,enchant=150haste
finger2=roggstone_signet,id=134157,bonus_id=3432/1497/1674
trinket1=chaos_talisman,id=137459,bonus_id=1727/1502/3336
trinket2=anshes_invigoring_charm,id=139102,bonus_id=3432/604/1497/1674
main_hand=stromkar_the_warbreaker,id=128910,bonus_id=750,gem_id=141268/137412/137399/0,relic_id=3397:1492:1675/1727:1502:3336/1727:1492:1813/0

# Gear Summary
# gear_ilvl=843.67
# gear_strength=11373
# gear_stamina=18222
# gear_crit_rating=3821
# gear_haste_rating=7273
# gear_mastery_rating=6030
# gear_versatility_rating=880
# gear_armor=3981

Zuan

Zuan : 219093 dps

  • Race: Human
  • Class: Warrior
  • Spec: Arms
  • Level: 110
  • Role: Attack
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
219092.5 219092.5 242.7 / 0.111% 48049.1 / 21.9% 28450.6
RPS Out RPS In Primary Resource Waiting APM Active Skill
7.7 7.7 Rage 13.08% 41.2 100.0% 100%
Origin https://eu.api.battle.net/wow/character/hyjal/Zuan/advanced
Talents
  • 15: Dauntless (Arms Warrior)
  • 30: Double Time
  • 45: Avatar
  • 60: Defensive Stance (Arms Warrior)
  • 75: Mortal Combo (Arms Warrior)
  • 90: Trauma (Arms Warrior)
  • 100: Opportunity Strikes (Arms Warrior)
  • Talent Calculator
Artifact
Professions
  • mining: 774
  • blacksmithing: 758

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Zuan 219093
auto_attack_mh 17830 8.1% 139.7 3.25sec 57418 17794 Direct 139.7 47256 98156 57418 20.0%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 139.70 139.70 0.00 0.00 3.2268 0.0000 8021418.29 11792244.70 31.98 17794.10 17794.10
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 111.81 80.04% 47256.02 28374 64168 47263.83 41761 53176 5283886 7767814 31.98
crit 27.89 19.96% 98155.62 56748 128336 98325.89 78317 115316 2737532 4024431 31.98
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Bladestorm 0 (3617) 0.0% (1.7%) 4.9 99.35sec 333650 139896

Stats details: bladestorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.87 0.00 16.55 0.00 2.3851 0.6282 0.00 0.00 0.00 139895.59 139895.59
 
 

Action details: bladestorm

Static Values
  • id:227847
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:raid_event.adds.in>90|!raid_event.adds.exists|spell_targets.bladestorm_mh>desired_targets
Spelldata
  • id:227847
  • name:Bladestorm
  • school:physical
  • tooltip:Dealing damage to all nearby enemies every $t1 sec. Immune to crowd control.
  • description:Become an unstoppable storm of destructive force, striking all targets within $50622A1 yards {$?s23881=false}[with both weapons for ${7*($50622sw2+$95738sw2)} Physical damage][for ${7*$168969sw2} Physical damage] over {$d=6 seconds}. You are immune to movement impairing and loss of control effects, but can use defensive abilities and can avoid attacks.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Bladestorm (_mh) 3617 1.7% 0.0 0.00sec 0 0 Direct 16.5 85858 167477 98249 15.2%  

Stats details: bladestorm_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 16.55 0.00 0.00 0.0000 0.0000 1626006.39 2390383.41 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.04 84.81% 85857.53 57939 131030 86985.51 57939 131030 1205123 1771646 31.98
crit 2.51 15.19% 167477.21 115878 262061 151956.26 0 262061 420883 618738 28.37
 
 

Action details: bladestorm_mh

Static Values
  • id:50622
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:50622
  • name:Bladestorm
  • school:physical
  • tooltip:
  • description:You become a whirling storm of destructive force, striking all nearby targets with your main hand weapon for $sw2 Physical damage.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.17
 
Colossus Smash 19842 9.1% 48.3 9.32sec 184637 135496 Direct 48.3 153666 315347 184632 19.2%  

Stats details: colossus_smash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.32 48.32 0.00 0.00 1.3627 0.0000 8922028.34 13116226.77 31.98 135496.35 135496.35
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.07 80.85% 153666.48 93342 211095 153139.77 121739 178100 6003282 8825393 31.98
crit 9.26 19.15% 315346.55 186684 422189 315420.63 186684 422189 2918746 4290834 31.98
 
 

Action details: colossus_smash

Static Values
  • id:167105
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.colossus_smash.down
Spelldata
  • id:167105
  • name:Colossus Smash
  • school:physical
  • tooltip:
  • description:Smashes the enemy's armor, dealing $sw1 Physical damage, and increasing damage you deal to them by {$208086s3=15}% for {$208086d=8 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.02
 
Corrupted Blood of Zakajz 19298 8.8% 0.0 0.00sec 0 0 Periodic 46.2 187344 0 187344 0.0% 20.5%

Stats details: corrupted_blood_of_zakajz

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 46.18 46.18 0.0000 2.0000 8653093.97 8653093.97 0.00 93679.63 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 46.2 100.00% 187343.53 1250 485793 187806.95 99950 256808 8653094 8653094 0.00
 
 

Action details: corrupted_blood_of_zakajz

Static Values
  • id:209569
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:209569
  • name:Corrupted Blood of Zakajz
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t sec.
  • description:{$@spelldesc209566=For {$209567d=5 seconds} after activating Battle Cry, |cFFFFCC99Strom'kar|r radiates shadowy energy, causing all your attacks to deal an additional {$209567s1=20}% damage as Shadow over {$209569d=6 seconds}.}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:50.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Deadly Grace 5120 2.3% 21.9 20.38sec 103552 0 Direct 21.9 78638 160647 103578 30.4%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.89 21.89 0.00 0.00 0.0000 0.0000 2267221.41 2267221.41 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.23 69.59% 78637.81 71017 85221 78631.70 72308 85221 1197861 1197861 0.00
crit 6.66 30.41% 160646.67 142035 170441 160733.56 145191 170441 1069360 1069360 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:5.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=47572 to 71358} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:47572.00
  • base_dd_max:71358.00
 
Execute 30068 13.7% 27.6 3.12sec 488373 349971 Direct 27.6 350395 785309 488361 31.7%  

Stats details: execute

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.63 27.63 0.00 0.00 1.3955 0.0000 13495919.65 19840280.25 31.98 349970.69 349970.69
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.87 68.27% 350395.30 81329 507495 350585.44 278686 431678 6610995 9718789 31.98
crit 8.77 31.73% 785309.39 162659 1014989 788772.68 0 1014989 6884924 10121491 31.96
 
 

Action details: execute

Static Values
  • id:163201
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:equipped.137060
Spelldata
  • id:163201
  • name:Execute
  • school:physical
  • tooltip:
  • description:Attempts to finish off a foe, causing $sw2 Physical damage, and consuming up to $m3 additional Rage to deal up to ${$sw2*3} additional damage. Only usable on enemies that have less than 20% health.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.62
 
Heroic Leap 723 0.3% 9.7 48.53sec 33345 0 Direct 9.7 25287 53293 33394 28.9%  

Stats details: heroic_leap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.74 9.73 0.00 0.00 0.0000 0.0000 324915.59 477656.70 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.91 71.06% 25287.40 12632 28568 25287.70 21571 28568 174836 257025 31.98
crit 2.82 28.94% 53293.33 25264 57135 53794.80 41200 57135 150080 220632 31.98
 
 

Action details: heroic_leap

Static Values
  • id:6544
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.colossus_smash.up
Spelldata
  • id:6544
  • name:Heroic Leap
  • school:physical
  • tooltip:
  • description:Leap through the air toward a target location, slamming down with destructive force to deal {$52174s1=1} Physical damage to all enemies within $52174a1 yards{$?s23922=false}[, and resetting the remaining cooldown on Taunt][].
 
Mortal Strike 61768 28.2% 98.0 3.64sec 283615 210483 Direct 98.0 195879 468939 283612 32.1%  

Stats details: mortal_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.01 98.01 0.00 0.00 1.3475 0.0000 27797174.11 40864478.97 31.98 210482.60 210482.60
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 66.52 67.87% 195879.05 100175 294511 195630.61 163418 223770 13029877 19155153 31.98
crit 31.49 32.13% 468938.67 200349 589023 469198.67 384466 530183 14767297 21709326 31.98
 
 

Action details: mortal_strike

Static Values
  • id:12294
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.battle_cry.up&buff.focused_rage.stack>=1&buff.battle_cry.remains<gcd
Spelldata
  • id:12294
  • name:Mortal Strike
  • school:physical
  • tooltip:
  • description:A vicious strike that deals $sw3 Physical damage and reduces the effectiveness of healing on the target for {$115804d=10 seconds}.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.76
 
Opportunity Strikes 17433 8.0% 88.9 4.75sec 88199 0 Direct 88.9 73388 148100 88196 19.8%  

Stats details: opportunity_strikes

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 88.89 88.89 0.00 0.00 0.0000 0.0000 7839889.27 11525379.84 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 71.27 80.18% 73387.68 42622 96390 73383.63 63309 83083 5230444 7689248 31.98
crit 17.62 19.82% 148100.17 85244 192780 148087.10 96016 188190 2609446 3836132 31.98
 
 

Action details: opportunity_strikes

Static Values
  • id:203178
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:203178
  • name:Opportunity Strikes
  • school:physical
  • tooltip:
  • description:{$@spelldesc203179=Your melee abilities have up to a {$h=60}% chance, based on the target's missing health, to trigger an extra attack that deals $203178sw1 Physical damage.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.60
 
Slam 29836 13.6% 96.6 3.65sec 139139 102847 Direct 96.6 115855 239014 139137 18.9%  

Stats details: slam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 96.58 96.58 0.00 0.00 1.3529 0.0000 13437731.21 19754737.74 31.98 102846.60 102846.60
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 78.32 81.10% 115855.03 72246 163386 116013.88 100454 137878 9073892 13339481 31.98
crit 18.26 18.90% 239013.73 144493 326773 239676.77 173800 311212 4363839 6415257 31.98
 
 

Action details: slam

Static Values
  • id:1464
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.battle_cry_deadly_calm.up|buff.focused_rage.stack=3|rage.deficit<=30
Spelldata
  • id:1464
  • name:Slam
  • school:physical
  • tooltip:
  • description:Slams an opponent, causing $sw2 Physical damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.71
 
Trauma 7253 3.3% 0.0 0.00sec 0 0 Periodic 163.8 15926 36903 19951 19.2% 72.7%

Stats details: trauma

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 163.77 163.77 0.0000 2.0000 3267453.24 3267453.24 0.00 9975.74 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 132.3 80.81% 15925.74 4816 51192 15932.11 13125 20032 2107639 2107639 0.00
crit 31.4 19.19% 36902.70 9633 100372 36866.93 25928 52593 1159814 1159814 0.00
 
 

Action details: trauma

Static Values
  • id:215537
  • school:physical
  • resource:none
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215537
  • name:Trauma
  • school:physical
  • tooltip:Bleeding for $w1 every $t1 sec.
  • description:{$@spelldesc215538=Slam and Whirlwind now cause the target to bleed for {$s1=20}% additional damage over {$215537d=6 seconds}. Multiple uses accumulate increased damage.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Warbreaker 6305 2.9% 7.6 62.23sec 369700 273160 Direct 7.6 232068 463643 369698 59.4%  

Stats details: warbreaker

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.65 7.65 0.00 0.00 1.3535 0.0000 2827748.50 2827748.50 0.00 273159.63 273159.63
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.10 40.56% 232067.88 137065 309975 199778.43 0 309975 719975 719975 0.00
crit 4.55 59.44% 463643.21 274130 619950 474547.46 0 619950 2107774 2107774 0.00
 
 

Action details: warbreaker

Static Values
  • id:209577
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.colossus_smash.down
Spelldata
  • id:209577
  • name:Warbreaker
  • school:shadow
  • tooltip:
  • description:Stomp the ground, causing a ring of corrupted spikes to erupt upwards, dealing $sw1 Shadow damage and applying the Colossus Smash effect to all nearby enemies.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.50
 
Simple Action Stats Execute Interval
Zuan
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Zuan
  • harmful:false
  • if_expr:
 
Avatar 5.5 90.36sec

Stats details: avatar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.48 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: avatar

Static Values
  • id:107574
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.bloodlust.up|time>=1)&!gcd.remains
Spelldata
  • id:107574
  • name:Avatar
  • school:physical
  • tooltip:Damage done increased by {$s1=20}%.
  • description:Transform into a colossus for {$d=20 seconds}, causing you to deal {$s1=20}% increased damage and removing all roots and snares.
 
Battle Cry 8.0 60.39sec

Stats details: battle_cry

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.95 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: battle_cry

Static Values
  • id:1719
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.bloodlust.up|time>=1)&!gcd.remains
Spelldata
  • id:1719
  • name:Battle Cry
  • school:physical
  • tooltip:Critical strike chance increased by $w1%.
  • description:Lets loose a battle cry, granting {$s1=100}% increased critical strike chance for {$d=5 seconds}.$?a202751[ |cFFFFFFFFGenerates ${{$202751s2=1000}/10} Rage.|r][]
 
Charge 1.0 0.00sec

Stats details: charge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: charge

Static Values
  • id:100
  • school:physical
  • resource:none
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:17.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:100
  • name:Charge
  • school:physical
  • tooltip:
  • description:Charge to an enemy, {$?s103828=false}[stunning][rooting] it for {$?s103828=false}[{$7922d=1.500 seconds}][{$105771d=1.500 seconds}]. |cFFFFFFFFGenerates {$/10;s2=20} Rage.|r
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Zuan
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Zuan
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Avatar 5.5 0.0 90.4sec 90.4sec 23.78% 23.84% 0.0(0.0) 5.2

Buff details

  • buff initial source:Zuan
  • cooldown name:buff_avatar
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • avatar_1:23.78%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:107574
  • name:Avatar
  • tooltip:Damage done increased by {$s1=20}%.
  • description:Transform into a colossus for {$d=20 seconds}, causing you to deal {$s1=20}% increased damage and removing all roots and snares.
  • max_stacks:0
  • duration:20.00
  • cooldown:90.00
  • default_chance:0.00%
Battle Cry 8.0 0.0 60.4sec 60.4sec 8.78% 8.84% 0.0(0.0) 7.9

Buff details

  • buff initial source:Zuan
  • cooldown name:buff_battle_cry
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • battle_cry_1:8.78%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1719
  • name:Battle Cry
  • tooltip:Critical strike chance increased by $w1%.
  • description:Lets loose a battle cry, granting {$s1=100}% increased critical strike chance for {$d=5 seconds}.$?a202751[ |cFFFFFFFFGenerates ${{$202751s2=1000}/10} Rage.|r][]
  • max_stacks:0
  • duration:5.00
  • cooldown:60.00
  • default_chance:0.00%
Bladestorm 4.9 0.0 99.3sec 99.3sec 2.31% 2.31% 0.0(0.0) 0.0

Buff details

  • buff initial source:Zuan
  • cooldown name:buff_bladestorm
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bladestorm_1:2.31%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:227847
  • name:Bladestorm
  • tooltip:Dealing damage to all nearby enemies every $t1 sec. Immune to crowd control.
  • description:Become an unstoppable storm of destructive force, striking all targets within $50622A1 yards {$?s23881=false}[with both weapons for ${7*($50622sw2+$95738sw2)} Physical damage][for ${7*$168969sw2} Physical damage] over {$d=6 seconds}. You are immune to movement impairing and loss of control effects, but can use defensive abilities and can avoid attacks.
  • max_stacks:0
  • duration:6.00
  • cooldown:90.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 11.98% 0.0(0.0) 1.0

Buff details

  • buff initial source:Zuan
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Corrupted Blood of Zakajz 8.0 0.0 60.4sec 60.4sec 8.78% 10.25% 0.0(0.0) 7.9

Buff details

  • buff initial source:Zuan
  • cooldown name:buff_corrupted_blood_of_zakajz
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • corrupted_blood_of_zakajz_1:8.78%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:209567
  • name:Corrupted Blood of Zakajz
  • tooltip:An additional {$s1=20}% of all damage dealt will be done to your enemies over {$209569d=6 seconds}.
  • description:{$@spelldesc209566=For {$209567d=5 seconds} after activating Battle Cry, |cFFFFCC99Strom'kar|r radiates shadowy energy, causing all your attacks to deal an additional {$209567s1=20}% damage as Shadow over {$209569d=6 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:101.00%
Potion of Deadly Grace 2.0 0.0 383.0sec 0.0sec 10.82% 10.89% 0.0(0.0) 2.0

Buff details

  • buff initial source:Zuan
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:10.82%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
precise_strikes 56.0 0.0 8.1sec 8.2sec 17.77% 17.80% 0.0(0.0) 0.0

Buff details

  • buff initial source:Zuan
  • cooldown name:buff_precise_strikes
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.45

Stack Uptimes

  • precise_strikes_1:17.77%

Trigger Attempt Success

  • trigger_pct:100.00%
Shattered Defenses 56.0 0.0 8.1sec 8.2sec 17.77% 30.65% 0.0(0.0) 0.0

Buff details

  • buff initial source:Zuan
  • cooldown name:buff_shattered_defenses
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30

Stack Uptimes

  • shattered_defenses_1:17.77%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:209706
  • name:Shattered Defenses
  • tooltip:Damage and critical strike chance of your next Mortal Strike or Execute increased by {$s1=30}%.
  • description:{$@spelldesc209574=After using Colossus Smash, your next Mortal Strike or Execute gains {$209706s1=30}% increased critical strike chance and deals {$209706s2=30}% additional damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Zuan
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Countless Armies

Buff details

  • buff initial source:Zuan
  • cooldown name:buff_flask_of_the_countless_armies
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:strength
  • amount:1300.00

Stack Uptimes

  • flask_of_the_countless_armies_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188034
  • name:Flask of the Countless Armies
  • tooltip:Strength increased by $w1.
  • description:Increases Strength by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (nightborne_delicacy_platter)

Buff details

  • buff initial source:Zuan
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:375.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Battle Cry0.5940.0015.8572.7070.00011.014
Avatar0.5470.0015.4081.6210.0007.171
Heroic Leap3.9600.00125.45730.9720.954116.746
Colossus Smash1.3540.0015.32162.03927.698106.535
Warbreaker2.8850.00151.61714.7990.00063.907
Mortal Strike1.3200.0013.25125.2223.74269.560
Bladestorm11.6580.001124.85736.2080.000165.968

Resources

Resource Usage Type Count Total Average RPE APR
Zuan
execute Rage 27.6 661.7 23.9 23.9 20395.6
mortal_strike Rage 98.0 1254.5 12.8 12.8 22158.1
slam Rage 96.6 1545.3 16.0 16.0 8696.0
Resource Gains Type Count Total Average Overflow
charge Rage 1.00 20.00 (0.57%) 20.00 0.00 0.00%
melee_crit Rage 27.89 869.66 (24.75%) 31.18 159.63 15.51%
melee_main_hand Rage 111.81 2623.74 (74.68%) 23.47 193.88 6.88%
Resource RPS-Gain RPS-Loss
Rage 7.80 7.68
Combat End Resource Mean Min Max
Rage 51.64 0.00 110.00

Benefits & Uptimes

Benefits %
Uptimes %
Rage Cap 8.3%

Procs

Count Interval
tactician 45.0 9.8sec

Statistics & Data Analysis

Fight Length
Sample Data Zuan Fight Length
Count 9999
Mean 450.42
Minimum 350.15
Maximum 555.44
Spread ( max - min ) 205.29
Range [ ( max - min ) / 2 * 100% ] 22.79%
DPS
Sample Data Zuan Damage Per Second
Count 9999
Mean 219092.53
Minimum 178381.70
Maximum 282450.92
Spread ( max - min ) 104069.22
Range [ ( max - min ) / 2 * 100% ] 23.75%
Standard Deviation 12381.7125
5th Percentile 199653.18
95th Percentile 239934.65
( 95th Percentile - 5th Percentile ) 40281.47
Mean Distribution
Standard Deviation 123.8233
95.00% Confidence Intervall ( 218849.84 - 219335.22 )
Normalized 95.00% Confidence Intervall ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 122
0.1% Error 12268
0.1 Scale Factor Error with Delta=300 1308715
0.05 Scale Factor Error with Delta=300 5234860
0.01 Scale Factor Error with Delta=300 130871506
Priority Target DPS
Sample Data Zuan Priority Target Damage Per Second
Count 9999
Mean 219092.53
Minimum 178381.70
Maximum 282450.92
Spread ( max - min ) 104069.22
Range [ ( max - min ) / 2 * 100% ] 23.75%
Standard Deviation 12381.7125
5th Percentile 199653.18
95th Percentile 239934.65
( 95th Percentile - 5th Percentile ) 40281.47
Mean Distribution
Standard Deviation 123.8233
95.00% Confidence Intervall ( 218849.84 - 219335.22 )
Normalized 95.00% Confidence Intervall ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 122
0.1% Error 12268
0.1 Scale Factor Error with Delta=300 1308715
0.05 Scale Factor Error with Delta=300 5234860
0.01 Scale Factor Error with Delta=300 130871506
DPS(e)
Sample Data Zuan Damage Per Second (Effective)
Count 9999
Mean 219092.53
Minimum 178381.70
Maximum 282450.92
Spread ( max - min ) 104069.22
Range [ ( max - min ) / 2 * 100% ] 23.75%
Damage
Sample Data Zuan Damage
Count 9999
Mean 98480599.97
Minimum 65860438.88
Maximum 133086853.61
Spread ( max - min ) 67226414.73
Range [ ( max - min ) / 2 * 100% ] 34.13%
DTPS
Sample Data Zuan Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Zuan Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Zuan Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Zuan Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Zuan Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Zuan Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data ZuanTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Zuan Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=countless_armies
1 0.00 food,type=nightborne_delicacy_platter
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=deadly_grace
Default action list Executed every time the actor is available.
# count action,conditions
5 1.00 charge
6 1.00 auto_attack
7 1.00 potion,name=deadly_grace,if=(target.health.pct<20&buff.battle_cry.up)|target.time_to_die<=26
8 7.96 battle_cry,if=(buff.bloodlust.up|time>=1)&!gcd.remains
9 5.48 avatar,if=(buff.bloodlust.up|time>=1)&!gcd.remains
0.00 blood_fury,if=buff.battle_cry.up|target.time_to_die<=16
0.00 berserking,if=buff.battle_cry.up|target.time_to_die<=11
0.00 arcane_torrent,if=buff.battle_cry_deadly_calm.down&rage.deficit>40
0.00 hamstring,if=buff.battle_cry_deadly_calm.remains>cooldown.hamstring.remains
A 9.74 heroic_leap,if=debuff.colossus_smash.up
0.00 rend,if=remains<gcd
0.00 focused_rage,if=buff.battle_cry_deadly_calm.remains>cooldown.focused_rage.remains&(buff.focused_rage.stack<3|cooldown.mortal_strike.remains)
B 16.80 colossus_smash,if=debuff.colossus_smash.down
C 2.71 warbreaker,if=debuff.colossus_smash.down
0.00 ravager
0.00 overpower
D 0.00 run_action_list,name=cleave,if=spell_targets.whirlwind>=2&talent.sweeping_strikes.enabled
E 0.00 run_action_list,name=aoe,if=spell_targets.whirlwind>=2&!talent.sweeping_strikes.enabled
F 0.00 run_action_list,name=execute,if=target.health.pct<=20
G 0.00 run_action_list,name=single
actions.single
# count action,conditions
0.00 mortal_strike,if=buff.battle_cry.up&buff.focused_rage.stack>=1&buff.battle_cry.remains<gcd
H 22.48 colossus_smash,if=buff.shattered_defenses.down
I 4.21 warbreaker,if=buff.shattered_defenses.down&cooldown.mortal_strike.remains<gcd
0.00 focused_rage,if=buff.focused_rage.stack<3&(buff.shattered_defenses.up|cooldown.colossus_smash.remains)
J 98.01 mortal_strike
K 96.58 slam,if=buff.battle_cry_deadly_calm.up|buff.focused_rage.stack=3|rage.deficit<=30
0.00 execute,if=equipped.137060
0.00 slam,if=equipped.137060
0.00 focused_rage,if=equipped.137060
L 3.92 bladestorm,interrupt=1,if=raid_event.adds.in>90|!raid_event.adds.exists|spell_targets.bladestorm_mh>desired_targets
actions.single+=/heroic_charge,if=rage.deficit>=40&(!cooldown.heroic_leap.remains|swing.mh.remains>1.2) #Remove the # above to run out of melee and charge back in for rage.
actions.execute
# count action,conditions
0.00 focused_rage,if=buff.focused_rage.stack<3&debuff.colossus_smash.down
0.00 mortal_strike,if=buff.battle_cry.up&(buff.focused_rage.stack=3|buff.focused_rage.stack=2&buff.battle_cry.remains<gcd)
0.00 execute,if=buff.battle_cry_deadly_calm.up
M 9.04 colossus_smash,if=buff.shattered_defenses.down
N 0.73 warbreaker,if=buff.shattered_defenses.down&rage<=30
O 12.21 execute,if=buff.shattered_defenses.up
0.00 mortal_strike,if=buff.focused_rage.stack=3
P 15.43 execute,if=debuff.colossus_smash.up
Q 0.95 bladestorm,interrupt=1,if=raid_event.adds.in>90|!raid_event.adds.exists|spell_targets.bladestorm_mh>desired_targets
actions.single+=/heroic_charge,if=rage.deficit>=40&(!cooldown.heroic_leap.remains|swing.mh.remains>1.2) #Remove the # above to run out of melee and charge back in for rage.

Sample Sequence

012456B89AJIJKJKLKBJJKKJKKJKJKKJKKJKJKKBJKKKAJKKJKJB8JIJHJHJJHJJKKKJBJKJKK9JKKJLKKJKJKBAKJKHJJ8KKHJIJKHJJKKHJJHJHJJHJJKKKJKKBAJJKKJKKKJK98JKKKCJKKHJJKLJKKKBJJAKKJKKJKKJKKJKJBKK8JHJKIJHJJKAKKBJJHJJKKK9BJJKKJKKBJJLKJKKKJBJ8AJHJKHJIJKJKKKBJHJJKKJKKJKBJJKKJKKJKKJK9B87AOPMOMOPPMOPNOPQPBOPAMOPPPMOPP8PCOMOPPM

Sample Sequence Table

time name target resources buffs
Pre flask Zuan 0.0/110: 0% rage
Pre food Zuan 0.0/110: 0% rage
Pre augmentation Zuan 0.0/110: 0% rage
Pre potion Fluffy_Pillow 0.0/110: 0% rage potion_of_deadly_grace
0:00.000 charge Fluffy_Pillow 0.0/110: 0% rage potion_of_deadly_grace
0:00.000 auto_attack Fluffy_Pillow 20.0/110: 18% rage potion_of_deadly_grace
0:00.000 colossus_smash Fluffy_Pillow 45.2/110: 41% rage potion_of_deadly_grace
0:01.397 battle_cry Fluffy_Pillow 70.4/110: 64% rage bloodlust, shattered_defenses, potion_of_deadly_grace
0:01.397 avatar Fluffy_Pillow 70.4/110: 64% rage bloodlust, corrupted_blood_of_zakajz, battle_cry, shattered_defenses, potion_of_deadly_grace
0:01.397 heroic_leap Fluffy_Pillow 70.4/110: 64% rage bloodlust, avatar, corrupted_blood_of_zakajz, battle_cry, shattered_defenses, potion_of_deadly_grace
0:01.397 mortal_strike Fluffy_Pillow 70.4/110: 64% rage bloodlust, avatar, corrupted_blood_of_zakajz, battle_cry, shattered_defenses, potion_of_deadly_grace
0:02.471 warbreaker Fluffy_Pillow 61.6/110: 56% rage bloodlust, avatar, corrupted_blood_of_zakajz, battle_cry, potion_of_deadly_grace
0:03.546 mortal_strike Fluffy_Pillow 61.6/110: 56% rage bloodlust, avatar, corrupted_blood_of_zakajz, precise_strikes, battle_cry, shattered_defenses, potion_of_deadly_grace
0:04.619 slam Fluffy_Pillow 89.6/110: 81% rage bloodlust, avatar, corrupted_blood_of_zakajz, battle_cry, potion_of_deadly_grace
0:05.693 mortal_strike Fluffy_Pillow 73.6/110: 67% rage bloodlust, avatar, corrupted_blood_of_zakajz, battle_cry, potion_of_deadly_grace
0:06.765 slam Fluffy_Pillow 94.3/110: 86% rage bloodlust, avatar, potion_of_deadly_grace
0:07.839 bladestorm Fluffy_Pillow 78.3/110: 71% rage bloodlust, avatar, potion_of_deadly_grace
0:09.430 slam Fluffy_Pillow 103.5/110: 94% rage bloodlust, avatar, potion_of_deadly_grace
0:10.505 colossus_smash Fluffy_Pillow 87.5/110: 80% rage bloodlust, avatar, potion_of_deadly_grace
0:11.580 mortal_strike Fluffy_Pillow 110.0/110: 100% rage bloodlust, avatar, precise_strikes, shattered_defenses, potion_of_deadly_grace
0:12.653 mortal_strike Fluffy_Pillow 101.2/110: 92% rage bloodlust, avatar, potion_of_deadly_grace
0:13.729 slam Fluffy_Pillow 85.2/110: 77% rage bloodlust, avatar, potion_of_deadly_grace
0:14.805 slam Fluffy_Pillow 94.4/110: 86% rage bloodlust, avatar, potion_of_deadly_grace
0:15.879 mortal_strike Fluffy_Pillow 78.4/110: 71% rage bloodlust, avatar, potion_of_deadly_grace
0:16.956 slam Fluffy_Pillow 87.6/110: 80% rage bloodlust, avatar, potion_of_deadly_grace
0:18.030 Waiting 1.000 sec 71.6/110: 65% rage bloodlust, avatar, potion_of_deadly_grace
0:19.030 slam Fluffy_Pillow 96.8/110: 88% rage bloodlust, avatar, potion_of_deadly_grace
0:20.104 mortal_strike Fluffy_Pillow 80.8/110: 73% rage bloodlust, avatar, potion_of_deadly_grace
0:21.218 Waiting 0.400 sec 64.8/110: 59% rage bloodlust, avatar, potion_of_deadly_grace
0:21.618 slam Fluffy_Pillow 90.0/110: 82% rage bloodlust, potion_of_deadly_grace
0:22.693 Waiting 1.500 sec 74.0/110: 67% rage bloodlust, potion_of_deadly_grace
0:24.193 mortal_strike Fluffy_Pillow 99.2/110: 90% rage bloodlust
0:25.499 slam Fluffy_Pillow 83.2/110: 76% rage bloodlust
0:26.575 Waiting 0.200 sec 67.2/110: 61% rage bloodlust
0:26.775 slam Fluffy_Pillow 92.4/110: 84% rage bloodlust
0:27.850 Waiting 0.700 sec 76.4/110: 69% rage bloodlust
0:28.550 mortal_strike Fluffy_Pillow 76.4/110: 69% rage bloodlust
0:29.779 slam Fluffy_Pillow 85.6/110: 78% rage bloodlust
0:30.857 Waiting 1.000 sec 69.6/110: 63% rage bloodlust
0:31.857 slam Fluffy_Pillow 94.8/110: 86% rage bloodlust
0:32.931 mortal_strike Fluffy_Pillow 78.8/110: 72% rage bloodlust
0:34.060 Waiting 0.400 sec 62.8/110: 57% rage bloodlust
0:34.460 slam Fluffy_Pillow 88.0/110: 80% rage bloodlust
0:35.534 Waiting 1.500 sec 72.0/110: 65% rage bloodlust
0:37.034 mortal_strike Fluffy_Pillow 109.5/110: 100% rage bloodlust
0:38.340 slam Fluffy_Pillow 93.5/110: 85% rage bloodlust
0:39.415 Waiting 0.200 sec 77.5/110: 70% rage bloodlust
0:39.615 slam Fluffy_Pillow 102.7/110: 93% rage bloodlust
0:40.689 colossus_smash Fluffy_Pillow 86.7/110: 79% rage bloodlust
0:41.763 mortal_strike Fluffy_Pillow 86.7/110: 79% rage precise_strikes, shattered_defenses
0:43.160 slam Fluffy_Pillow 103.1/110: 94% rage
0:44.557 slam Fluffy_Pillow 87.1/110: 79% rage
0:45.952 slam Fluffy_Pillow 96.3/110: 88% rage
0:47.348 heroic_leap Fluffy_Pillow 80.3/110: 73% rage
0:47.348 mortal_strike Fluffy_Pillow 80.3/110: 73% rage
0:48.743 Waiting 0.400 sec 64.3/110: 58% rage
0:49.143 slam Fluffy_Pillow 89.5/110: 81% rage
0:50.539 Waiting 1.900 sec 73.5/110: 67% rage
0:52.439 slam Fluffy_Pillow 98.7/110: 90% rage
0:53.835 mortal_strike Fluffy_Pillow 82.7/110: 75% rage
0:55.231 Waiting 0.600 sec 66.7/110: 61% rage
0:55.831 slam Fluffy_Pillow 91.9/110: 84% rage
0:57.228 Waiting 1.000 sec 75.9/110: 69% rage
0:58.228 mortal_strike Fluffy_Pillow 75.9/110: 69% rage
0:59.802 colossus_smash Fluffy_Pillow 85.1/110: 77% rage
1:01.198 battle_cry Fluffy_Pillow 85.1/110: 77% rage precise_strikes, shattered_defenses
1:01.397 mortal_strike Fluffy_Pillow 85.1/110: 77% rage corrupted_blood_of_zakajz, precise_strikes, battle_cry, shattered_defenses
1:02.793 warbreaker Fluffy_Pillow 110.0/110: 100% rage corrupted_blood_of_zakajz, battle_cry
1:04.187 mortal_strike Fluffy_Pillow 110.0/110: 100% rage corrupted_blood_of_zakajz, precise_strikes, battle_cry, shattered_defenses
1:05.581 colossus_smash Fluffy_Pillow 101.2/110: 92% rage corrupted_blood_of_zakajz, battle_cry
1:06.978 mortal_strike Fluffy_Pillow 110.0/110: 100% rage precise_strikes, shattered_defenses
1:08.374 colossus_smash Fluffy_Pillow 101.2/110: 92% rage
1:09.769 mortal_strike Fluffy_Pillow 110.0/110: 100% rage precise_strikes, shattered_defenses
1:11.165 mortal_strike Fluffy_Pillow 101.2/110: 92% rage
1:12.561 colossus_smash Fluffy_Pillow 110.0/110: 100% rage
1:13.956 mortal_strike Fluffy_Pillow 110.0/110: 100% rage precise_strikes, shattered_defenses
1:15.351 mortal_strike Fluffy_Pillow 101.2/110: 92% rage
1:16.748 slam Fluffy_Pillow 110.0/110: 100% rage
1:18.143 slam Fluffy_Pillow 94.0/110: 85% rage
1:19.536 slam Fluffy_Pillow 103.2/110: 94% rage
1:20.931 mortal_strike Fluffy_Pillow 87.2/110: 79% rage
1:22.326 colossus_smash Fluffy_Pillow 71.2/110: 65% rage
1:23.721 mortal_strike Fluffy_Pillow 96.4/110: 88% rage precise_strikes, shattered_defenses
1:25.115 slam Fluffy_Pillow 87.6/110: 80% rage
1:26.511 mortal_strike Fluffy_Pillow 96.8/110: 88% rage
1:27.906 slam Fluffy_Pillow 80.8/110: 73% rage
1:29.301 slam Fluffy_Pillow 90.0/110: 82% rage
1:30.696 Waiting 0.500 sec 74.0/110: 67% rage
1:31.196 avatar Fluffy_Pillow 74.0/110: 67% rage
1:31.397 Waiting 0.400 sec 74.0/110: 67% rage avatar
1:31.797 mortal_strike Fluffy_Pillow 74.0/110: 67% rage avatar
1:33.427 slam Fluffy_Pillow 83.2/110: 76% rage avatar
1:34.821 Waiting 1.100 sec 67.2/110: 61% rage avatar
1:35.921 slam Fluffy_Pillow 92.4/110: 84% rage avatar
1:37.317 Waiting 0.100 sec 76.4/110: 69% rage avatar
1:37.417 mortal_strike Fluffy_Pillow 76.4/110: 69% rage avatar
1:38.991 bladestorm Fluffy_Pillow 60.4/110: 55% rage avatar
1:41.143 slam Fluffy_Pillow 85.6/110: 78% rage avatar
1:42.536 slam Fluffy_Pillow 94.8/110: 86% rage avatar
1:43.932 mortal_strike Fluffy_Pillow 78.8/110: 72% rage avatar
1:45.328 Waiting 0.600 sec 62.8/110: 57% rage avatar
1:45.928 slam Fluffy_Pillow 88.0/110: 80% rage avatar
1:47.324 Waiting 1.200 sec 72.0/110: 65% rage avatar
1:48.524 mortal_strike Fluffy_Pillow 72.0/110: 65% rage avatar
1:50.120 slam Fluffy_Pillow 92.7/110: 84% rage avatar
1:51.517 Waiting 0.600 sec 76.7/110: 70% rage
1:52.117 colossus_smash Fluffy_Pillow 76.7/110: 70% rage
1:53.721 heroic_leap Fluffy_Pillow 101.9/110: 93% rage precise_strikes, shattered_defenses
1:53.721 slam Fluffy_Pillow 101.9/110: 93% rage precise_strikes, shattered_defenses
1:55.117 mortal_strike Fluffy_Pillow 85.9/110: 78% rage precise_strikes, shattered_defenses
1:56.514 slam Fluffy_Pillow 102.3/110: 93% rage
1:57.909 colossus_smash Fluffy_Pillow 86.3/110: 78% rage
1:59.306 mortal_strike Fluffy_Pillow 110.0/110: 100% rage precise_strikes, shattered_defenses
2:00.702 mortal_strike Fluffy_Pillow 101.2/110: 92% rage
2:02.099 battle_cry Fluffy_Pillow 85.2/110: 77% rage
2:02.099 slam Fluffy_Pillow 85.2/110: 77% rage corrupted_blood_of_zakajz, battle_cry
2:03.496 slam Fluffy_Pillow 106.3/110: 97% rage corrupted_blood_of_zakajz, battle_cry
2:04.891 colossus_smash Fluffy_Pillow 90.3/110: 82% rage corrupted_blood_of_zakajz, battle_cry
2:06.285 mortal_strike Fluffy_Pillow 110.0/110: 100% rage corrupted_blood_of_zakajz, precise_strikes, battle_cry, shattered_defenses
2:07.680 warbreaker Fluffy_Pillow 101.2/110: 92% rage
2:09.074 mortal_strike Fluffy_Pillow 101.2/110: 92% rage precise_strikes, shattered_defenses
2:10.467 slam Fluffy_Pillow 110.0/110: 100% rage
2:11.861 colossus_smash Fluffy_Pillow 94.0/110: 85% rage
2:13.256 mortal_strike Fluffy_Pillow 110.0/110: 100% rage precise_strikes, shattered_defenses
2:14.650 mortal_strike Fluffy_Pillow 101.2/110: 92% rage
2:16.045 slam Fluffy_Pillow 110.0/110: 100% rage
2:17.440 slam Fluffy_Pillow 94.0/110: 85% rage
2:18.834 colossus_smash Fluffy_Pillow 78.0/110: 71% rage
2:20.230 mortal_strike Fluffy_Pillow 103.2/110: 94% rage precise_strikes, shattered_defenses
2:21.624 mortal_strike Fluffy_Pillow 94.4/110: 86% rage
2:23.018 colossus_smash Fluffy_Pillow 103.6/110: 94% rage
2:24.413 mortal_strike Fluffy_Pillow 103.6/110: 94% rage precise_strikes, shattered_defenses
2:25.811 colossus_smash Fluffy_Pillow 94.8/110: 86% rage
2:27.205 mortal_strike Fluffy_Pillow 110.0/110: 100% rage precise_strikes, shattered_defenses
2:28.602 mortal_strike Fluffy_Pillow 101.2/110: 92% rage
2:29.997 colossus_smash Fluffy_Pillow 110.0/110: 100% rage
2:31.394 mortal_strike Fluffy_Pillow 110.0/110: 100% rage precise_strikes, shattered_defenses
2:32.790 mortal_strike Fluffy_Pillow 110.0/110: 100% rage
2:34.186 slam Fluffy_Pillow 94.0/110: 85% rage
2:35.582 Waiting 0.400 sec 78.0/110: 71% rage
2:35.982 slam Fluffy_Pillow 103.2/110: 94% rage
2:37.376 slam Fluffy_Pillow 87.2/110: 79% rage
2:38.774 mortal_strike Fluffy_Pillow 71.2/110: 65% rage
2:40.171 slam Fluffy_Pillow 92.1/110: 84% rage
2:41.567 Waiting 1.100 sec 76.1/110: 69% rage
2:42.667 slam Fluffy_Pillow 101.3/110: 92% rage
2:44.063 colossus_smash Fluffy_Pillow 85.3/110: 78% rage
2:45.458 heroic_leap Fluffy_Pillow 85.3/110: 78% rage precise_strikes, shattered_defenses
2:45.458 mortal_strike Fluffy_Pillow 85.3/110: 78% rage precise_strikes, shattered_defenses
2:46.854 mortal_strike Fluffy_Pillow 110.0/110: 100% rage
2:48.250 slam Fluffy_Pillow 94.0/110: 85% rage
2:49.645 slam Fluffy_Pillow 103.2/110: 94% rage
2:51.040 mortal_strike Fluffy_Pillow 87.2/110: 79% rage
2:52.435 Waiting 0.200 sec 71.2/110: 65% rage
2:52.635 slam Fluffy_Pillow 107.5/110: 98% rage
2:54.031 slam Fluffy_Pillow 91.5/110: 83% rage
2:55.427 Waiting 0.600 sec 75.5/110: 69% rage
2:56.027 slam Fluffy_Pillow 100.7/110: 92% rage
2:57.423 mortal_strike Fluffy_Pillow 84.7/110: 77% rage
2:58.820 Waiting 0.500 sec 68.7/110: 62% rage
2:59.320 slam Fluffy_Pillow 93.9/110: 85% rage
3:00.715 Waiting 0.500 sec 77.9/110: 71% rage
3:01.215 avatar Fluffy_Pillow 77.9/110: 71% rage
3:01.397 Waiting 0.500 sec 77.9/110: 71% rage avatar
3:01.897 battle_cry Fluffy_Pillow 77.9/110: 71% rage avatar
3:02.099 mortal_strike Fluffy_Pillow 77.9/110: 71% rage avatar, corrupted_blood_of_zakajz, battle_cry
3:03.549 slam Fluffy_Pillow 98.0/110: 89% rage avatar, corrupted_blood_of_zakajz, battle_cry
3:04.943 slam Fluffy_Pillow 82.0/110: 75% rage avatar, corrupted_blood_of_zakajz, battle_cry
3:06.338 slam Fluffy_Pillow 103.1/110: 94% rage avatar, corrupted_blood_of_zakajz, battle_cry
3:07.734 warbreaker Fluffy_Pillow 87.1/110: 79% rage avatar
3:09.129 mortal_strike Fluffy_Pillow 87.1/110: 79% rage avatar, precise_strikes, shattered_defenses
3:10.524 slam Fluffy_Pillow 103.5/110: 94% rage avatar
3:11.921 slam Fluffy_Pillow 87.5/110: 80% rage avatar
3:13.318 colossus_smash Fluffy_Pillow 96.7/110: 88% rage avatar
3:14.714 mortal_strike Fluffy_Pillow 96.7/110: 88% rage avatar, precise_strikes, shattered_defenses
3:16.109 mortal_strike Fluffy_Pillow 110.0/110: 100% rage avatar
3:17.505 slam Fluffy_Pillow 94.0/110: 85% rage avatar
3:18.901 bladestorm Fluffy_Pillow 78.0/110: 71% rage avatar
3:20.959 mortal_strike Fluffy_Pillow 103.2/110: 94% rage avatar
3:22.356 slam Fluffy_Pillow 87.2/110: 79% rage
3:23.751 slam Fluffy_Pillow 108.6/110: 99% rage
3:25.146 slam Fluffy_Pillow 92.6/110: 84% rage
3:26.544 colossus_smash Fluffy_Pillow 101.8/110: 93% rage
3:27.941 mortal_strike Fluffy_Pillow 101.8/110: 93% rage precise_strikes, shattered_defenses
3:29.336 mortal_strike Fluffy_Pillow 93.0/110: 85% rage
3:30.732 heroic_leap Fluffy_Pillow 102.2/110: 93% rage
3:30.732 slam Fluffy_Pillow 102.2/110: 93% rage
3:32.128 slam Fluffy_Pillow 86.2/110: 78% rage
3:33.523 mortal_strike Fluffy_Pillow 95.4/110: 87% rage
3:34.919 Waiting 1.200 sec 79.4/110: 72% rage
3:36.119 slam Fluffy_Pillow 104.6/110: 95% rage
3:37.516 slam Fluffy_Pillow 88.6/110: 81% rage
3:38.912 mortal_strike Fluffy_Pillow 72.6/110: 66% rage
3:40.467 slam Fluffy_Pillow 81.8/110: 74% rage
3:41.861 Waiting 0.900 sec 65.8/110: 60% rage
3:42.761 slam Fluffy_Pillow 91.0/110: 83% rage
3:44.158 Waiting 0.300 sec 75.0/110: 68% rage
3:44.458 mortal_strike Fluffy_Pillow 75.0/110: 68% rage
3:46.032 Waiting 0.100 sec 59.0/110: 54% rage
3:46.132 slam Fluffy_Pillow 84.2/110: 77% rage
3:47.527 Waiting 1.900 sec 68.2/110: 62% rage
3:49.427 slam Fluffy_Pillow 93.4/110: 85% rage
3:50.823 mortal_strike Fluffy_Pillow 77.4/110: 70% rage
3:52.216 Waiting 0.600 sec 61.4/110: 56% rage
3:52.816 slam Fluffy_Pillow 86.6/110: 79% rage
3:54.211 Waiting 1.400 sec 70.6/110: 64% rage
3:55.611 mortal_strike Fluffy_Pillow 70.6/110: 64% rage
3:57.159 colossus_smash Fluffy_Pillow 79.8/110: 73% rage
3:58.553 Waiting 0.900 sec 79.8/110: 73% rage precise_strikes, shattered_defenses
3:59.453 slam Fluffy_Pillow 105.0/110: 95% rage precise_strikes, shattered_defenses
4:00.848 slam Fluffy_Pillow 89.0/110: 81% rage precise_strikes, shattered_defenses
4:02.243 battle_cry Fluffy_Pillow 73.0/110: 66% rage precise_strikes, shattered_defenses
4:02.243 mortal_strike Fluffy_Pillow 73.0/110: 66% rage corrupted_blood_of_zakajz, precise_strikes, battle_cry, shattered_defenses
4:03.637 colossus_smash Fluffy_Pillow 101.8/110: 93% rage corrupted_blood_of_zakajz, battle_cry
4:05.034 mortal_strike Fluffy_Pillow 101.8/110: 93% rage corrupted_blood_of_zakajz, precise_strikes, battle_cry, shattered_defenses
4:06.431 slam Fluffy_Pillow 110.0/110: 100% rage corrupted_blood_of_zakajz, battle_cry
4:07.826 warbreaker Fluffy_Pillow 94.0/110: 85% rage
4:09.221 mortal_strike Fluffy_Pillow 94.0/110: 85% rage precise_strikes, shattered_defenses
4:10.617 colossus_smash Fluffy_Pillow 110.0/110: 100% rage
4:12.014 mortal_strike Fluffy_Pillow 110.0/110: 100% rage precise_strikes, shattered_defenses
4:13.411 mortal_strike Fluffy_Pillow 110.0/110: 100% rage
4:14.806 slam Fluffy_Pillow 94.0/110: 85% rage
4:16.203 heroic_leap Fluffy_Pillow 110.0/110: 100% rage
4:16.203 slam Fluffy_Pillow 110.0/110: 100% rage
4:17.597 slam Fluffy_Pillow 94.0/110: 85% rage
4:18.991 colossus_smash Fluffy_Pillow 78.0/110: 71% rage
4:20.386 mortal_strike Fluffy_Pillow 103.2/110: 94% rage precise_strikes, shattered_defenses
4:21.781 mortal_strike Fluffy_Pillow 94.4/110: 86% rage
4:23.175 colossus_smash Fluffy_Pillow 103.6/110: 94% rage
4:24.570 mortal_strike Fluffy_Pillow 103.6/110: 94% rage precise_strikes, shattered_defenses
4:25.967 mortal_strike Fluffy_Pillow 94.8/110: 86% rage
4:27.364 slam Fluffy_Pillow 104.0/110: 95% rage
4:28.761 slam Fluffy_Pillow 88.0/110: 80% rage
4:30.155 slam Fluffy_Pillow 97.2/110: 88% rage
4:31.550 avatar Fluffy_Pillow 81.2/110: 74% rage
4:31.550 colossus_smash Fluffy_Pillow 81.2/110: 74% rage avatar
4:32.944 mortal_strike Fluffy_Pillow 106.4/110: 97% rage avatar, precise_strikes, shattered_defenses
4:34.341 mortal_strike Fluffy_Pillow 97.6/110: 89% rage avatar
4:35.737 slam Fluffy_Pillow 81.6/110: 74% rage avatar
4:37.132 slam Fluffy_Pillow 90.8/110: 83% rage avatar
4:38.529 mortal_strike Fluffy_Pillow 74.8/110: 68% rage avatar
4:39.924 slam Fluffy_Pillow 84.0/110: 76% rage avatar
4:41.319 Waiting 1.600 sec 68.0/110: 62% rage avatar
4:42.919 slam Fluffy_Pillow 93.2/110: 85% rage avatar
4:44.314 colossus_smash Fluffy_Pillow 77.2/110: 70% rage avatar
4:45.708 mortal_strike Fluffy_Pillow 77.2/110: 70% rage avatar, precise_strikes, shattered_defenses
4:47.105 mortal_strike Fluffy_Pillow 93.6/110: 85% rage avatar
4:48.500 Waiting 0.200 sec 77.6/110: 71% rage avatar
4:48.700 bladestorm Fluffy_Pillow 77.6/110: 71% rage avatar
4:50.968 slam Fluffy_Pillow 102.8/110: 93% rage avatar
4:52.364 mortal_strike Fluffy_Pillow 86.8/110: 79% rage
4:53.761 slam Fluffy_Pillow 96.0/110: 87% rage
4:55.157 slam Fluffy_Pillow 80.0/110: 73% rage
4:56.553 slam Fluffy_Pillow 101.4/110: 92% rage
4:57.949 mortal_strike Fluffy_Pillow 85.4/110: 78% rage
4:59.344 colossus_smash Fluffy_Pillow 69.4/110: 63% rage
5:00.739 mortal_strike Fluffy_Pillow 94.6/110: 86% rage precise_strikes, shattered_defenses
5:02.135 battle_cry Fluffy_Pillow 85.8/110: 78% rage
5:02.243 heroic_leap Fluffy_Pillow 85.8/110: 78% rage corrupted_blood_of_zakajz, battle_cry
5:02.243 mortal_strike Fluffy_Pillow 85.8/110: 78% rage corrupted_blood_of_zakajz, battle_cry
5:03.802 colossus_smash Fluffy_Pillow 107.4/110: 98% rage corrupted_blood_of_zakajz, battle_cry
5:05.198 mortal_strike Fluffy_Pillow 107.4/110: 98% rage corrupted_blood_of_zakajz, precise_strikes, battle_cry, shattered_defenses
5:06.593 slam Fluffy_Pillow 110.0/110: 100% rage corrupted_blood_of_zakajz, battle_cry
5:07.988 colossus_smash Fluffy_Pillow 94.0/110: 85% rage
5:09.384 mortal_strike Fluffy_Pillow 94.0/110: 85% rage precise_strikes, shattered_defenses
5:10.778 warbreaker Fluffy_Pillow 110.0/110: 100% rage
5:12.173 mortal_strike Fluffy_Pillow 110.0/110: 100% rage precise_strikes, shattered_defenses
5:13.570 slam Fluffy_Pillow 110.0/110: 100% rage
5:14.965 mortal_strike Fluffy_Pillow 94.0/110: 85% rage
5:16.361 slam Fluffy_Pillow 103.2/110: 94% rage
5:17.756 slam Fluffy_Pillow 87.2/110: 79% rage
5:19.152 Waiting 0.400 sec 71.2/110: 65% rage
5:19.552 slam Fluffy_Pillow 96.4/110: 88% rage
5:20.948 colossus_smash Fluffy_Pillow 80.4/110: 73% rage
5:22.345 mortal_strike Fluffy_Pillow 80.4/110: 73% rage precise_strikes, shattered_defenses
5:23.739 colossus_smash Fluffy_Pillow 96.8/110: 88% rage
5:25.136 mortal_strike Fluffy_Pillow 96.8/110: 88% rage precise_strikes, shattered_defenses
5:26.533 mortal_strike Fluffy_Pillow 110.0/110: 100% rage
5:27.927 slam Fluffy_Pillow 94.0/110: 85% rage
5:29.322 Waiting 0.300 sec 78.0/110: 71% rage
5:29.622 slam Fluffy_Pillow 103.2/110: 94% rage
5:31.019 mortal_strike Fluffy_Pillow 87.2/110: 79% rage
5:32.415 Waiting 0.500 sec 71.2/110: 65% rage
5:32.915 slam Fluffy_Pillow 107.4/110: 98% rage
5:34.310 slam Fluffy_Pillow 91.4/110: 83% rage
5:35.706 Waiting 0.400 sec 75.4/110: 69% rage
5:36.106 mortal_strike Fluffy_Pillow 75.4/110: 69% rage
5:37.662 slam Fluffy_Pillow 84.6/110: 77% rage
5:39.057 colossus_smash Fluffy_Pillow 68.6/110: 62% rage
5:40.453 mortal_strike Fluffy_Pillow 93.8/110: 85% rage precise_strikes, shattered_defenses
5:41.850 mortal_strike Fluffy_Pillow 85.0/110: 77% rage
5:43.244 slam Fluffy_Pillow 94.2/110: 86% rage
5:44.638 Waiting 1.700 sec 78.2/110: 71% rage
5:46.338 slam Fluffy_Pillow 110.0/110: 100% rage
5:47.735 mortal_strike Fluffy_Pillow 94.0/110: 85% rage
5:49.130 Waiting 0.500 sec 78.0/110: 71% rage
5:49.630 slam Fluffy_Pillow 103.2/110: 94% rage
5:51.024 slam Fluffy_Pillow 87.2/110: 79% rage
5:52.419 Waiting 0.300 sec 71.2/110: 65% rage
5:52.719 mortal_strike Fluffy_Pillow 71.2/110: 65% rage
5:54.355 slam Fluffy_Pillow 80.4/110: 73% rage
5:55.750 Waiting 0.600 sec 64.4/110: 59% rage
5:56.350 slam Fluffy_Pillow 89.6/110: 81% rage
5:57.746 Waiting 0.600 sec 73.6/110: 67% rage
5:58.346 mortal_strike Fluffy_Pillow 73.6/110: 67% rage
5:59.921 slam Fluffy_Pillow 82.8/110: 75% rage
6:01.317 avatar Fluffy_Pillow 66.8/110: 61% rage
6:01.550 colossus_smash Fluffy_Pillow 66.8/110: 61% rage avatar
6:02.946 battle_cry Fluffy_Pillow 66.8/110: 61% rage avatar, precise_strikes, shattered_defenses
6:02.946 potion Fluffy_Pillow 66.8/110: 61% rage avatar, corrupted_blood_of_zakajz, precise_strikes, battle_cry, shattered_defenses
6:02.946 heroic_leap Fluffy_Pillow 66.8/110: 61% rage avatar, corrupted_blood_of_zakajz, precise_strikes, battle_cry, shattered_defenses, potion_of_deadly_grace
6:02.946 execute Fluffy_Pillow 66.8/110: 61% rage avatar, corrupted_blood_of_zakajz, precise_strikes, battle_cry, shattered_defenses, potion_of_deadly_grace
6:04.341 execute Fluffy_Pillow 86.4/110: 79% rage avatar, corrupted_blood_of_zakajz, battle_cry, potion_of_deadly_grace
6:05.738 colossus_smash Fluffy_Pillow 54.4/110: 49% rage avatar, corrupted_blood_of_zakajz, battle_cry, potion_of_deadly_grace
6:07.135 execute Fluffy_Pillow 90.9/110: 83% rage avatar, corrupted_blood_of_zakajz, precise_strikes, battle_cry, shattered_defenses, potion_of_deadly_grace
6:08.531 colossus_smash Fluffy_Pillow 73.3/110: 67% rage avatar, potion_of_deadly_grace
6:09.928 execute Fluffy_Pillow 98.5/110: 90% rage avatar, precise_strikes, shattered_defenses, potion_of_deadly_grace
6:11.325 execute Fluffy_Pillow 80.9/110: 74% rage avatar, potion_of_deadly_grace
6:12.719 execute Fluffy_Pillow 48.9/110: 44% rage avatar, potion_of_deadly_grace
6:14.114 colossus_smash Fluffy_Pillow 42.1/110: 38% rage avatar, potion_of_deadly_grace
6:15.509 execute Fluffy_Pillow 42.1/110: 38% rage avatar, precise_strikes, shattered_defenses, potion_of_deadly_grace
6:16.903 execute Fluffy_Pillow 49.7/110: 45% rage avatar, potion_of_deadly_grace
6:18.298 warbreaker Fluffy_Pillow 17.7/110: 16% rage avatar, potion_of_deadly_grace
6:19.693 execute Fluffy_Pillow 42.9/110: 39% rage avatar, precise_strikes, shattered_defenses, potion_of_deadly_grace
6:21.089 execute Fluffy_Pillow 25.3/110: 23% rage avatar, potion_of_deadly_grace
6:22.485 bladestorm Fluffy_Pillow 0.0/110: 0% rage potion_of_deadly_grace
6:24.646 execute Fluffy_Pillow 25.2/110: 23% rage potion_of_deadly_grace
6:26.040 Waiting 17.900 sec 0.0/110: 0% rage potion_of_deadly_grace
6:43.940 colossus_smash Fluffy_Pillow 110.0/110: 100% rage
6:45.509 execute Fluffy_Pillow 110.0/110: 100% rage precise_strikes, shattered_defenses
6:46.904 execute Fluffy_Pillow 110.0/110: 100% rage
6:48.300 heroic_leap Fluffy_Pillow 78.0/110: 71% rage
6:48.300 colossus_smash Fluffy_Pillow 78.0/110: 71% rage
6:49.694 execute Fluffy_Pillow 78.0/110: 71% rage precise_strikes, shattered_defenses
6:51.088 execute Fluffy_Pillow 85.6/110: 78% rage
6:52.484 execute Fluffy_Pillow 53.6/110: 49% rage
6:53.880 execute Fluffy_Pillow 46.8/110: 43% rage
6:55.277 colossus_smash Fluffy_Pillow 14.8/110: 13% rage
6:56.674 execute Fluffy_Pillow 40.0/110: 36% rage precise_strikes, shattered_defenses
6:58.069 execute Fluffy_Pillow 22.4/110: 20% rage
6:59.465 Waiting 0.300 sec 0.0/110: 0% rage
6:59.765 execute Fluffy_Pillow 25.2/110: 23% rage
7:01.160 Waiting 1.600 sec 0.0/110: 0% rage
7:02.760 battle_cry Fluffy_Pillow 0.0/110: 0% rage
7:02.946 Waiting 0.200 sec 0.0/110: 0% rage corrupted_blood_of_zakajz, battle_cry
7:03.146 execute Fluffy_Pillow 37.6/110: 34% rage corrupted_blood_of_zakajz, battle_cry
7:04.542 Waiting 13.600 sec 5.6/110: 5% rage corrupted_blood_of_zakajz, battle_cry
7:18.142 warbreaker Fluffy_Pillow 110.0/110: 100% rage
7:19.694 execute Fluffy_Pillow 110.0/110: 100% rage precise_strikes, shattered_defenses
7:21.089 colossus_smash Fluffy_Pillow 110.0/110: 100% rage
7:22.485 execute Fluffy_Pillow 110.0/110: 100% rage precise_strikes, shattered_defenses
7:23.880 execute Fluffy_Pillow 110.0/110: 100% rage
7:25.277 execute Fluffy_Pillow 78.0/110: 71% rage
7:26.673 colossus_smash Fluffy_Pillow 71.2/110: 65% rage

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 24919 23212 11876 (6131)
Agility 6577 6252 0
Stamina 28080 28080 17538
Intellect 5325 5000 0
Spirit 0 0 0
Health 1684800 1684800 0
Rage 110 110 0
Crit 11.58% 11.58% 2304
Haste 7.81% 7.81% 2538
Damage / Heal Versatility 8.57% 8.57% 3428
Attack Power 24919 23212 0
Mastery 73.46% 71.28% 9673
Armor 3945 3945 3945
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 840.00
Local Head Battlelord's Greathelm
ilevel: 830, stats: { 531 Armor, +1614 Sta, +1077 Str, +735 Mastery, +476 Vers }
Local Neck Brysngamen, Torc of Helheim
ilevel: 825, stats: { +867 Sta, +1195 Mastery, +478 Vers }, gems: { +150 Mastery }
Local Shoulders Wardbreaker Pauldrons
ilevel: 850, stats: { 512 Armor, +973 StrInt, +1459 Sta, +637 Vers, +342 Mastery }
Local Chest Ley-Scarred Chestplate
ilevel: 835, stats: { 660 Armor, +1128 StrInt, +1692 Sta, +776 Mastery, +459 Crit }
Local Waist Slack Tide Girdle
ilevel: 840, stats: { 376 Armor, +1329 Sta, +886 StrInt, +653 Haste, +289 Crit, +404 Avoidance }
Local Legs Battlelord's Legplates
ilevel: 830, stats: { 571 Armor, +1614 Sta, +1077 Str, +813 Mastery, +398 Crit }
Local Feet Coralplate Sandstompers
ilevel: 830, stats: { 449 Armor, +807 StrInt, +1211 Sta, +532 Mastery, +376 Vers }
Local Wrists Skoldiir Bracers
ilevel: 835, stats: { 289 Armor, +635 StrInt, +952 Sta, +421 Crit, +273 Mastery }
Local Hands Fists of Thane Kray-Tan
ilevel: 850, stats: { 427 Armor, +973 StrInt, +1459 Sta, +658 Haste, +322 Mastery }
Local Finger1 Braided Silver Ring
ilevel: 850, stats: { +1094 Sta, +997 Mastery, +839 Vers }, enchant: { +150 Mastery }
Local Finger2 Loop of Eightfold Eyes
ilevel: 840, stats: { +997 Sta, +1213 Mastery, +555 Vers }
Local Trinket1 An'she's Invigoring Charm
ilevel: 825, stats: { +977 Str, +849 Mastery }
Local Trinket2 Ironrune Charm
ilevel: 845, stats: { +1177 Str, +915 Haste }
Local Back Drape of the Raven Lord
ilevel: 850, stats: { 130 Armor, +729 StrAgiInt, +1094 Sta, +472 Mastery, +262 Haste }
Local Main Hand Strom'kar, the Warbreaker
ilevel: 861, weapon: { 7436 - 11156, 3.6 }, stats: { +1437 Str, +2156 Sta, +692 Crit, +664 Mastery }, relics: { +43 ilevels, +31 ilevels, +37 ilevels }
Local Tabard Renowned Guild Tabard
ilevel: 1

Talents

Level
15 Dauntless (Arms Warrior) Overpower (Arms Warrior) Sweeping Strikes (Arms Warrior)
30 Shockwave (Arms Warrior) Storm Bolt (Arms Warrior) Double Time
45 Fervor of Battle (Arms Warrior) Rend (Arms Warrior) Avatar
60 Second Wind Bounding Stride Defensive Stance (Arms Warrior)
75 In For The Kill (Arms Warrior) Mortal Combo (Arms Warrior) Focused Rage (Arms Warrior)
90 Deadly Calm (Arms Warrior) Trauma (Arms Warrior) Titanic Might (Arms Warrior)
100 Anger Management Opportunity Strikes (Arms Warrior) Ravager (Arms Warrior)

Profile

warrior="Zuan"
origin="https://eu.api.battle.net/wow/character/hyjal/Zuan/advanced"
thumbnail="http://eu.battle.net/static-render/eu/hyjal/240/115091952-avatar.jpg"
level=110
race=human
role=attack
position=back
professions=blacksmithing=758/mining=774
talents=http://eu.battle.net/wow/en/tool/talent-calculator#Za!0222111
artifact=36:0:0:0:0:1136:1:1137:1:1139:1:1142:1:1145:3:1146:2:1148:3:1149:3:1150:3:1356:1
spec=arms

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=countless_armies
actions.precombat+=/food,type=nightborne_delicacy_platter
actions.precombat+=/augmentation,type=defiled
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=deadly_grace

# Executed every time the actor is available.
actions=charge
actions+=/auto_attack
actions+=/potion,name=deadly_grace,if=(target.health.pct<20&buff.battle_cry.up)|target.time_to_die<=26
actions+=/battle_cry,if=(buff.bloodlust.up|time>=1)&!gcd.remains
actions+=/avatar,if=(buff.bloodlust.up|time>=1)&!gcd.remains
actions+=/blood_fury,if=buff.battle_cry.up|target.time_to_die<=16
actions+=/berserking,if=buff.battle_cry.up|target.time_to_die<=11
actions+=/arcane_torrent,if=buff.battle_cry_deadly_calm.down&rage.deficit>40
actions+=/hamstring,if=buff.battle_cry_deadly_calm.remains>cooldown.hamstring.remains
actions+=/heroic_leap,if=debuff.colossus_smash.up
actions+=/rend,if=remains<gcd
actions+=/focused_rage,if=buff.battle_cry_deadly_calm.remains>cooldown.focused_rage.remains&(buff.focused_rage.stack<3|cooldown.mortal_strike.remains)
actions+=/colossus_smash,if=debuff.colossus_smash.down
actions+=/warbreaker,if=debuff.colossus_smash.down
actions+=/ravager
actions+=/overpower
actions+=/run_action_list,name=cleave,if=spell_targets.whirlwind>=2&talent.sweeping_strikes.enabled
actions+=/run_action_list,name=aoe,if=spell_targets.whirlwind>=2&!talent.sweeping_strikes.enabled
actions+=/run_action_list,name=execute,if=target.health.pct<=20
actions+=/run_action_list,name=single

actions.single=mortal_strike,if=buff.battle_cry.up&buff.focused_rage.stack>=1&buff.battle_cry.remains<gcd
actions.single+=/colossus_smash,if=buff.shattered_defenses.down
actions.single+=/warbreaker,if=buff.shattered_defenses.down&cooldown.mortal_strike.remains<gcd
actions.single+=/focused_rage,if=buff.focused_rage.stack<3&(buff.shattered_defenses.up|cooldown.colossus_smash.remains)
actions.single+=/mortal_strike
actions.single+=/slam,if=buff.battle_cry_deadly_calm.up|buff.focused_rage.stack=3|rage.deficit<=30
actions.single+=/execute,if=equipped.137060
actions.single+=/slam,if=equipped.137060
actions.single+=/focused_rage,if=equipped.137060
# actions.single+=/heroic_charge,if=rage.deficit>=40&(!cooldown.heroic_leap.remains|swing.mh.remains>1.2)
#Remove the # above to run out of melee and charge back in for rage.
actions.single+=/bladestorm,interrupt=1,if=raid_event.adds.in>90|!raid_event.adds.exists|spell_targets.bladestorm_mh>desired_targets

actions.cleave=mortal_strike
actions.cleave+=/execute,if=buff.stone_heart.react
actions.cleave+=/colossus_smash,if=buff.shattered_defenses.down&buff.precise_strikes.down
actions.cleave+=/warbreaker,if=buff.shattered_defenses.down
actions.cleave+=/focused_rage,if=buff.shattered_defenses.down
actions.cleave+=/whirlwind,if=talent.fervor_of_battle.enabled&(debuff.colossus_smash.up|rage.deficit<50)&(!talent.focused_rage.enabled|buff.battle_cry_deadly_calm.up|buff.cleave.up)
actions.cleave+=/rend,if=remains<=duration*0.3
actions.cleave+=/bladestorm
actions.cleave+=/cleave
actions.cleave+=/whirlwind,if=rage>=100|buff.focused_rage.stack=3
actions.cleave+=/shockwave
actions.cleave+=/storm_bolt

actions.aoe=mortal_strike
actions.aoe+=/execute,if=buff.stone_heart.react
actions.aoe+=/colossus_smash,if=buff.shattered_defenses.down&buff.precise_strikes.down
actions.aoe+=/warbreaker,if=buff.shattered_defenses.down
actions.aoe+=/whirlwind,if=talent.fervor_of_battle.enabled&(debuff.colossus_smash.up|rage.deficit<50)&(!talent.focused_rage.enabled|buff.battle_cry_deadly_calm.up|buff.cleave.up)
actions.aoe+=/rend,if=remains<=duration*0.3
actions.aoe+=/bladestorm
actions.aoe+=/cleave
actions.aoe+=/whirlwind,if=rage>=60
actions.aoe+=/shockwave
actions.aoe+=/storm_bolt

actions.execute=focused_rage,if=buff.focused_rage.stack<3&debuff.colossus_smash.down
actions.execute+=/mortal_strike,if=buff.battle_cry.up&(buff.focused_rage.stack=3|buff.focused_rage.stack=2&buff.battle_cry.remains<gcd)
actions.execute+=/execute,if=buff.battle_cry_deadly_calm.up
actions.execute+=/colossus_smash,if=buff.shattered_defenses.down
actions.execute+=/warbreaker,if=buff.shattered_defenses.down&rage<=30
actions.execute+=/execute,if=buff.shattered_defenses.up
actions.execute+=/mortal_strike,if=buff.focused_rage.stack=3
actions.execute+=/execute,if=debuff.colossus_smash.up
# actions.single+=/heroic_charge,if=rage.deficit>=40&(!cooldown.heroic_leap.remains|swing.mh.remains>1.2)
#Remove the # above to run out of melee and charge back in for rage.
actions.execute+=/bladestorm,interrupt=1,if=raid_event.adds.in>90|!raid_event.adds.exists|spell_targets.bladestorm_mh>desired_targets

head=battlelords_greathelm,id=139684,bonus_id=3386/3383
neck=brysngamen_torc_of_helheim,id=133636,bonus_id=1826/1808/1477/3338,gems=150mastery
shoulders=wardbreaker_pauldrons,id=136730,bonus_id=1727/1512/3336
back=drape_of_the_raven_lord,id=136770,bonus_id=1727/1502/3336
chest=leyscarred_chestplate,id=134311,bonus_id=3432/1497/1674
tabard=renowned_guild_tabard,id=69210
wrists=skoldiir_bracers,id=134186,bonus_id=3432/1497/1674
hands=fists_of_thane_kraytan,id=141577,bonus_id=1512/3336
waist=slack_tide_girdle,id=133770,bonus_id=1727/40/1492/1813
legs=battlelords_legplates,id=139685,bonus_id=3386/3383
feet=coralplate_sandstompers,id=134229,bonus_id=3397/1492/1675
finger1=braided_silver_ring,id=134539,bonus_id=1727/1502/3336,enchant=150mastery
finger2=loop_of_eightfold_eyes,id=134527,bonus_id=1726/1492/3337
trinket1=anshes_invigoring_charm,id=139102,bonus_id=3396/605/1487/1675
trinket2=ironrune_charm,id=134190,bonus_id=3397/604/1507/3337
main_hand=stromkar_the_warbreaker,id=128910,bonus_id=750,gem_id=141268/136683/137377/0,relic_id=3397:1512:3337/0/1726:1482:3339/0

# Gear Summary
# gear_ilvl=839.73
# gear_strength=11876
# gear_stamina=17538
# gear_crit_rating=2259
# gear_haste_rating=2488
# gear_mastery_rating=9483
# gear_versatility_rating=3361
# gear_avoidance_rating=404
# gear_armor=3945
# set_bonus=tier19oh_2pc=1

Ulthuan

Ulthuan : 184815 dps

  • Race: Night Elf
  • Class: Warrior
  • Spec: Fury
  • Level: 110
  • Role: Attack
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
184814.9 184814.9 91.2 / 0.049% 18152.8 / 9.8% 25437.7
RPS Out RPS In Primary Resource Waiting APM Active Skill
7.3 7.3 Rage 0.00% 45.3 100.0% 100%
Origin https://eu.api.battle.net/wow/character/hyjal/Ulthuan/advanced
Talents
  • 15: Endless Rage (Fury Warrior)
  • 30: Storm Bolt (Fury Warrior)
  • 45: Avatar
  • 60: Warpaint (Fury Warrior)
  • 75: Carnage (Fury Warrior)
  • 90: Inner Rage (Fury Warrior)
  • 100: Bladestorm (Fury Warrior)
  • Talent Calculator
Artifact
Professions
  • mining: 514
  • blacksmithing: 761

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Ulthuan 184815
auto_attack_mh 21043 11.4% 195.7 2.31sec 48383 20971 Direct 195.7 40044 83924 48383 25.4% 7.0%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 195.66 195.66 0.00 0.00 2.3071 0.0000 9466752.79 13917023.31 31.98 20971.33 20971.33
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 132.38 67.66% 40043.52 27859 52056 40046.36 37590 42296 5301051 7793047 31.98
crit 49.64 25.37% 83924.16 55718 119730 83980.52 75792 93917 4165702 6123976 31.98
miss 13.65 6.97% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 10525 5.7% 195.7 2.31sec 24198 10489 Direct 195.7 20022 41954 24198 25.4% 7.0%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 195.66 195.66 0.00 0.00 2.3071 0.0000 4734751.83 6960533.68 31.98 10488.71 10488.71
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 132.34 67.64% 20022.31 13929 26028 20023.94 18811 21287 2649724 3895346 31.98
crit 49.70 25.40% 41954.03 27859 59865 41981.99 37200 46676 2085028 3065188 31.98
miss 13.63 6.96% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Bloodthirst 25447 13.8% 100.4 4.49sec 114078 80481 Direct 100.4 83419 168565 114079 36.0% 0.0%  

Stats details: bloodthirst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 100.39 100.39 0.00 0.00 1.4175 0.0000 11452056.74 16835608.18 31.98 80481.09 80481.09
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 64.24 63.99% 83419.14 65280 121982 83472.20 78095 90527 5358890 7878075 31.98
crit 36.15 36.01% 168565.12 130561 280558 168657.57 151939 195652 6093167 8957533 31.98
 
 

Action details: bloodthirst

Static Values
  • id:23881
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:23881
  • name:Bloodthirst
  • school:physical
  • tooltip:
  • description:Assault the target in a bloodthirsty craze, dealing $sw2 Physical damage and restoring {$117313s1=4}% of your health. |cFFFFFFFFGenerates ${$m3/10} Rage.|r
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.50
 
Deadly Grace 6843 3.6% 22.2 19.96sec 136810 0 Direct 22.2 95360 208930 136832 36.5% 0.0%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.17 22.16 0.00 0.00 0.0000 0.0000 3032687.95 3032687.95 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.07 63.48% 95359.90 65761 122879 95271.73 72149 121018 1341687 1341687 0.00
crit 8.09 36.52% 208929.99 131522 282623 209550.47 150099 282623 1691001 1691001 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:5.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=47572 to 71358} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:47572.00
  • base_dd_max:71358.00
 
Execute 8733 (13102) 4.7% (7.1%) 20.7 4.47sec 285239 195707 Direct 20.7 140213 286191 190132 34.2% 0.0%  

Stats details: execute

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.66 20.66 0.00 0.00 1.4575 0.0000 3927178.87 5773324.93 31.98 195706.68 195706.68
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.59 65.81% 140212.54 115366 215570 140450.53 115366 179641 1906041 2802061 31.98
crit 7.06 34.19% 286190.64 230731 495810 286991.17 236499 495810 2021138 2971264 31.98
 
 

Action details: execute

Static Values
  • id:5308
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.03
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:artifact.juggernaut.enabled&(!buff.juggernaut.up|buff.juggernaut.remains<2)
Spelldata
  • id:5308
  • name:Execute
  • school:physical
  • tooltip:
  • description:Attempt to finish off a wounded foe, causing ${$sw2+$163558sw2} Physical damage. Only usable on enemies that have less than 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:4.41
 
    Execute Off-Hand 4369 2.4% 0.0 0.00sec 0 0 Direct 20.7 70174 142836 95121 34.3% 0.0%  

Stats details: execute_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 20.66 0.00 0.00 0.0000 0.0000 1964766.54 2888392.92 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.57 65.67% 70174.07 57684 107788 70323.42 57684 90455 951927 1399423 31.98
crit 7.09 34.33% 142836.39 115369 247912 143266.86 118830 247912 1012839 1488970 31.98
 
 

Action details: execute_offhand

Static Values
  • id:163558
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.03
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:163558
  • name:Execute Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc5308=Attempt to finish off a wounded foe, causing ${$sw2+$163558sw2} Physical damage. Only usable on enemies that have less than 20% health.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:4.41
 
Furious Slash 5464 3.0% 44.4 8.99sec 55339 39047 Direct 44.4 43948 95910 55338 21.9% 0.0%  

Stats details: furious_slash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.43 44.43 0.00 0.00 1.4172 0.0000 2458818.53 3614696.14 31.98 39047.46 39047.46
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.69 78.08% 43947.71 35446 66233 43977.19 37816 50978 1524578 2241275 31.98
crit 9.74 21.92% 95909.98 70892 152336 96653.71 78247 152336 934240 1373422 31.98
 
 

Action details: furious_slash

Static Values
  • id:100130
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:100130
  • name:Furious Slash
  • school:physical
  • tooltip:
  • description:Aggressively strike with your off-hand weapon for $sw3 Physical damage. Increases your Bloodthirst critical strike chance by {$206333s1=15}% until it next deals a critical strike, stacking up to {$206333u=6} times.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.71
 
Heroic Leap 428 0.2% 10.4 45.37sec 18483 0 Direct 10.4 15125 30937 18505 21.4% 0.0%  

Stats details: heroic_leap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.43 10.42 0.00 0.00 0.0000 0.0000 192802.60 283438.09 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.19 78.63% 15125.18 12373 23120 15115.38 12373 20230 123903 182149 31.98
crit 2.23 21.37% 30937.11 24746 53176 28221.88 0 53176 68900 101289 29.17
 
 

Action details: heroic_leap

Static Values
  • id:6544
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(raid_event.movement.distance>25&raid_event.movement.in>45)|!raid_event.movement.exists
Spelldata
  • id:6544
  • name:Heroic Leap
  • school:physical
  • tooltip:
  • description:Leap through the air toward a target location, slamming down with destructive force to deal {$52174s1=1} Physical damage to all enemies within $52174a1 yards{$?s23922=false}[, and resetting the remaining cooldown on Taunt][].
 
Odyn's Fury 0 (14196) 0.0% (7.7%) 8.1 60.89sec 790862 542623

Stats details: odyns_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.07 0.00 0.00 0.00 1.4575 0.0000 0.00 0.00 0.00 542622.73 542622.73
 
 

Action details: odyns_fury

Static Values
  • id:205545
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.battle_cry.up|target.time_to_die<cooldown.battle_cry.remains
Spelldata
  • id:205545
  • name:Odyn's Fury
  • school:physical
  • tooltip:
  • description:Unleashes the fiery power Odyn bestowed the |cFFFFCC99Warswords|r, dealing ${$205546sw2+$205547sw2} Fire damage and an additional $205546o3 Fire damage over {$205546d=4 seconds} to all enemies within $205546A2 yards.
 
    Odyn's Fury (_mh) 11788 6.4% 0.0 0.00sec 0 0 Direct 8.1 115777 272684 268313 97.2% 0.0%  
Periodic 31.9 43209 101499 98235 94.4% 0.0% 7.1%

Stats details: odyns_fury_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 8.07 31.92 31.92 0.0000 1.0000 5302407.05 5302407.05 0.00 166105.10 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.23 2.79% 115776.50 96141 179648 26063.90 0 179648 26064 26064 0.00
crit 7.85 97.21% 272684.19 192283 413190 272564.31 235958 344957 2140401 2140401 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.8 5.60% 43209.19 29151 54471 36580.21 0 54471 77272 77272 0.00
crit 30.1 94.40% 101499.24 58302 125283 101531.25 95207 110794 3058670 3058670 0.00
 
 

Action details: odyns_fury_mh

Static Values
  • id:205546
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205546
  • name:Odyn's Fury
  • school:fire
  • tooltip:Suffering $o3 Fire damage over {$d=4 seconds}.
  • description:{$@spelldesc205545=Unleashes the fiery power Odyn bestowed the |cFFFFCC99Warswords|r, dealing ${$205546sw2+$205547sw2} Fire damage and an additional $205546o3 Fire damage over {$205546d=4 seconds} to all enemies within $205546A2 yards.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:1.000000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.50
 
    Odyn's Fury (_oh) 2408 1.3% 0.0 0.00sec 0 0 Direct 8.1 57801 136351 134150 97.2% 0.0%  

Stats details: odyns_fury_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 8.07 0.00 0.00 0.0000 0.0000 1083177.20 1083177.20 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.23 2.80% 57800.82 48071 89824 13087.41 0 89824 13087 13087 0.00
crit 7.85 97.20% 136350.54 96141 206595 136290.48 117979 172478 1070090 1070090 0.00
 
 

Action details: odyns_fury_oh

Static Values
  • id:205547
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205547
  • name:Odyn's Fury
  • school:fire
  • tooltip:
  • description:{$@spelldesc205545=Unleashes the fiery power Odyn bestowed the |cFFFFCC99Warswords|r, dealing ${$205546sw2+$205547sw2} Fire damage and an additional $205546o3 Fire damage over {$205546d=4 seconds} to all enemies within $205546A2 yards.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.50
 
Raging Blow 0 (60843) 0.0% (32.9%) 101.8 4.42sec 268963 189236

Stats details: raging_blow

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 101.82 0.00 0.00 0.00 1.4213 0.0000 0.00 0.00 0.00 189236.38 189236.38
 
 

Action details: raging_blow

Static Values
  • id:85288
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.enrage.up
Spelldata
  • id:85288
  • name:Raging Blow
  • school:physical
  • tooltip:
  • description:A mighty blow with both weapons that deals a total of ${$96103sw2+$85384sw2} Physical damage.$?a215573[][ Only usable while Enraged.] |cFFFFFFFFGenerates ${$m2/10} Rage.|r
 
    Raging Blow (_oh) 20274 11.0% 0.0 0.00sec 0 0 Direct 101.8 68638 153299 89632 24.8% 0.0%  

Stats details: raging_blow_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 101.82 0.00 0.00 0.0000 0.0000 9126708.35 13417125.78 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.57 75.20% 68637.58 50128 93667 68657.42 63594 74016 5255778 7726492 31.98
crit 25.25 24.80% 153298.86 100255 215435 153722.70 133681 177148 3870930 5690634 31.98
 
 

Action details: raging_blow_oh

Static Values
  • id:85384
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85384
  • name:Raging Blow
  • school:physical
  • tooltip:
  • description:{$@spelldesc85288=A mighty blow with both weapons that deals a total of ${$96103sw2+$85384sw2} Physical damage.$?a215573[][ Only usable while Enraged.] |cFFFFFFFFGenerates ${$m2/10} Rage.|r}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.83
 
    Raging Blow (_mh) 40568 22.0% 0.0 0.00sec 0 0 Direct 101.8 137230 306837 179333 24.8% 0.0%  

Stats details: raging_blow_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 101.82 0.00 0.00 0.0000 0.0000 18260337.19 26844425.33 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.55 75.18% 137230.22 100255 187335 137271.65 125583 149295 10504636 15442809 31.98
crit 25.28 24.82% 306837.06 200511 430870 307688.47 271310 352855 7755702 11401616 31.98
 
 

Action details: raging_blow_mh

Static Values
  • id:96103
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:96103
  • name:Raging Blow
  • school:physical
  • tooltip:
  • description:{$@spelldesc85288=A mighty blow with both weapons that deals a total of ${$96103sw2+$85384sw2} Physical damage.$?a215573[][ Only usable while Enraged.] |cFFFFFFFFGenerates ${$m2/10} Rage.|r}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.83
 
Rampage 0 (26924) 0.0% (14.6%) 39.3 9.99sec 308413 205174

Stats details: rampage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.31 0.00 0.00 0.00 1.5032 0.0000 0.00 0.00 0.00 205173.59 205173.59
 
 

Action details: rampage

Static Values
  • id:184367
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:2.0000
  • min_gcd:0.7500
  • base_cost:70.0
  • secondary_cost:0.0
  • cooldown:1.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:rage>95|buff.massacre.react
Spelldata
  • id:184367
  • name:Rampage
  • school:physical
  • tooltip:
  • description:Enrages you and unleashes a series of 5 brutal strikes over 2 sec for a total of ${$218617sw1+$184707sw1+$184709sw1+$201364sw1+$201363sw1} Physical damage.
 
    Rampage (1) 2026 1.1% 0.0 0.00sec 0 0 Direct 39.3 17167 39355 23210 27.2% 0.0%  

Stats details: rampage1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 39.31 0.00 0.00 0.0000 0.0000 912273.48 1341128.43 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.60 72.77% 17166.95 13401 25042 17169.04 14014 19780 490995 721809 31.98
crit 10.70 27.23% 39355.49 26803 57596 39577.32 28381 54396 421278 619319 31.98
 
 

Action details: rampage1

Static Values
  • id:218617
  • school:physical
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:218617
  • name:Rampage
  • school:physical
  • tooltip:
  • description:{$@spelldesc184367=Enrages you and unleashes a series of 5 brutal strikes over 2 sec for a total of ${$218617sw1+$184707sw1+$184709sw1+$201364sw1+$201363sw1} Physical damage.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.51
 
    Rampage (2) 3855 2.1% 0.0 0.00sec 0 0 Direct 39.3 32661 71264 44173 29.8% 0.0%  

Stats details: rampage2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 39.30 0.00 0.00 0.0000 0.0000 1736112.69 2552250.10 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 27.58 70.18% 32661.24 31524 37829 32666.58 31524 33976 900797 1324257 31.98
crit 11.72 29.82% 71264.38 63048 87006 71478.60 65500 82172 835316 1227994 31.98
 
 

Action details: rampage2

Static Values
  • id:184707
  • school:physical
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:184707
  • name:Rampage
  • school:physical
  • tooltip:
  • description:{$@spelldesc184367=Enrages you and unleashes a series of 5 brutal strikes over 2 sec for a total of ${$218617sw1+$184707sw1+$184709sw1+$201364sw1+$201363sw1} Physical damage.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.55
 
    Rampage (3) 5147 2.8% 0.0 0.00sec 0 0 Direct 39.3 43712 95239 58970 29.6% 0.0%  

Stats details: rampage3

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 39.30 0.00 0.00 0.0000 0.0000 2317405.79 3406806.03 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 27.66 70.39% 43712.18 42180 50616 43717.64 42452 45288 1209136 1777545 31.98
crit 11.64 29.61% 95239.45 84360 116417 95509.71 85766 106715 1108270 1629261 31.98
 
 

Action details: rampage3

Static Values
  • id:184709
  • school:physical
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:184709
  • name:Rampage
  • school:physical
  • tooltip:
  • description:{$@spelldesc184367=Enrages you and unleashes a series of 5 brutal strikes over 2 sec for a total of ${$218617sw1+$184707sw1+$184709sw1+$201364sw1+$201363sw1} Physical damage.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.04
 
    Rampage (4) 7345 4.0% 0.0 0.00sec 0 0 Direct 39.3 65536 139067 84169 25.3% 0.0%  

Stats details: rampage4

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 39.29 0.00 0.00 0.0000 0.0000 3307115.86 4861773.57 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.33 74.66% 65535.94 63270 75924 65542.03 63692 68221 1922430 2826155 31.98
crit 9.96 25.34% 139066.53 126540 174625 139435.77 126540 167032 1384686 2035619 31.98
 
 

Action details: rampage4

Static Values
  • id:201364
  • school:physical
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:201364
  • name:Rampage
  • school:physical
  • tooltip:
  • description:{$@spelldesc184367=Enrages you and unleashes a series of 5 brutal strikes over 2 sec for a total of ${$218617sw1+$184707sw1+$184709sw1+$201364sw1+$201363sw1} Physical damage.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.11
 
    Rampage (5) 8550 4.6% 0.0 0.00sec 0 0 Direct 39.3 76342 162050 97972 25.2% 0.0%  

Stats details: rampage5

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 39.29 0.00 0.00 0.0000 0.0000 3849363.46 5658928.91 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.37 74.76% 76341.54 73704 88445 76347.28 73704 78617 2242505 3296695 31.98
crit 9.92 25.24% 162050.44 147408 203423 162473.82 147408 203423 1606858 2362233 31.98
 
 

Action details: rampage5

Static Values
  • id:201363
  • school:physical
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:201363
  • name:Rampage
  • school:physical
  • tooltip:
  • description:{$@spelldesc184367=Enrages you and unleashes a series of 5 brutal strikes over 2 sec for a total of ${$218617sw1+$184707sw1+$184709sw1+$201364sw1+$201363sw1} Physical damage.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.81
 
Simple Action Stats Execute Interval
Ulthuan
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Ulthuan
  • harmful:false
  • if_expr:
 
Avatar 4.4 118.32sec

Stats details: avatar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.45 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: avatar

Static Values
  • id:107574
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.battle_cry.up|(target.time_to_die<(cooldown.battle_cry.remains+10))
Spelldata
  • id:107574
  • name:Avatar
  • school:physical
  • tooltip:Damage done increased by {$s1=20}%.
  • description:Transform into a colossus for {$d=20 seconds}, causing you to deal {$s1=20}% increased damage and removing all roots and snares.
 
Battle Cry 7.8 61.68sec

Stats details: battle_cry

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.79 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: battle_cry

Static Values
  • id:1719
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(artifact.odyns_fury.enabled&cooldown.odyns_fury.remains=0&(cooldown.bloodthirst.remains=0|(buff.enrage.remains>cooldown.bloodthirst.remains)))|!artifact.odyns_fury.enabled
Spelldata
  • id:1719
  • name:Battle Cry
  • school:physical
  • tooltip:Critical strike chance increased by $w1%.
  • description:Lets loose a battle cry, granting {$s1=100}% increased critical strike chance for {$d=5 seconds}.$?a202751[ |cFFFFFFFFGenerates ${{$202751s2=1000}/10} Rage.|r][]
 
Charge 1.0 0.00sec

Stats details: charge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: charge

Static Values
  • id:100
  • school:physical
  • resource:none
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:100
  • name:Charge
  • school:physical
  • tooltip:
  • description:Charge to an enemy, {$?s103828=false}[stunning][rooting] it for {$?s103828=false}[{$7922d=1.500 seconds}][{$105771d=1.500 seconds}]. |cFFFFFFFFGenerates {$/10;s2=20} Rage.|r
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Ulthuan
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Ulthuan
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Avatar 4.4 0.0 120.0sec 118.4sec 19.45% 19.51% 0.0(0.0) 4.2

Buff details

  • buff initial source:Ulthuan
  • cooldown name:buff_avatar
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • avatar_1:19.45%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:107574
  • name:Avatar
  • tooltip:Damage done increased by {$s1=20}%.
  • description:Transform into a colossus for {$d=20 seconds}, causing you to deal {$s1=20}% increased damage and removing all roots and snares.
  • max_stacks:0
  • duration:20.00
  • cooldown:90.00
  • default_chance:0.00%
Battle Cry 7.8 0.0 61.7sec 61.7sec 8.61% 8.66% 0.0(0.0) 7.7

Buff details

  • buff initial source:Ulthuan
  • cooldown name:buff_battle_cry
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • battle_cry_1:8.61%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1719
  • name:Battle Cry
  • tooltip:Critical strike chance increased by $w1%.
  • description:Lets loose a battle cry, granting {$s1=100}% increased critical strike chance for {$d=5 seconds}.$?a202751[ |cFFFFFFFFGenerates ${{$202751s2=1000}/10} Rage.|r][]
  • max_stacks:0
  • duration:5.00
  • cooldown:60.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 13.69% 0.0(0.0) 1.0

Buff details

  • buff initial source:Ulthuan
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Enrage 45.2 30.2 9.8sec 5.8sec 55.44% 51.39% 30.2(30.2) 45.0

Buff details

  • buff initial source:Ulthuan
  • cooldown name:buff_enrage
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • enrage_1:55.44%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:184362
  • name:Enrage
  • tooltip:Attack speed increased by {$s1=100}% and damage taken increased by {$s2=30}%.
  • description:{$@spelldesc184361=Bloodthirst critical strikes $?a206320[or activating Berserker Rage ][]will Enrage you, increasing your attack speed by {$184362s1=100}% and damage you take by {$184362s2=30}% for {$184362d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deadly Grace 2.0 0.0 381.4sec 0.0sec 10.83% 10.89% 0.0(0.0) 2.0

Buff details

  • buff initial source:Ulthuan
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:10.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Taste for Blood 38.1 6.3 10.5sec 9.0sec 48.54% 48.57% 0.0(0.0) 11.6

Buff details

  • buff initial source:Ulthuan
  • cooldown name:buff_taste_for_blood
  • max_stacks:6
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • taste_for_blood_1:42.40%
  • taste_for_blood_2:5.75%
  • taste_for_blood_3:0.38%
  • taste_for_blood_4:0.01%
  • taste_for_blood_5:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:206333
  • name:Taste for Blood
  • tooltip:Critical strike chance of Bloodthirst increased by {$s1=15}%.
  • description:Furious Slash increases the critical strike chance of Bloodthirst by {$s1=15}%.
  • max_stacks:6
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Ulthuan
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Countless Armies

Buff details

  • buff initial source:Ulthuan
  • cooldown name:buff_flask_of_the_countless_armies
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:strength
  • amount:1300.00

Stack Uptimes

  • flask_of_the_countless_armies_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188034
  • name:Flask of the Countless Armies
  • tooltip:Strength increased by $w1.
  • description:Increases Strength by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (nightborne_delicacy_platter)

Buff details

  • buff initial source:Ulthuan
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:375.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Heroic Leap0.3950.0011.0633.4782.1925.198
Battle Cry1.9280.0014.12311.8250.82523.105
Avatar33.5040.04537.136103.40460.034143.105
Odyn's Fury16.1040.16419.169113.91776.013150.260
Bloodthirst0.2440.0017.35024.07812.76940.452

Resources

Resource Usage Type Count Total Average RPE APR
Ulthuan
execute Rage 20.7 516.4 25.0 25.0 11409.6
rampage Rage 39.3 2751.4 70.0 70.0 4405.8
Resource Gains Type Count Total Average Overflow
charge Rage 1.00 20.00 (0.60%) 20.00 0.00 0.00%
raging_blow Rage 101.82 509.12 (15.36%) 5.00 0.00 0.00%
bloodthirst Rage 100.39 1002.16 (30.24%) 9.98 1.72 0.17%
melee_main_hand Rage 182.02 1192.07 (35.97%) 6.55 9.28 0.77%
melee_off_hand Rage 182.04 590.96 (17.83%) 3.25 9.78 1.63%
Resource RPS-Gain RPS-Loss
Rage 7.36 7.25
Combat End Resource Mean Min Max
Rage 45.53 0.30 100.00

Benefits & Uptimes

Benefits %
Uptimes %
Rage Cap 0.8%

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Ulthuan Fight Length
Count 9999
Mean 450.42
Minimum 350.15
Maximum 555.44
Spread ( max - min ) 205.29
Range [ ( max - min ) / 2 * 100% ] 22.79%
DPS
Sample Data Ulthuan Damage Per Second
Count 9999
Mean 184814.90
Minimum 169500.14
Maximum 205025.61
Spread ( max - min ) 35525.47
Range [ ( max - min ) / 2 * 100% ] 9.61%
Standard Deviation 4650.7898
5th Percentile 177416.64
95th Percentile 192631.03
( 95th Percentile - 5th Percentile ) 15214.38
Mean Distribution
Standard Deviation 46.5102
95.00% Confidence Intervall ( 184723.74 - 184906.06 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 24
0.1% Error 2432
0.1 Scale Factor Error with Delta=300 184644
0.05 Scale Factor Error with Delta=300 738579
0.01 Scale Factor Error with Delta=300 18464480
Priority Target DPS
Sample Data Ulthuan Priority Target Damage Per Second
Count 9999
Mean 184814.90
Minimum 169500.14
Maximum 205025.61
Spread ( max - min ) 35525.47
Range [ ( max - min ) / 2 * 100% ] 9.61%
Standard Deviation 4650.7898
5th Percentile 177416.64
95th Percentile 192631.03
( 95th Percentile - 5th Percentile ) 15214.38
Mean Distribution
Standard Deviation 46.5102
95.00% Confidence Intervall ( 184723.74 - 184906.06 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 24
0.1% Error 2432
0.1 Scale Factor Error with Delta=300 184644
0.05 Scale Factor Error with Delta=300 738579
0.01 Scale Factor Error with Delta=300 18464480
DPS(e)
Sample Data Ulthuan Damage Per Second (Effective)
Count 9999
Mean 184814.90
Minimum 169500.14
Maximum 205025.61
Spread ( max - min ) 35525.47
Range [ ( max - min ) / 2 * 100% ] 9.61%
Damage
Sample Data Ulthuan Damage
Count 9999
Mean 83124716.91
Minimum 62465158.65
Maximum 104424790.12
Spread ( max - min ) 41959631.48
Range [ ( max - min ) / 2 * 100% ] 25.24%
DTPS
Sample Data Ulthuan Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Ulthuan Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Ulthuan Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Ulthuan Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Ulthuan Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Ulthuan Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data UlthuanTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Ulthuan Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=countless_armies
1 0.00 food,type=nightborne_delicacy_platter
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=deadly_grace
Default action list Executed every time the actor is available.
# count action,conditions
5 1.00 auto_attack
6 1.00 charge
7 0.00 run_action_list,name=movement,if=movement.distance>5
This is mostly to prevent cooldowns from being accidentally used during movement.
8 10.43 heroic_leap,if=(raid_event.movement.distance>25&raid_event.movement.in>45)|!raid_event.movement.exists
9 1.00 potion,name=deadly_grace,if=(target.health.pct<20&buff.battle_cry.up)|target.time_to_die<30
A 7.79 battle_cry,if=(artifact.odyns_fury.enabled&cooldown.odyns_fury.remains=0&(cooldown.bloodthirst.remains=0|(buff.enrage.remains>cooldown.bloodthirst.remains)))|!artifact.odyns_fury.enabled
B 4.45 avatar,if=buff.battle_cry.up|(target.time_to_die<(cooldown.battle_cry.remains+10))
0.00 bloodbath,if=buff.dragon_roar.up|(!talent.dragon_roar.enabled&(buff.battle_cry.up|cooldown.battle_cry.remains>10))
0.00 blood_fury,if=buff.battle_cry.up
0.00 berserking,if=buff.battle_cry.up
0.00 arcane_torrent,if=rage<rage.max-40
C 0.00 call_action_list,name=two_targets,if=spell_targets.whirlwind=2|spell_targets.whirlwind=3
D 0.00 call_action_list,name=aoe,if=spell_targets.whirlwind>3
E 0.00 call_action_list,name=single_target
actions.single_target
# count action,conditions
F 8.07 odyns_fury,if=buff.battle_cry.up|target.time_to_die<cooldown.battle_cry.remains
0.00 execute,if=artifact.juggernaut.enabled&(!buff.juggernaut.up|buff.juggernaut.remains<2)
0.00 berserker_rage,if=talent.outburst.enabled&cooldown.dragon_roar.remains=0&buff.enrage.down
G 11.15 rampage,if=rage>95|buff.massacre.react
0.00 whirlwind,if=!talent.inner_rage.enabled&buff.wrecking_ball.react
H 62.34 raging_blow,if=buff.enrage.up
0.00 whirlwind,if=buff.wrecking_ball.react&buff.enrage.up
I 8.51 execute,if=buff.enrage.up|buff.battle_cry.up|buff.stone_heart.react||(buff.juggernaut.up&buff.juggernaut.remains<3)
J 100.39 bloodthirst
K 39.48 raging_blow
0.00 dragon_roar,if=!talent.bloodbath.enabled&(cooldown.battle_cry.remains<1|cooldown.battle_cry.remains>10)|talent.bloodbath.enabled&cooldown.bloodbath.remains=0
L 28.16 rampage,if=(target.health.pct>20&(cooldown.battle_cry.remains>3|buff.battle_cry.up|rage>90))
M 12.14 execute,if=rage>50|buff.battle_cry.up|buff.stone_heart.react|target.time_to_die<20
N 44.43 furious_slash

Sample Sequence

0124568ABFJHNJHGJHLJHNJKLJHNJHLJHNJKLJHNJHLJHN8JKLJHNJHLJHNAFJHLJHNJKLJHNJKLJHN8JHLJHNJHLJHNJHLJHNJKLJHNABFJHLJHN8JKLJHNJKLJHNJKLJHNJKLJHNJKNJHLJ8HNJKLAFHJNHJLHJNKJLHJNKJLHJNKJNK8JLHJNKJLHJNKJNHABFGHJNHJGHJLHJNKJ8LHJNKJNKJLHJNKJLHJNKJLHJNHAFJHLJ8HNJKLJHNJKLJHNJHLJHNJHNJGHJNHJG8HIJKNA9BFIIJHIJKNJHIJKMJKMJHIJKMJK8MJHIJGHIJKNJHIJKMAFIIJHIJHIJK

Sample Sequence Table

time name target resources buffs
Pre flask Ulthuan 0.0/100: 0% rage
Pre food Ulthuan 0.0/100: 0% rage
Pre augmentation Ulthuan 0.0/100: 0% rage
Pre potion Fluffy_Pillow 0.0/100: 0% rage potion_of_deadly_grace
0:00.000 auto_attack Fluffy_Pillow 0.0/100: 0% rage potion_of_deadly_grace
0:00.000 charge Fluffy_Pillow 9.9/100: 10% rage potion_of_deadly_grace
0:00.000 heroic_leap Fluffy_Pillow 29.9/100: 30% rage potion_of_deadly_grace
0:00.000 battle_cry Fluffy_Pillow 29.9/100: 30% rage potion_of_deadly_grace
0:00.000 avatar Fluffy_Pillow 29.9/100: 30% rage battle_cry, potion_of_deadly_grace
0:00.000 odyns_fury Fluffy_Pillow 29.9/100: 30% rage avatar, battle_cry, potion_of_deadly_grace
0:01.459 bloodthirst Fluffy_Pillow 36.5/100: 37% rage bloodlust, avatar, battle_cry, potion_of_deadly_grace
0:02.583 raging_blow Fluffy_Pillow 46.5/100: 47% rage bloodlust, avatar, enrage, battle_cry, potion_of_deadly_grace
0:03.704 furious_slash Fluffy_Pillow 61.4/100: 61% rage bloodlust, avatar, enrage, battle_cry, potion_of_deadly_grace
0:04.826 bloodthirst Fluffy_Pillow 61.4/100: 61% rage bloodlust, avatar, enrage, taste_for_blood, battle_cry, potion_of_deadly_grace
0:05.950 raging_blow Fluffy_Pillow 81.3/100: 81% rage bloodlust, avatar, enrage, potion_of_deadly_grace
0:07.072 rampage Fluffy_Pillow 96.2/100: 96% rage bloodlust, avatar, enrage, potion_of_deadly_grace
0:08.566 bloodthirst Fluffy_Pillow 36.1/100: 36% rage bloodlust, avatar, enrage, potion_of_deadly_grace
0:09.690 raging_blow Fluffy_Pillow 56.0/100: 56% rage bloodlust, avatar, enrage, potion_of_deadly_grace
0:10.813 rampage Fluffy_Pillow 70.9/100: 71% rage bloodlust, avatar, enrage, potion_of_deadly_grace
0:12.308 bloodthirst Fluffy_Pillow 10.8/100: 11% rage bloodlust, avatar, enrage, potion_of_deadly_grace
0:13.429 raging_blow Fluffy_Pillow 30.7/100: 31% rage bloodlust, avatar, enrage, potion_of_deadly_grace
0:14.551 furious_slash Fluffy_Pillow 45.6/100: 46% rage bloodlust, avatar, enrage, potion_of_deadly_grace
0:15.673 bloodthirst Fluffy_Pillow 45.6/100: 46% rage bloodlust, avatar, taste_for_blood, potion_of_deadly_grace
0:16.795 raging_blow Fluffy_Pillow 65.5/100: 65% rage bloodlust, avatar, taste_for_blood, potion_of_deadly_grace
0:17.916 rampage Fluffy_Pillow 70.5/100: 70% rage bloodlust, avatar, taste_for_blood, potion_of_deadly_grace
0:19.411 bloodthirst Fluffy_Pillow 10.4/100: 10% rage bloodlust, avatar, enrage, taste_for_blood, potion_of_deadly_grace
0:20.533 raging_blow Fluffy_Pillow 30.3/100: 30% rage bloodlust, enrage, taste_for_blood, potion_of_deadly_grace
0:21.654 furious_slash Fluffy_Pillow 45.2/100: 45% rage bloodlust, enrage, taste_for_blood, potion_of_deadly_grace
0:22.777 bloodthirst Fluffy_Pillow 55.1/100: 55% rage bloodlust, taste_for_blood(2), potion_of_deadly_grace
0:23.899 raging_blow Fluffy_Pillow 65.1/100: 65% rage bloodlust, enrage
0:25.023 rampage Fluffy_Pillow 70.1/100: 70% rage bloodlust, enrage
0:26.519 bloodthirst Fluffy_Pillow 19.9/100: 20% rage bloodlust, enrage
0:27.640 raging_blow Fluffy_Pillow 29.9/100: 30% rage bloodlust, enrage
0:28.762 furious_slash Fluffy_Pillow 44.8/100: 45% rage bloodlust, enrage
0:29.886 bloodthirst Fluffy_Pillow 54.7/100: 55% rage bloodlust, taste_for_blood
0:31.009 raging_blow Fluffy_Pillow 64.7/100: 65% rage bloodlust, taste_for_blood
0:32.133 rampage Fluffy_Pillow 76.3/100: 76% rage bloodlust, taste_for_blood
0:33.628 bloodthirst Fluffy_Pillow 6.3/100: 6% rage bloodlust, enrage, taste_for_blood
0:34.751 raging_blow Fluffy_Pillow 26.2/100: 26% rage bloodlust, enrage, taste_for_blood
0:35.873 furious_slash Fluffy_Pillow 31.2/100: 31% rage bloodlust, enrage, taste_for_blood
0:36.995 bloodthirst Fluffy_Pillow 41.1/100: 41% rage bloodlust, taste_for_blood(2)
0:38.119 raging_blow Fluffy_Pillow 61.0/100: 61% rage bloodlust, enrage
0:39.240 rampage Fluffy_Pillow 75.9/100: 76% rage bloodlust, enrage
0:40.735 bloodthirst Fluffy_Pillow 15.8/100: 16% rage bloodlust, enrage
0:41.856 raging_blow Fluffy_Pillow 35.7/100: 36% rage enrage
0:43.315 furious_slash Fluffy_Pillow 50.6/100: 51% rage
0:44.773 heroic_leap Fluffy_Pillow 57.2/100: 57% rage taste_for_blood
0:45.000 bloodthirst Fluffy_Pillow 57.2/100: 57% rage taste_for_blood
0:46.475 raging_blow Fluffy_Pillow 67.2/100: 67% rage taste_for_blood
0:47.934 rampage Fluffy_Pillow 72.2/100: 72% rage taste_for_blood
0:49.439 bloodthirst Fluffy_Pillow 12.1/100: 12% rage enrage, taste_for_blood
0:50.896 raging_blow Fluffy_Pillow 32.0/100: 32% rage enrage, taste_for_blood
0:52.353 furious_slash Fluffy_Pillow 46.9/100: 47% rage
0:53.810 bloodthirst Fluffy_Pillow 56.8/100: 57% rage taste_for_blood
0:55.267 raging_blow Fluffy_Pillow 66.8/100: 67% rage enrage
0:56.724 rampage Fluffy_Pillow 71.8/100: 72% rage enrage
0:58.230 bloodthirst Fluffy_Pillow 11.7/100: 12% rage enrage
0:59.689 raging_blow Fluffy_Pillow 31.6/100: 32% rage enrage
1:01.145 furious_slash Fluffy_Pillow 46.5/100: 46% rage
1:02.601 battle_cry Fluffy_Pillow 56.4/100: 56% rage taste_for_blood
1:02.601 odyns_fury Fluffy_Pillow 56.4/100: 56% rage taste_for_blood, battle_cry
1:04.058 bloodthirst Fluffy_Pillow 56.4/100: 56% rage taste_for_blood, battle_cry
1:05.516 raging_blow Fluffy_Pillow 66.4/100: 66% rage enrage, battle_cry
1:06.972 rampage Fluffy_Pillow 81.3/100: 81% rage enrage, battle_cry
1:08.473 bloodthirst Fluffy_Pillow 21.2/100: 21% rage enrage
1:09.931 raging_blow Fluffy_Pillow 41.1/100: 41% rage enrage
1:11.387 furious_slash Fluffy_Pillow 56.0/100: 56% rage
1:12.844 bloodthirst Fluffy_Pillow 65.9/100: 66% rage taste_for_blood
1:14.302 raging_blow Fluffy_Pillow 75.9/100: 76% rage taste_for_blood
1:15.760 rampage Fluffy_Pillow 80.9/100: 81% rage taste_for_blood
1:17.267 bloodthirst Fluffy_Pillow 20.8/100: 21% rage enrage, taste_for_blood
1:18.725 raging_blow Fluffy_Pillow 40.7/100: 41% rage enrage, taste_for_blood
1:20.182 furious_slash Fluffy_Pillow 55.6/100: 56% rage
1:21.639 bloodthirst Fluffy_Pillow 58.9/100: 59% rage taste_for_blood
1:23.096 raging_blow Fluffy_Pillow 68.9/100: 69% rage taste_for_blood
1:24.554 rampage Fluffy_Pillow 73.9/100: 74% rage taste_for_blood
1:26.058 bloodthirst Fluffy_Pillow 13.8/100: 14% rage enrage, taste_for_blood
1:27.516 raging_blow Fluffy_Pillow 33.7/100: 34% rage enrage, taste_for_blood
1:28.973 furious_slash Fluffy_Pillow 48.6/100: 49% rage
1:30.431 heroic_leap Fluffy_Pillow 58.5/100: 58% rage taste_for_blood
1:30.431 bloodthirst Fluffy_Pillow 58.5/100: 58% rage taste_for_blood
1:31.888 raging_blow Fluffy_Pillow 68.5/100: 68% rage enrage
1:33.346 rampage Fluffy_Pillow 73.5/100: 73% rage enrage
1:34.852 bloodthirst Fluffy_Pillow 13.4/100: 13% rage enrage
1:36.310 raging_blow Fluffy_Pillow 33.3/100: 33% rage enrage
1:37.768 furious_slash Fluffy_Pillow 48.2/100: 48% rage enrage
1:39.225 bloodthirst Fluffy_Pillow 58.1/100: 58% rage taste_for_blood
1:40.682 raging_blow Fluffy_Pillow 78.0/100: 78% rage enrage
1:42.140 rampage Fluffy_Pillow 83.0/100: 83% rage enrage
1:43.646 bloodthirst Fluffy_Pillow 22.9/100: 23% rage enrage
1:45.104 raging_blow Fluffy_Pillow 42.8/100: 43% rage enrage
1:46.562 furious_slash Fluffy_Pillow 57.7/100: 58% rage
1:48.020 bloodthirst Fluffy_Pillow 67.6/100: 68% rage taste_for_blood
1:49.480 raging_blow Fluffy_Pillow 77.6/100: 78% rage enrage
1:50.938 rampage Fluffy_Pillow 92.5/100: 92% rage enrage
1:52.443 bloodthirst Fluffy_Pillow 22.5/100: 22% rage enrage
1:53.901 raging_blow Fluffy_Pillow 42.4/100: 42% rage enrage
1:55.357 furious_slash Fluffy_Pillow 57.3/100: 57% rage
1:56.813 bloodthirst Fluffy_Pillow 67.2/100: 67% rage taste_for_blood
1:58.270 raging_blow Fluffy_Pillow 77.2/100: 77% rage taste_for_blood
1:59.729 rampage Fluffy_Pillow 92.1/100: 92% rage taste_for_blood
2:01.233 bloodthirst Fluffy_Pillow 22.1/100: 22% rage enrage, taste_for_blood
2:02.691 raging_blow Fluffy_Pillow 32.1/100: 32% rage enrage, taste_for_blood
2:04.147 furious_slash Fluffy_Pillow 47.0/100: 47% rage
2:05.606 battle_cry Fluffy_Pillow 53.6/100: 54% rage taste_for_blood
2:05.606 avatar Fluffy_Pillow 53.6/100: 54% rage taste_for_blood, battle_cry
2:05.606 odyns_fury Fluffy_Pillow 53.6/100: 54% rage avatar, taste_for_blood, battle_cry
2:07.064 bloodthirst Fluffy_Pillow 53.6/100: 54% rage avatar, taste_for_blood, battle_cry
2:08.519 raging_blow Fluffy_Pillow 73.5/100: 73% rage avatar, enrage, battle_cry
2:09.976 rampage Fluffy_Pillow 78.5/100: 78% rage avatar, enrage, battle_cry
2:11.481 bloodthirst Fluffy_Pillow 18.4/100: 18% rage avatar, enrage
2:12.938 raging_blow Fluffy_Pillow 38.3/100: 38% rage avatar, enrage
2:14.395 furious_slash Fluffy_Pillow 53.2/100: 53% rage avatar, enrage
2:15.853 heroic_leap Fluffy_Pillow 63.1/100: 63% rage avatar, taste_for_blood
2:15.853 bloodthirst Fluffy_Pillow 63.1/100: 63% rage avatar, taste_for_blood
2:17.311 raging_blow Fluffy_Pillow 83.0/100: 83% rage avatar, taste_for_blood
2:18.769 rampage Fluffy_Pillow 88.0/100: 88% rage avatar, taste_for_blood
2:20.275 bloodthirst Fluffy_Pillow 18.0/100: 18% rage avatar, enrage, taste_for_blood
2:21.732 raging_blow Fluffy_Pillow 37.9/100: 38% rage avatar, enrage, taste_for_blood
2:23.188 furious_slash Fluffy_Pillow 52.8/100: 53% rage avatar
2:24.646 bloodthirst Fluffy_Pillow 59.4/100: 59% rage avatar, taste_for_blood
2:26.104 raging_blow Fluffy_Pillow 69.4/100: 69% rage taste_for_blood
2:27.560 rampage Fluffy_Pillow 74.4/100: 74% rage taste_for_blood
2:29.064 bloodthirst Fluffy_Pillow 14.3/100: 14% rage enrage, taste_for_blood
2:30.521 raging_blow Fluffy_Pillow 34.2/100: 34% rage enrage
2:31.979 furious_slash Fluffy_Pillow 49.1/100: 49% rage enrage
2:33.438 bloodthirst Fluffy_Pillow 59.0/100: 59% rage taste_for_blood
2:34.896 raging_blow Fluffy_Pillow 72.3/100: 72% rage taste_for_blood
2:36.354 rampage Fluffy_Pillow 77.3/100: 77% rage taste_for_blood
2:37.857 bloodthirst Fluffy_Pillow 7.3/100: 7% rage enrage, taste_for_blood
2:39.316 raging_blow Fluffy_Pillow 27.2/100: 27% rage enrage, taste_for_blood
2:40.772 furious_slash Fluffy_Pillow 42.1/100: 42% rage
2:42.232 bloodthirst Fluffy_Pillow 52.0/100: 52% rage taste_for_blood
2:43.689 raging_blow Fluffy_Pillow 62.0/100: 62% rage taste_for_blood
2:45.146 rampage Fluffy_Pillow 76.9/100: 77% rage taste_for_blood
2:46.652 bloodthirst Fluffy_Pillow 6.9/100: 7% rage enrage, taste_for_blood
2:48.110 raging_blow Fluffy_Pillow 16.9/100: 17% rage enrage
2:49.569 furious_slash Fluffy_Pillow 31.8/100: 32% rage enrage
2:51.026 bloodthirst Fluffy_Pillow 41.7/100: 42% rage taste_for_blood
2:52.484 raging_blow Fluffy_Pillow 55.0/100: 55% rage taste_for_blood
2:53.943 furious_slash Fluffy_Pillow 60.0/100: 60% rage taste_for_blood
2:55.400 bloodthirst Fluffy_Pillow 60.0/100: 60% rage taste_for_blood(2)
2:56.856 raging_blow Fluffy_Pillow 79.9/100: 80% rage enrage
2:58.314 rampage Fluffy_Pillow 94.8/100: 95% rage enrage
2:59.819 bloodthirst Fluffy_Pillow 34.7/100: 35% rage enrage
3:01.278 heroic_leap Fluffy_Pillow 54.6/100: 55% rage enrage
3:01.278 raging_blow Fluffy_Pillow 54.6/100: 55% rage enrage
3:02.736 furious_slash Fluffy_Pillow 69.5/100: 69% rage
3:04.194 bloodthirst Fluffy_Pillow 69.5/100: 69% rage taste_for_blood
3:05.652 raging_blow Fluffy_Pillow 79.5/100: 79% rage taste_for_blood
3:07.110 rampage Fluffy_Pillow 94.4/100: 94% rage taste_for_blood
3:07.110 battle_cry Fluffy_Pillow 24.4/100: 24% rage enrage, taste_for_blood, battle_cry
3:08.615 odyns_fury Fluffy_Pillow 24.4/100: 24% rage enrage, taste_for_blood, battle_cry
3:10.072 raging_blow Fluffy_Pillow 34.3/100: 34% rage enrage, taste_for_blood, battle_cry
3:11.530 bloodthirst Fluffy_Pillow 49.2/100: 49% rage battle_cry
3:12.986 furious_slash Fluffy_Pillow 59.2/100: 59% rage enrage
3:14.444 raging_blow Fluffy_Pillow 59.2/100: 59% rage enrage, taste_for_blood
3:15.901 bloodthirst Fluffy_Pillow 74.1/100: 74% rage taste_for_blood
3:17.358 rampage Fluffy_Pillow 94.0/100: 94% rage taste_for_blood
3:18.862 raging_blow Fluffy_Pillow 24.0/100: 24% rage enrage, taste_for_blood
3:20.320 bloodthirst Fluffy_Pillow 38.9/100: 39% rage enrage, taste_for_blood
3:21.776 furious_slash Fluffy_Pillow 58.8/100: 59% rage
3:23.233 raging_blow Fluffy_Pillow 58.8/100: 59% rage taste_for_blood
3:24.692 bloodthirst Fluffy_Pillow 63.8/100: 64% rage taste_for_blood
3:26.149 rampage Fluffy_Pillow 83.7/100: 84% rage taste_for_blood
3:27.655 raging_blow Fluffy_Pillow 13.7/100: 14% rage enrage, taste_for_blood
3:29.113 bloodthirst Fluffy_Pillow 28.6/100: 29% rage enrage, taste_for_blood
3:30.570 furious_slash Fluffy_Pillow 48.5/100: 48% rage
3:32.027 raging_blow Fluffy_Pillow 48.5/100: 48% rage taste_for_blood
3:33.487 bloodthirst Fluffy_Pillow 53.5/100: 53% rage taste_for_blood
3:34.943 rampage Fluffy_Pillow 73.4/100: 73% rage taste_for_blood
3:36.447 raging_blow Fluffy_Pillow 3.4/100: 3% rage enrage, taste_for_blood
3:37.904 bloodthirst Fluffy_Pillow 18.3/100: 18% rage enrage, taste_for_blood
3:39.362 furious_slash Fluffy_Pillow 38.2/100: 38% rage
3:40.820 raging_blow Fluffy_Pillow 38.2/100: 38% rage taste_for_blood
3:42.278 bloodthirst Fluffy_Pillow 43.2/100: 43% rage taste_for_blood
3:43.735 furious_slash Fluffy_Pillow 59.8/100: 60% rage taste_for_blood
3:45.194 raging_blow Fluffy_Pillow 59.8/100: 60% rage taste_for_blood(2)
3:46.651 heroic_leap Fluffy_Pillow 74.7/100: 75% rage taste_for_blood(2)
3:46.651 bloodthirst Fluffy_Pillow 74.7/100: 75% rage taste_for_blood(2)
3:48.109 rampage Fluffy_Pillow 84.7/100: 85% rage enrage
3:49.613 raging_blow Fluffy_Pillow 24.6/100: 25% rage enrage
3:51.071 bloodthirst Fluffy_Pillow 29.6/100: 30% rage enrage
3:52.529 furious_slash Fluffy_Pillow 49.5/100: 49% rage
3:53.986 raging_blow Fluffy_Pillow 59.4/100: 59% rage taste_for_blood
3:55.442 bloodthirst Fluffy_Pillow 64.4/100: 64% rage taste_for_blood
3:56.901 rampage Fluffy_Pillow 84.3/100: 84% rage taste_for_blood
3:58.407 raging_blow Fluffy_Pillow 14.3/100: 14% rage enrage, taste_for_blood
3:59.862 bloodthirst Fluffy_Pillow 19.3/100: 19% rage enrage, taste_for_blood
4:01.322 furious_slash Fluffy_Pillow 39.2/100: 39% rage
4:02.780 raging_blow Fluffy_Pillow 49.1/100: 49% rage taste_for_blood
4:04.237 bloodthirst Fluffy_Pillow 54.1/100: 54% rage taste_for_blood
4:05.694 furious_slash Fluffy_Pillow 74.0/100: 74% rage enrage
4:07.149 raging_blow Fluffy_Pillow 83.9/100: 84% rage enrage, taste_for_blood
4:08.606 battle_cry Fluffy_Pillow 88.9/100: 89% rage taste_for_blood
4:08.606 avatar Fluffy_Pillow 88.9/100: 89% rage taste_for_blood, battle_cry
4:08.606 odyns_fury Fluffy_Pillow 88.9/100: 89% rage avatar, taste_for_blood, battle_cry
4:10.061 rampage Fluffy_Pillow 98.8/100: 99% rage avatar, taste_for_blood, battle_cry
4:11.567 raging_blow Fluffy_Pillow 28.8/100: 29% rage avatar, enrage, taste_for_blood, battle_cry
4:13.024 bloodthirst Fluffy_Pillow 43.7/100: 44% rage avatar, enrage, taste_for_blood, battle_cry
4:14.482 furious_slash Fluffy_Pillow 63.6/100: 64% rage avatar, enrage
4:15.940 raging_blow Fluffy_Pillow 73.5/100: 73% rage avatar, enrage, taste_for_blood
4:17.397 bloodthirst Fluffy_Pillow 78.5/100: 78% rage avatar, taste_for_blood
4:18.855 rampage Fluffy_Pillow 98.4/100: 98% rage avatar, enrage
4:20.360 raging_blow Fluffy_Pillow 38.3/100: 38% rage avatar, enrage
4:21.816 bloodthirst Fluffy_Pillow 53.2/100: 53% rage avatar, enrage
4:23.274 rampage Fluffy_Pillow 73.1/100: 73% rage avatar, enrage
4:24.778 raging_blow Fluffy_Pillow 13.0/100: 13% rage avatar, enrage
4:26.235 bloodthirst Fluffy_Pillow 27.9/100: 28% rage avatar, enrage
4:27.690 furious_slash Fluffy_Pillow 37.9/100: 38% rage avatar
4:29.146 raging_blow Fluffy_Pillow 47.8/100: 48% rage taste_for_blood
4:30.604 bloodthirst Fluffy_Pillow 52.8/100: 53% rage taste_for_blood
4:32.060 heroic_leap Fluffy_Pillow 72.7/100: 73% rage taste_for_blood
4:32.060 rampage Fluffy_Pillow 72.7/100: 73% rage taste_for_blood
4:33.566 raging_blow Fluffy_Pillow 2.7/100: 3% rage enrage, taste_for_blood
4:35.024 bloodthirst Fluffy_Pillow 17.6/100: 18% rage enrage, taste_for_blood
4:36.481 furious_slash Fluffy_Pillow 27.6/100: 28% rage
4:37.939 raging_blow Fluffy_Pillow 37.5/100: 37% rage taste_for_blood
4:39.397 bloodthirst Fluffy_Pillow 42.5/100: 42% rage taste_for_blood
4:40.854 furious_slash Fluffy_Pillow 62.4/100: 62% rage taste_for_blood
4:42.312 raging_blow Fluffy_Pillow 62.4/100: 62% rage taste_for_blood(2)
4:43.770 bloodthirst Fluffy_Pillow 77.3/100: 77% rage taste_for_blood(2)
4:45.228 rampage Fluffy_Pillow 87.3/100: 87% rage enrage
4:46.733 raging_blow Fluffy_Pillow 17.3/100: 17% rage enrage
4:48.192 bloodthirst Fluffy_Pillow 32.2/100: 32% rage enrage
4:49.649 furious_slash Fluffy_Pillow 52.1/100: 52% rage
4:51.106 raging_blow Fluffy_Pillow 58.7/100: 59% rage taste_for_blood
4:52.563 bloodthirst Fluffy_Pillow 63.7/100: 64% rage taste_for_blood
4:54.022 rampage Fluffy_Pillow 73.7/100: 74% rage taste_for_blood
4:55.527 raging_blow Fluffy_Pillow 13.6/100: 14% rage enrage, taste_for_blood
4:56.985 bloodthirst Fluffy_Pillow 28.5/100: 28% rage enrage, taste_for_blood
4:58.442 furious_slash Fluffy_Pillow 48.4/100: 48% rage
4:59.899 raging_blow Fluffy_Pillow 58.3/100: 58% rage taste_for_blood
5:01.355 bloodthirst Fluffy_Pillow 63.3/100: 63% rage taste_for_blood
5:02.812 rampage Fluffy_Pillow 83.2/100: 83% rage enrage
5:04.316 raging_blow Fluffy_Pillow 13.2/100: 13% rage enrage
5:05.773 bloodthirst Fluffy_Pillow 28.1/100: 28% rage enrage
5:07.230 furious_slash Fluffy_Pillow 48.0/100: 48% rage enrage
5:08.687 raging_blow Fluffy_Pillow 57.9/100: 58% rage enrage, taste_for_blood
5:10.146 battle_cry Fluffy_Pillow 69.5/100: 69% rage taste_for_blood
5:10.146 odyns_fury Fluffy_Pillow 69.5/100: 69% rage taste_for_blood, battle_cry
5:11.602 bloodthirst Fluffy_Pillow 69.5/100: 69% rage taste_for_blood, battle_cry
5:13.059 raging_blow Fluffy_Pillow 79.5/100: 79% rage enrage, battle_cry
5:14.517 rampage Fluffy_Pillow 94.4/100: 94% rage enrage, battle_cry
5:16.022 bloodthirst Fluffy_Pillow 34.3/100: 34% rage enrage
5:17.479 heroic_leap Fluffy_Pillow 54.2/100: 54% rage enrage
5:17.479 raging_blow Fluffy_Pillow 54.2/100: 54% rage enrage
5:18.935 furious_slash Fluffy_Pillow 69.1/100: 69% rage
5:20.394 bloodthirst Fluffy_Pillow 72.4/100: 72% rage taste_for_blood
5:21.853 raging_blow Fluffy_Pillow 82.4/100: 82% rage taste_for_blood
5:23.310 rampage Fluffy_Pillow 87.4/100: 87% rage taste_for_blood
5:24.815 bloodthirst Fluffy_Pillow 27.3/100: 27% rage enrage, taste_for_blood
5:26.273 raging_blow Fluffy_Pillow 47.2/100: 47% rage enrage, taste_for_blood
5:27.729 furious_slash Fluffy_Pillow 62.1/100: 62% rage
5:29.187 bloodthirst Fluffy_Pillow 72.0/100: 72% rage taste_for_blood
5:30.644 raging_blow Fluffy_Pillow 82.0/100: 82% rage taste_for_blood
5:32.104 rampage Fluffy_Pillow 87.0/100: 87% rage taste_for_blood
5:33.607 bloodthirst Fluffy_Pillow 26.9/100: 27% rage enrage, taste_for_blood
5:35.064 raging_blow Fluffy_Pillow 46.8/100: 47% rage enrage, taste_for_blood
5:36.520 furious_slash Fluffy_Pillow 61.7/100: 62% rage
5:37.980 bloodthirst Fluffy_Pillow 61.7/100: 62% rage taste_for_blood
5:39.439 raging_blow Fluffy_Pillow 71.7/100: 72% rage enrage
5:40.896 rampage Fluffy_Pillow 76.7/100: 77% rage enrage
5:42.401 bloodthirst Fluffy_Pillow 16.6/100: 17% rage enrage
5:43.857 raging_blow Fluffy_Pillow 36.5/100: 36% rage enrage
5:45.315 furious_slash Fluffy_Pillow 51.4/100: 51% rage
5:46.773 bloodthirst Fluffy_Pillow 54.7/100: 55% rage taste_for_blood
5:48.230 raging_blow Fluffy_Pillow 64.7/100: 65% rage enrage
5:49.686 furious_slash Fluffy_Pillow 69.7/100: 70% rage enrage
5:51.141 bloodthirst Fluffy_Pillow 79.6/100: 80% rage taste_for_blood
5:52.597 rampage Fluffy_Pillow 99.5/100: 99% rage taste_for_blood
5:54.101 raging_blow Fluffy_Pillow 29.5/100: 29% rage enrage, taste_for_blood
5:55.557 bloodthirst Fluffy_Pillow 44.4/100: 44% rage enrage, taste_for_blood
5:57.015 furious_slash Fluffy_Pillow 64.3/100: 64% rage enrage
5:58.474 raging_blow Fluffy_Pillow 64.3/100: 64% rage enrage, taste_for_blood
5:59.932 bloodthirst Fluffy_Pillow 79.2/100: 79% rage taste_for_blood
6:01.388 rampage Fluffy_Pillow 99.1/100: 99% rage taste_for_blood
6:02.892 heroic_leap Fluffy_Pillow 29.1/100: 29% rage enrage, taste_for_blood
6:02.892 raging_blow Fluffy_Pillow 29.1/100: 29% rage enrage, taste_for_blood
6:04.351 execute Fluffy_Pillow 44.0/100: 44% rage enrage, taste_for_blood
6:05.809 bloodthirst Fluffy_Pillow 28.9/100: 29% rage
6:07.267 raging_blow Fluffy_Pillow 38.9/100: 39% rage
6:08.726 furious_slash Fluffy_Pillow 43.9/100: 44% rage
6:10.183 battle_cry Fluffy_Pillow 53.8/100: 54% rage taste_for_blood
6:10.183 potion Fluffy_Pillow 53.8/100: 54% rage taste_for_blood, battle_cry
6:10.183 avatar Fluffy_Pillow 53.8/100: 54% rage taste_for_blood, battle_cry, potion_of_deadly_grace
6:10.183 odyns_fury Fluffy_Pillow 53.8/100: 54% rage avatar, taste_for_blood, battle_cry, potion_of_deadly_grace
6:11.640 execute Fluffy_Pillow 53.8/100: 54% rage avatar, taste_for_blood, battle_cry, potion_of_deadly_grace
6:13.098 execute Fluffy_Pillow 38.7/100: 39% rage avatar, taste_for_blood, battle_cry, potion_of_deadly_grace
6:14.554 bloodthirst Fluffy_Pillow 13.7/100: 14% rage avatar, taste_for_blood, battle_cry, potion_of_deadly_grace
6:16.010 raging_blow Fluffy_Pillow 23.7/100: 24% rage avatar, enrage, potion_of_deadly_grace
6:17.468 execute Fluffy_Pillow 38.6/100: 39% rage avatar, enrage, potion_of_deadly_grace
6:18.926 bloodthirst Fluffy_Pillow 23.5/100: 23% rage avatar, potion_of_deadly_grace
6:20.383 raging_blow Fluffy_Pillow 40.1/100: 40% rage avatar, potion_of_deadly_grace
6:21.841 furious_slash Fluffy_Pillow 45.1/100: 45% rage avatar, potion_of_deadly_grace
6:23.299 bloodthirst Fluffy_Pillow 55.0/100: 55% rage avatar, taste_for_blood, potion_of_deadly_grace
6:24.757 raging_blow Fluffy_Pillow 65.0/100: 65% rage avatar, enrage, potion_of_deadly_grace
6:26.214 execute Fluffy_Pillow 70.0/100: 70% rage avatar, enrage, potion_of_deadly_grace
6:27.670 bloodthirst Fluffy_Pillow 54.9/100: 55% rage avatar, potion_of_deadly_grace
6:29.128 raging_blow Fluffy_Pillow 74.8/100: 75% rage avatar, potion_of_deadly_grace
6:30.586 execute Fluffy_Pillow 79.8/100: 80% rage potion_of_deadly_grace
6:32.043 bloodthirst Fluffy_Pillow 64.7/100: 65% rage potion_of_deadly_grace
6:33.500 raging_blow Fluffy_Pillow 74.7/100: 75% rage potion_of_deadly_grace
6:34.958 execute Fluffy_Pillow 79.7/100: 80% rage potion_of_deadly_grace
6:36.414 bloodthirst Fluffy_Pillow 64.6/100: 65% rage
6:37.871 raging_blow Fluffy_Pillow 74.6/100: 75% rage enrage
6:39.329 execute Fluffy_Pillow 89.5/100: 89% rage enrage
6:40.787 bloodthirst Fluffy_Pillow 67.8/100: 68% rage
6:42.243 raging_blow Fluffy_Pillow 77.8/100: 78% rage
6:43.702 execute Fluffy_Pillow 82.8/100: 83% rage
6:45.160 bloodthirst Fluffy_Pillow 67.7/100: 68% rage
6:46.618 raging_blow Fluffy_Pillow 77.7/100: 78% rage
6:48.076 heroic_leap Fluffy_Pillow 92.6/100: 93% rage
6:48.076 execute Fluffy_Pillow 92.6/100: 93% rage
6:49.533 bloodthirst Fluffy_Pillow 67.6/100: 68% rage
6:50.991 raging_blow Fluffy_Pillow 87.5/100: 87% rage enrage
6:52.448 execute Fluffy_Pillow 92.5/100: 92% rage enrage
6:53.906 bloodthirst Fluffy_Pillow 77.4/100: 77% rage
6:55.364 rampage Fluffy_Pillow 97.3/100: 97% rage enrage
6:56.868 raging_blow Fluffy_Pillow 37.2/100: 37% rage enrage
6:58.324 execute Fluffy_Pillow 52.1/100: 52% rage enrage
6:59.783 bloodthirst Fluffy_Pillow 33.7/100: 34% rage
7:01.239 raging_blow Fluffy_Pillow 43.7/100: 44% rage
7:02.697 furious_slash Fluffy_Pillow 48.7/100: 49% rage
7:04.154 bloodthirst Fluffy_Pillow 52.0/100: 52% rage taste_for_blood
7:05.611 raging_blow Fluffy_Pillow 62.0/100: 62% rage enrage
7:07.067 execute Fluffy_Pillow 76.9/100: 77% rage enrage
7:08.526 bloodthirst Fluffy_Pillow 61.8/100: 62% rage
7:09.984 raging_blow Fluffy_Pillow 71.8/100: 72% rage
7:11.442 execute Fluffy_Pillow 76.8/100: 77% rage
7:12.898 battle_cry Fluffy_Pillow 61.7/100: 62% rage
7:12.898 odyns_fury Fluffy_Pillow 61.7/100: 62% rage battle_cry
7:14.355 execute Fluffy_Pillow 61.7/100: 62% rage battle_cry
7:15.812 execute Fluffy_Pillow 43.3/100: 43% rage battle_cry
7:17.269 bloodthirst Fluffy_Pillow 18.3/100: 18% rage battle_cry
7:18.728 raging_blow Fluffy_Pillow 28.3/100: 28% rage enrage
7:20.186 execute Fluffy_Pillow 43.2/100: 43% rage enrage
7:21.643 bloodthirst Fluffy_Pillow 28.1/100: 28% rage
7:23.100 raging_blow Fluffy_Pillow 48.0/100: 48% rage enrage
7:24.556 execute Fluffy_Pillow 62.9/100: 63% rage enrage
7:26.014 bloodthirst Fluffy_Pillow 47.8/100: 48% rage
7:27.472 raging_blow Fluffy_Pillow 57.8/100: 58% rage

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 26359 24653 13252 (5432)
Agility 6581 6256 0
Stamina 34258 34258 19988
Intellect 5325 5000 0
Spirit 0 0 0
Health 2055480 2055480 0
Rage 100 100 0
Crit 19.61% 19.61% 4764
Haste 3.17% 3.17% 1029
Damage / Heal Versatility 10.59% 10.59% 4235
Attack Power 26359 24653 0
Mastery 48.30% 46.80% 8899
Armor 3930 3930 3930
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 841.00
Local Head Battlelord's Greathelm
ilevel: 830, stats: { 531 Armor, +1614 Sta, +1077 Str, +735 Mastery, +476 Vers }
Local Neck Raven Filigree Pendant
ilevel: 845, stats: { +1045 Sta, +1132 Vers, +669 Mastery }
Local Shoulders Coralplate Pauldrons
ilevel: 850, stats: { 512 Armor, +973 StrInt, +1459 Sta, +615 Mastery, +363 Vers }
Local Chest Skoldiir Breastplate
ilevel: 835, stats: { 660 Armor, +1128 StrInt, +1692 Sta, +776 Crit, +459 Mastery }
Local Waist Greatbelt of Disruption
ilevel: 850, stats: { 384 Armor, +973 StrInt, +1459 Sta, +594 Vers, +385 Mastery }, gems: { +150 Haste }
Local Legs Battlelord's Legplates
ilevel: 830, stats: { 571 Armor, +1614 Sta, +1077 Str, +813 Mastery, +398 Crit }
Local Feet Salt-Laden Stompers
ilevel: 840, stats: { 459 Armor, +1329 Sta, +886 StrInt, +572 Vers, +370 Crit }
Local Wrists Battlelord's Wristguards
ilevel: 820, stats: { 279 Armor, +827 Sta, +552 Str, +384 Haste, +271 Crit }
Local Hands Valarsmidd Gauntlets of the Quickblade
ilevel: 830, stats: { 408 Armor, +807 StrInt, +1211 Sta, +649 Crit, +259 Vers }
Local Finger1 Braided Silver Ring
ilevel: 850, stats: { +1094 Sta, +997 Mastery, +839 Vers }
Local Finger2 Signet of the Highborne Magi
ilevel: 845, stats: { +1045 Sta, +1132 Mastery, +669 Crit }
Local Trinket1 An'she's Invigoring Charm
ilevel: 830, stats: { +1023 Str, +865 Mastery }
Local Trinket2 Brulstone Idol
ilevel: 830, stats: { +1023 Str, +865 Mastery }
Local Back Goldscar Pelt
ilevel: 840, stats: { 126 Armor, +665 StrAgiInt, +997 Sta, +211 Crit, +495 Haste }
Local Main Hand Warswords of the Valarjar
ilevel: 868, weapon: { 7937 - 11907, 3.6 }, stats: { +1534 Str, +2301 Sta, +710 Crit, +682 Mastery }, relics: { +37 ilevels, +39 ilevels, +42 ilevels }
Local Off Hand Warswords of the Valarjar
ilevel: 868, weapon: { 7937 - 11907, 3.6 }, stats: { +1534 Str, +2301 Sta, +710 Crit, +682 Mastery }

Talents

Level
15 War Machine (Fury Warrior) Endless Rage (Fury Warrior) Fresh Meat (Fury Warrior)
30 Shockwave (Fury Warrior) Storm Bolt (Fury Warrior) Double Time
45 Wrecking Ball (Fury Warrior) Outburst Avatar
60 Furious Charge (Fury Warrior) Bounding Stride Warpaint (Fury Warrior)
75 Massacre (Fury Warrior) Frothing Berserker (Fury Warrior) Carnage (Fury Warrior)
90 Bloodbath (Fury Warrior) Frenzy (Fury Warrior) Inner Rage (Fury Warrior)
100 Bladestorm (Fury Warrior) Reckless Abandon (Fury Warrior) Dragon Roar (Fury Warrior)

Profile

warrior="Ulthuan"
origin="https://eu.api.battle.net/wow/character/hyjal/Ulthuan/advanced"
thumbnail="http://eu.battle.net/static-render/eu/hyjal/244/114747892-avatar.jpg"
level=110
race=night_elf
timeofday=day
role=attack
position=back
professions=blacksmithing=761/mining=514
talents=http://eu.battle.net/wow/en/tool/talent-calculator#ZZ!1122220
artifact=35:0:0:0:0:984:1:985:1:990:1:991:3:995:3:996:3:1357:1
spec=fury

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=countless_armies
actions.precombat+=/food,type=nightborne_delicacy_platter
actions.precombat+=/augmentation,type=defiled
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=deadly_grace

# Executed every time the actor is available.
actions=auto_attack
actions+=/charge
# This is mostly to prevent cooldowns from being accidentally used during movement.
actions+=/run_action_list,name=movement,if=movement.distance>5
actions+=/heroic_leap,if=(raid_event.movement.distance>25&raid_event.movement.in>45)|!raid_event.movement.exists
actions+=/potion,name=deadly_grace,if=(target.health.pct<20&buff.battle_cry.up)|target.time_to_die<30
actions+=/battle_cry,if=(artifact.odyns_fury.enabled&cooldown.odyns_fury.remains=0&(cooldown.bloodthirst.remains=0|(buff.enrage.remains>cooldown.bloodthirst.remains)))|!artifact.odyns_fury.enabled
actions+=/avatar,if=buff.battle_cry.up|(target.time_to_die<(cooldown.battle_cry.remains+10))
actions+=/bloodbath,if=buff.dragon_roar.up|(!talent.dragon_roar.enabled&(buff.battle_cry.up|cooldown.battle_cry.remains>10))
actions+=/blood_fury,if=buff.battle_cry.up
actions+=/berserking,if=buff.battle_cry.up
actions+=/arcane_torrent,if=rage<rage.max-40
actions+=/call_action_list,name=two_targets,if=spell_targets.whirlwind=2|spell_targets.whirlwind=3
actions+=/call_action_list,name=aoe,if=spell_targets.whirlwind>3
actions+=/call_action_list,name=single_target

actions.movement=heroic_leap

actions.single_target=odyns_fury,if=buff.battle_cry.up|target.time_to_die<cooldown.battle_cry.remains
actions.single_target+=/execute,if=artifact.juggernaut.enabled&(!buff.juggernaut.up|buff.juggernaut.remains<2)
actions.single_target+=/berserker_rage,if=talent.outburst.enabled&cooldown.dragon_roar.remains=0&buff.enrage.down
actions.single_target+=/rampage,if=rage>95|buff.massacre.react
actions.single_target+=/whirlwind,if=!talent.inner_rage.enabled&buff.wrecking_ball.react
actions.single_target+=/raging_blow,if=buff.enrage.up
actions.single_target+=/whirlwind,if=buff.wrecking_ball.react&buff.enrage.up
actions.single_target+=/execute,if=buff.enrage.up|buff.battle_cry.up|buff.stone_heart.react||(buff.juggernaut.up&buff.juggernaut.remains<3)
actions.single_target+=/bloodthirst
actions.single_target+=/raging_blow
actions.single_target+=/dragon_roar,if=!talent.bloodbath.enabled&(cooldown.battle_cry.remains<1|cooldown.battle_cry.remains>10)|talent.bloodbath.enabled&cooldown.bloodbath.remains=0
actions.single_target+=/rampage,if=(target.health.pct>20&(cooldown.battle_cry.remains>3|buff.battle_cry.up|rage>90))
actions.single_target+=/execute,if=rage>50|buff.battle_cry.up|buff.stone_heart.react|target.time_to_die<20
actions.single_target+=/furious_slash

actions.two_targets=whirlwind,if=buff.meat_cleaver.down
actions.two_targets+=/call_action_list,name=bladestorm
actions.two_targets+=/rampage,if=buff.enrage.down|(rage=100&buff.juggernaut.down)|buff.massacre.up
actions.two_targets+=/bloodthirst,if=buff.enrage.down
actions.two_targets+=/raging_blow,if=talent.inner_rage.enabled&spell_targets.whirlwind=2
actions.two_targets+=/whirlwind,if=spell_targets.whirlwind>2
actions.two_targets+=/dragon_roar
actions.two_targets+=/bloodthirst
actions.two_targets+=/whirlwind

actions.aoe=bloodthirst,if=buff.enrage.down|rage<50
actions.aoe+=/call_action_list,name=bladestorm
actions.aoe+=/whirlwind,if=buff.enrage.up
actions.aoe+=/dragon_roar
actions.aoe+=/rampage,if=buff.meat_cleaver.up
actions.aoe+=/bloodthirst
actions.aoe+=/whirlwind

actions.bladestorm=bladestorm,if=buff.enrage.remains>2&(raid_event.adds.in>90|!raid_event.adds.exists|spell_targets.bladestorm_mh>desired_targets)

head=battlelords_greathelm,id=139684,bonus_id=3385/3383
neck=raven_filigree_pendant,id=134499,bonus_id=1727/1497/3336
shoulders=coralplate_pauldrons,id=134228,bonus_id=3432/1512/3337
back=goldscar_pelt,id=133639,bonus_id=1727/1492/1813
chest=skoldiir_breastplate,id=134179,bonus_id=3432/1497/1674
wrists=battlelords_wristguards,id=139688,bonus_id=3385/3382
hands=valarsmidd_gauntlets,id=121112,bonus_id=3396/1676/1622/3339
waist=greatbelt_of_disruption,id=137310,bonus_id=1727/1808/1502/3336,gems=150haste
legs=battlelords_legplates,id=139685,bonus_id=3386/3383
feet=saltladen_stompers,id=137334,bonus_id=1727/1492/1813
finger1=braided_silver_ring,id=134539,bonus_id=1727/1502/3336
finger2=signet_of_the_highborne_magi,id=134537,bonus_id=1727/1497/3336
trinket1=anshes_invigoring_charm,id=139102,bonus_id=3397/605/1492/1675
trinket2=brulstone_idol,id=134146,bonus_id=3397/605/1492/1675
main_hand=warswords_of_the_valarjar,id=128908,bonus_id=751,gem_id=141261/141258/141268/0,relic_id=3397:1492:1675/3432:1497:1674/3397:1507:3337/0
off_hand=warswords_of_the_valarjar,id=134553

# Gear Summary
# gear_ilvl=841.31
# gear_strength=13252
# gear_stamina=19988
# gear_crit_rating=4764
# gear_haste_rating=1029
# gear_mastery_rating=8899
# gear_versatility_rating=4235
# gear_armor=3930
# set_bonus=tier19oh_2pc=1

Ylvi

Ylvi : 13281 dps, 71822 dtps, 3954 hps (3954 aps), 181.8k TMI, 182.3k ETMI

  • Race: Dwarf
  • Class: Warrior
  • Spec: Protection
  • Level: 100
  • Role: Tank
  • Position: front

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR APS APS Error APS Range APR
13281.1 13281.1 13.0 / 0.098% 2590.5 / 19.5% 2936.2 3953.8 12.78 / 0.32% 921 / 23.3% 0.0
DTPS DTPS Error DTPS Range   TMI TMI Error TMI Min TMI Max TMI Range   MSD Mean MSD Min MSD Max MSD Freq.   Window Bin Size
71821.9 30.80 / 0.04% 6231 / 8.7%       181.8k 201 / 0.11% 152.0k 215.2k 37.4k / 20.6%       167.1% 127.3% 210.6% 3.0       6.00s 0.50s
RPS Out RPS In Primary Resource Waiting APM Active Skill
4.5 4.5 Rage 0.00% 66.6 100.0% 100%
Origin https://eu.api.battle.net/wow/character/hyjal/Ylvi/advanced
Talents
  • 15: Shockwave (Protection Warrior)
  • 30: Inspiring Presence (Protection Warrior)
  • 45: Ultimatum (Protection Warrior)
  • 60: Bounding Stride
  • 75: Indomitable (Protection Warrior)
  • 90: Vengeance (Protection Warrior)
  • 100: Heavy Repercussions (Protection Warrior)
  • Talent Calculator
Professions
  • mining: 685
  • jewelcrafting: 700

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% G% B% Up%
Ylvi 13281
auto_attack_mh 96 0.7% 198.1 2.28sec 219 97

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 198.06 198.06 0.00 0.00 2.2684 0.0000 43366.61 91244.45 52.47 96.53 96.53
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
glance 89.03 44.95% 405.01 386 509 405.11 395 420 36060 70761 49.04
glance (blocked) 25.77 13.01% 283.54 270 356 283.60 272 309 7307 20483 64.33
parry 29.78 15.03% 0.00 0 0 0.00 0 0 0 0 0.00
dodge 23.80 12.02% 0.00 0 0 0.00 0 0 0 0 0.00
miss 29.68 14.98% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Deep Wounds 3673 27.7% 157.5 2.86sec 10501 0 Periodic 147.8 8617 17651 11196 28.5% 0.0% 0.0% 0.0% 98.0%

Stats details: deep_wounds

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 157.54 66.19 147.76 147.76 0.0000 2.9886 1654244.25 1654244.25 0.00 3746.13 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
parry 23.69 35.79% 0.00 0 0 0.00 0 0 0 0 0.00
dodge 18.91 28.57% 0.00 0 0 0.00 0 0 0 0 0.00
miss 23.59 35.64% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 105.6 71.45% 8616.55 3 11438 8618.51 8314 8974 909696 909696 0.00
crit 42.2 28.55% 17650.96 11 23334 17656.62 16641 18745 744548 744548 0.00
 
 

Action details: deep_wounds

Static Values
  • id:115767
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:115767
  • name:Deep Wounds
  • school:physical
  • tooltip:Bleeding for $w1 every $t1 sec.
  • description:{$@spelldesc115768=Your Devastate and Revenge also cause $115767o1 Bleed damage over {$115767d=15 seconds}.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:1.050000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Devastate 3995 30.1% 228.1 1.97sec 7882 5886 Direct 228.1 10401 21377 7882 16.9% 42.0% 0.0% 13.0%  

Stats details: devastate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 228.15 228.15 0.00 0.00 1.3391 0.0000 1798375.18 3783981.46 52.47 5886.35 5886.35
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 72.62 31.83% 11153.48 10651 14001 11155.88 10859 11644 810005 1589494 49.04
hit (blocked) 21.07 9.23% 7807.08 7456 9800 7809.00 7498 8429 164481 461094 64.33
crit 29.89 13.10% 22919.90 21729 28561 22928.92 21970 24348 685181 1344549 49.04
crit (blocked) 8.65 3.79% 16041.75 15210 19993 16040.58 0 18710 138708 388844 64.30
parry 34.28 15.02% 0.00 0 0 0.00 0 0 0 0 0.00
dodge 27.43 12.02% 0.00 0 0 0.00 0 0 0 0 0.00
miss 34.21 14.99% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: devastate

Static Values
  • id:20243
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20243
  • name:Devastate
  • school:physical
  • tooltip:
  • description:A direct strike, dealing $sw1 Physical damage. {$s3=30}% chance to reset the remaining cooldown on Shield Slam.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.09
 
Fel Burn 474 3.6% 28.9 15.86sec 7384 0 Periodic 246.8 669 1345 864 28.8% 0.0% 0.0% 0.0% 54.8%

Stats details: fel_burn

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.88 12.13 246.81 246.81 0.0000 1.0000 213243.79 213243.79 0.00 863.99 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
parry 4.30 35.44% 0.00 0 0 0.00 0 0 0 0 0.00
dodge 3.48 28.72% 0.00 0 0 0.00 0 0 0 0 0.00
miss 4.35 35.84% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 175.7 71.19% 669.47 107 2360 669.77 512 830 117633 117633 0.00
crit 71.1 28.81% 1344.56 219 4595 1344.38 890 1812 95611 95611 0.00
 
 

Action details: fel_burn

Static Values
  • id:184256
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:184256
  • name:Fel Burn
  • school:fire
  • tooltip:Burning for $w1 Fire damage every $t1 sec. Successive attacks add stacks but do not refresh duration.
  • description:{$@spelldesc184257=Your attacks cause the target to burn for $184256o1 Fire damage over {$184256d=15 seconds}. Successive attacks do not refresh Fel Burn's duration, but instead add an additional stack of Fel Burn.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:101.43
  • dot_duration:15.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Revenge 1097 8.3% 43.5 10.29sec 11354 8467 Direct 43.5 14795 30539 11354 17.5% 41.8% 0.0% 13.1%  

Stats details: revenge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.50 43.50 0.00 0.00 1.3410 0.0000 493969.40 1039775.82 52.49 8467.37 8467.37
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.70 31.49% 15872.97 15007 20982 15876.96 15061 17598 217482 426770 49.04
hit (blocked) 4.00 9.20% 11107.54 10505 14688 10880.73 0 14688 44480 124691 62.99
crit 5.88 13.52% 32757.16 30615 42804 32728.39 0 42804 192723 378185 48.95
crit (blocked) 1.71 3.94% 22922.54 21431 29963 18872.74 0 29963 39286 110131 52.94
parry 6.52 14.98% 0.00 0 0 0.00 0 0 0 0 0.00
dodge 5.18 11.90% 0.00 0 0 0.00 0 0 0 0 0.00
miss 6.51 14.96% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: revenge

Static Values
  • id:6572
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:cooldown.shield_slam.remains<=gcd.max*2
Spelldata
  • id:6572
  • name:Revenge
  • school:physical
  • tooltip:
  • description:Swing in a wide arc, dealing {$s1=1} damage to all enemies in front of you. Your successful dodges and parries reset the remaining cooldown on Revenge up to once per $5302m1 sec. |cFFFFFFFFGenerates {$/10;s2=5} Rage.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:3.780000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Shield Slam 3946 29.7% 64.7 7.02sec 27423 20522 Direct 64.7 35246 72976 27423 18.6% 42.1% 0.0% 13.0%  

Stats details: shield_slam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 64.74 64.74 0.00 0.00 1.3363 0.0000 1775258.34 3734374.96 52.46 20521.79 20521.79
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.77 30.53% 37789.31 21737 79017 37817.17 30735 45400 746969 1465797 49.04
hit (blocked) 5.73 8.85% 26472.63 15216 55312 26383.98 0 41484 151696 425252 64.05
crit 9.34 14.42% 78195.98 44343 155648 78081.95 52021 102970 730146 1432785 49.04
crit (blocked) 2.67 4.13% 54751.34 31040 112836 51100.87 0 96106 146448 410541 60.07
parry 9.73 15.03% 0.00 0 0 0.00 0 0 0 0 0.00
dodge 7.77 12.00% 0.00 0 0 0.00 0 0 0 0 0.00
miss 9.73 15.03% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: shield_slam

Static Values
  • id:23922
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!(cooldown.shield_block.remains<=gcd.max*2&!buff.shield_block.up&talent.heavy_repercussions.enabled)
Spelldata
  • id:23922
  • name:Shield Slam
  • school:physical
  • tooltip:
  • description:Slams the target with your shield, causing {$s1=1} Physical damage. |cFFFFFFFFGenerates {$/10;s3=15} Rage.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:5.475000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Simple Action Stats Execute Interval
Ylvi
Battle Cry 7.8 61.76sec

Stats details: battle_cry

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.78 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: battle_cry

Static Values
  • id:1719
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.vengeance.enabled&talent.ultimatum.enabled&cooldown.shield_slam.remains<=5-gcd.max-0.5)|!talent.vengeance.enabled
Spelldata
  • id:1719
  • name:Battle Cry
  • school:physical
  • tooltip:Critical strike chance increased by $w1%.
  • description:Lets loose a battle cry, granting {$s1=100}% increased critical strike chance for {$d=5 seconds}.$?a202751[ |cFFFFFFFFGenerates ${{$202751s2=1000}/10} Rage.|r][]
 
Demoralizing Shout 5.4 91.08sec

Stats details: demoralizing_shout

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.36 2.25 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
parry 0.80 35.67% 0.00 0 0 0.00 0 0 0 0 0.00
dodge 0.64 28.36% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.81 35.97% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: demoralizing_shout

Static Values
  • id:1160
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:incoming_damage_2500ms>health.max*0.20
Spelldata
  • id:1160
  • name:Demoralizing Shout
  • school:physical
  • tooltip:{$?s199023=false}[Demoralized, dealing {$s1=20}% less damage.][Demoralized, dealing {$s1=20}% less damage to the shouting Warrior.]
  • description:{$?s199023=false}[Demoralizes all enemies within $A2 yards, reducing the damage they do by {$s1=20}% for {$d=8 seconds}.][Demoralizes all enemies within $A2 yards, reducing the damage they do to you by {$s1=20}% for {$d=8 seconds}.]{$?s202743=false}[ |cFFFFFFFFGenerates ${$m5/10} Rage.|r][]
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Ylvi
  • harmful:false
  • if_expr:
 
Focused Rage 36.3 12.45sec

Stats details: focused_rage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.32 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: focused_rage

Static Values
  • id:204488
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:1.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.vengeance_focused_rage.up&!buff.vengeance_ignore_pain.up)|(buff.ultimatum.up&buff.vengeance_focused_rage.up&!buff.vengeance_ignore_pain.up)|(talent.vengeance.enabled&buff.ultimatum.up&!buff.vengeance_ignore_pain.up&!buff.vengeance_focused_rage.up)|(talent.vengeance.enabled&!buff.vengeance_ignore_pain.up&!buff.vengeance_focused_rage.up&rage>=30)|(buff.ultimatum.up&buff.vengeance_ignore_pain.up&cooldown.shield_slam.remains=0&rage<10)|(rage>=100)
Spelldata
  • id:204488
  • name:Focused Rage
  • school:physical
  • tooltip:Shield Slam deals {$s1=50}% increased damage.
  • description:Focus your rage on your next Shield Slam, increasing its damage by {$s1=50}%, stacking up to {$u=3} times. Unaffected by the global cooldown
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Ylvi
  • harmful:false
  • if_expr:
 
Intercept 22.4 20.61sec

Stats details: intercept

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.36 9.35 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
parry 3.32 35.52% 0.00 0 0 0.00 0 0 0 0 0.00
dodge 2.65 28.36% 0.00 0 0 0.00 0 0 0 0 0.00
miss 3.38 36.12% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: intercept

Static Values
  • id:198304
  • school:physical
  • resource:none
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:198304
  • name:Intercept
  • school:physical
  • tooltip:
  • description:Run at high speed toward an ally or enemy. When targeting an enemy, Intercept will root for {$105771d=1.500 seconds}, but has a minimum range of {$s1=8} yds. When targeting an ally, Intercept will intercept the next melee or ranged attack against the ally within {$147833d=10 seconds} while the target remains within $147833A2 yards. |cFFFFFFFFGenerates {$/10;s2=20} Rage.|r
 
Last Stand 4.9 97.09sec

Stats details: last_stand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.91 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: last_stand

Static Values
  • id:12975
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:incoming_damage_2500ms>health.max*0.50&!cooldown.shield_wall.remains=0
Spelldata
  • id:12975
  • name:Last Stand
  • school:physical
  • tooltip:Maximum health increased by {$s1=30}%.
  • description:Increases current and maximum health by {$s1=30}% for {$d=15 seconds}.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Shield Block 39.9 11.66sec

Stats details: shield_block

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.94 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shield_block

Static Values
  • id:2565
  • school:physical
  • resource:rage
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:0.0
  • cooldown:13.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!buff.neltharions_fury.up&((cooldown.shield_slam.remains<6&!buff.shield_block.up)|(cooldown.shield_slam.remains<6+buff.shield_block.remains&buff.shield_block.up))
Spelldata
  • id:2565
  • name:Shield Block
  • school:physical
  • tooltip:
  • description:Raise your shield, blocking every melee attack against you for {$132404d=6 seconds}. These blocks can be critical blocks. Increases Shield Slam damage by {$132404s2=30}% while active.
 
Shield Block (_heavy_repercussions) 61.1 7.44sec

Stats details: shield_block_heavy_repercussions

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.07 25.62 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
parry 9.13 35.65% 0.00 0 0 0.00 0 0 0 0 0.00
dodge 7.33 28.63% 0.00 0 0 0.00 0 0 0 0 0.00
miss 9.15 35.71% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: shield_block_heavy_repercussions

Static Values
  • id:2565
  • school:physical
  • resource:rage
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2565
  • name:Shield Block
  • school:physical
  • tooltip:
  • description:Raise your shield, blocking every melee attack against you for {$132404d=6 seconds}. These blocks can be critical blocks. Increases Shield Slam damage by {$132404s2=30}% while active.
 
Shield Wall 2.2 246.58sec

Stats details: shield_wall

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.17 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shield_wall

Static Values
  • id:871
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:240.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:incoming_damage_2500ms>health.max*0.50
Spelldata
  • id:871
  • name:Shield Wall
  • school:physical
  • tooltip:All damage taken reduced by $w1%.
  • description:Reduces all damage you take by {$s1=40}% for {$d=8 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Archmage's Greater Incandescence (_str) 7.7 0.0 53.3sec 53.1sec 16.81% 16.87% 0.0(0.0) 7.5

Buff details

  • buff initial source:Ylvi
  • cooldown name:buff_archmages_greater_incandescence_str
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • archmages_greater_incandescence_str_1:16.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:177175
  • name:Archmage's Greater Incandescence
  • tooltip:Increases Strength by 15% for {$d=10 seconds}.
  • description:Increases Strength by 15% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Cry 7.8 0.0 61.8sec 61.8sec 8.59% 8.65% 0.0(0.0) 7.7

Buff details

  • buff initial source:Ylvi
  • cooldown name:buff_battle_cry
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • battle_cry_1:8.59%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1719
  • name:Battle Cry
  • tooltip:Critical strike chance increased by $w1%.
  • description:Lets loose a battle cry, granting {$s1=100}% increased critical strike chance for {$d=5 seconds}.$?a202751[ |cFFFFFFFFGenerates ${{$202751s2=1000}/10} Rage.|r][]
  • max_stacks:0
  • duration:5.00
  • cooldown:60.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 11.35% 0.0(0.0) 1.0

Buff details

  • buff initial source:Ylvi
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bulwark of Purity 8.0 0.0 60.6sec 60.5sec 4.30% 66.81% 0.0(0.0) 0.0

Buff details

  • buff initial source:Ylvi
  • cooldown name:buff_bulwark_of_purity
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:150715.00

Stack Uptimes

  • bulwark_of_purity_1:4.30%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201414
  • name:Bulwark of Purity
  • tooltip:Absorbing {$s1=56115} damage from Demons.
  • description:Gain a shield that absorbs {$s1=56115} damage for {$d=20 seconds}. The shield is {$s2=100}% more effective if your attacker is a Demon, and the shield's strength is improved by Resolve.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Demoralizing Shout 5.4 0.0 91.1sec 91.1sec 9.46% 9.52% 0.0(0.0) 5.3

Buff details

  • buff initial source:Ylvi
  • cooldown name:buff_demoralizing_shout
  • max_stacks:1
  • duration:8.00
  • cooldown:90.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • demoralizing_shout_1:9.46%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1160
  • name:Demoralizing Shout
  • tooltip:{$?s199023=false}[Demoralized, dealing {$s1=20}% less damage.][Demoralized, dealing {$s1=20}% less damage to the shouting Warrior.]
  • description:{$?s199023=false}[Demoralizes all enemies within $A2 yards, reducing the damage they do by {$s1=20}% for {$d=8 seconds}.][Demoralizes all enemies within $A2 yards, reducing the damage they do to you by {$s1=20}% for {$d=8 seconds}.]{$?s202743=false}[ |cFFFFFFFFGenerates ${$m5/10} Rage.|r][]
  • max_stacks:0
  • duration:8.00
  • cooldown:90.00
  • default_chance:101.00%
Draenic Strength Potion 2.0 0.0 58.3sec 0.0sec 10.83% 10.89% 0.0(0.0) 2.0

Buff details

  • buff initial source:Ylvi
  • cooldown name:buff_draenic_strength_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:strength
  • amount:1000.00

Stack Uptimes

  • draenic_strength_potion_1:10.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156428
  • name:Draenic Strength Potion
  • tooltip:Strength increased by {$s1=1000}.
  • description:Increases your Strength by {$s1=1000} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Focused Rage 36.2 0.2 12.5sec 12.4sec 39.72% 33.83% 0.0(0.0) 0.0

Buff details

  • buff initial source:Ylvi
  • cooldown name:buff_focused_rage
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • focused_rage_1:39.64%
  • focused_rage_2:0.08%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:204488
  • name:Focused Rage
  • tooltip:Shield Slam deals {$s1=50}% increased damage.
  • description:Focus your rage on your next Shield Slam, increasing its damage by {$s1=50}%, stacking up to {$u=3} times. Unaffected by the global cooldown
  • max_stacks:3
  • duration:30.00
  • cooldown:1.50
  • default_chance:100.00%
Ignore Pain 34.9 0.0 12.9sec 12.9sec 8.31% 8.32% 0.0(0.0) 0.0

Buff details

  • buff initial source:Ylvi
  • cooldown name:buff_ignore_pain
  • max_stacks:1
  • duration:15.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ignore_pain_1:8.31%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190456
  • name:Ignore Pain
  • tooltip:Ignoring {$s2=90}% of the next ${$w1*10/9} total damage that you take, from any sources.
  • description:Fight through the pain, ignoring {$s2=90}% of the next up to ${($m1/10)*$AP*(1+$@versadmg)} damage you take from any sources, based on Rage spent.
  • max_stacks:0
  • duration:15.00
  • cooldown:1.00
  • default_chance:0.00%
Last Stand 4.9 0.0 97.1sec 97.1sec 16.10% 16.16% 0.0(0.0) 4.8

Buff details

  • buff initial source:Ylvi
  • cooldown name:buff_last_stand
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • last_stand_1:16.10%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:12975
  • name:Last Stand
  • tooltip:Maximum health increased by {$s1=30}%.
  • description:Increases current and maximum health by {$s1=30}% for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Mark of Bleeding Hollow 12.8 6.9 35.3sec 22.3sec 42.35% 42.39% 6.9(6.9) 12.3

Buff details

  • buff initial source:Ylvi
  • cooldown name:buff_mark_of_bleeding_hollow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:500.00

Stack Uptimes

  • mark_of_bleeding_hollow_1:42.35%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173322
  • name:Mark of Bleeding Hollow
  • tooltip:Mastery increased by $w1.
  • description:Mastery increased by {$s1=500}.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Shield Block 27.8 0.0 16.5sec 15.0sec 73.00% 56.85% 0.0(0.0) 27.1

Buff details

  • buff initial source:Ylvi
  • cooldown name:buff_shield_block
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • shield_block_1:73.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:132404
  • name:Shield Block
  • tooltip:Block chance increased by {$s1=100}%.
  • description:{$@spelldesc2565=Raise your shield, blocking every melee attack against you for {$132404d=6 seconds}. These blocks can be critical blocks. Increases Shield Slam damage by {$132404s2=30}% while active.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Shield Wall 2.2 0.0 246.6sec 246.6sec 3.84% 4.45% 0.0(0.0) 2.1

Buff details

  • buff initial source:Ylvi
  • cooldown name:buff_shield_wall
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.40

Stack Uptimes

  • shield_wall_1:3.84%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:871
  • name:Shield Wall
  • tooltip:All damage taken reduced by $w1%.
  • description:Reduces all damage you take by {$s1=40}% for {$d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:240.00
  • default_chance:0.00%
Ultimatum 12.0 0.0 36.4sec 36.8sec 3.63% 3.67% 0.0(0.0) 0.0

Buff details

  • buff initial source:Ylvi
  • cooldown name:buff_ultimatum
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • ultimatum_1:3.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:122510
  • name:Ultimatum
  • tooltip:Your next Focused Rage costs no Rage.
  • description:{$@spelldesc122509=Your Shield Slam critical strikes cause your next Focused Rage to cost no Rage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Vengeance: Focused Rage 35.0 0.0 12.9sec 12.9sec 35.58% 35.61% 0.0(0.0) 0.4

Buff details

  • buff initial source:Ylvi
  • cooldown name:buff_vengeance_focused_rage
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.50

Stack Uptimes

  • vengeance_focused_rage_1:35.58%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202573
  • name:Vengeance: Focused Rage
  • tooltip:Rage cost of Focused Rage reduced by {$s1=50}%.
  • description:{$@spelldesc202572=Ignore Pain reduces the Rage cost of your next Focused Rage by {$202573s1=50}%, and Focused Rage reduces the Rage cost of your next Ignore Pain by {$202574s1=50}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Vengeance: Ignore Pain 36.3 0.0 12.4sec 12.4sec 63.37% 52.05% 0.0(0.0) 2.1

Buff details

  • buff initial source:Ylvi
  • cooldown name:buff_vengeance_ignore_pain
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.50

Stack Uptimes

  • vengeance_ignore_pain_1:63.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202574
  • name:Vengeance: Ignore Pain
  • tooltip:Rage cost of Ignore Pain reduced by {$s1=50}%.
  • description:{$@spelldesc202572=Ignore Pain reduces the Rage cost of your next Focused Rage by {$202573s1=50}%, and Focused Rage reduces the Rage cost of your next Ignore Pain by {$202574s1=50}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Well Fed (buttered_sturgeon)

Buff details

  • buff initial source:Ylvi
  • cooldown name:buff_buttered_sturgeon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:125.00

Stack Uptimes

  • buttered_sturgeon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:180748
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=125} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Greater Draenic Strength Flask

Buff details

  • buff initial source:Ylvi
  • cooldown name:buff_greater_draenic_strength_flask
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:strength
  • amount:250.00

Stack Uptimes

  • greater_draenic_strength_flask_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156080
  • name:Greater Draenic Strength Flask
  • tooltip:Strength increased by $w1.
  • description:Increases Strength by {$s1=250} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Intercept0.6040.0971.10712.9079.45417.122
Shield Block1.0470.0028.5050.2210.0008.505
Ignore Pain11.8700.05642.990403.491294.798508.162
Focused Rage11.1140.00138.495392.470291.255491.949
Demoralizing Shout1.1730.02311.9504.8010.84016.931
Shield Wall6.8710.00246.2587.6730.00046.258
Last Stand7.1370.00148.82827.7681.98682.350
Battle Cry1.8520.0015.27812.2252.13430.661
Shield Slam1.3890.00119.36787.71842.233139.801
Revenge2.7520.00147.024116.96046.517208.965

Resources

Resource Usage Type Count Total Average RPE APR
Ylvi
focused_rage Rage 36.3 384.2 10.6 10.6 0.0
ignore_pain Rage 35.0 1257.1 35.9 18.0 1415.8
shield_block Rage 39.9 399.4 10.0 10.0 0.0
Resource Gains Type Count Total Average Overflow
intercept Rage 22.36 447.16 (21.82%) 20.00 0.00 0.00%
ignore_pain Health 34.99 1779780.82 (100.00%) 50863.81 0.00 0.00%
shield_slam Rage 64.74 971.07 (47.39%) 15.00 0.00 0.00%
revenge Rage 43.50 217.52 (10.61%) 5.00 0.00 0.00%
melee_main_hand Rage 114.80 413.30 (20.17%) 3.60 0.00 0.00%
rage_from_damage_taken Rage 351.61 0.18 (0.01%) 0.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Health 4262.21 71851.18
Rage 4.55 4.52
Combat End Resource Mean Min Max
Rage 13.03 0.00 48.00

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval
parry_haste 9.3 43.1sec

Statistics & Data Analysis

Fight Length
Sample Data Ylvi Fight Length
Count 9999
Mean 450.42
Minimum 350.15
Maximum 555.44
Spread ( max - min ) 205.29
Range [ ( max - min ) / 2 * 100% ] 22.79%
DPS
Sample Data Ylvi Damage Per Second
Count 9999
Mean 13281.14
Minimum 10978.36
Maximum 16178.51
Spread ( max - min ) 5200.15
Range [ ( max - min ) / 2 * 100% ] 19.58%
Standard Deviation 663.7514
5th Percentile 12221.07
95th Percentile 14400.88
( 95th Percentile - 5th Percentile ) 2179.80
Mean Distribution
Standard Deviation 6.6378
95.00% Confidence Intervall ( 13268.13 - 13294.15 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 95
0.1% Error 9594
0.1 Scale Factor Error with Delta=300 3760
0.05 Scale Factor Error with Delta=300 15043
0.01 Scale Factor Error with Delta=300 376092
Priority Target DPS
Sample Data Ylvi Priority Target Damage Per Second
Count 9999
Mean 13281.14
Minimum 10978.36
Maximum 16178.51
Spread ( max - min ) 5200.15
Range [ ( max - min ) / 2 * 100% ] 19.58%
Standard Deviation 663.7514
5th Percentile 12221.07
95th Percentile 14400.88
( 95th Percentile - 5th Percentile ) 2179.80
Mean Distribution
Standard Deviation 6.6378
95.00% Confidence Intervall ( 13268.13 - 13294.15 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 95
0.1% Error 9594
0.1 Scale Factor Error with Delta=300 3760
0.05 Scale Factor Error with Delta=300 15043
0.01 Scale Factor Error with Delta=300 376092
DPS(e)
Sample Data Ylvi Damage Per Second (Effective)
Count 9999
Mean 13281.14
Minimum 10978.36
Maximum 16178.51
Spread ( max - min ) 5200.15
Range [ ( max - min ) / 2 * 100% ] 19.58%
Damage
Sample Data Ylvi Damage
Count 9999
Mean 5978457.57
Minimum 4100709.68
Maximum 8259415.16
Spread ( max - min ) 4158705.49
Range [ ( max - min ) / 2 * 100% ] 34.78%
DTPS
Sample Data Ylvi Damage Taken Per Second
Count 9999
Mean 71821.86
Minimum 65199.11
Maximum 77488.34
Spread ( max - min ) 12289.23
Range [ ( max - min ) / 2 * 100% ] 8.56%
Standard Deviation 1571.3493
5th Percentile 69183.71
95th Percentile 74343.21
( 95th Percentile - 5th Percentile ) 5159.50
Mean Distribution
Standard Deviation 15.7143
95.00% Confidence Intervall ( 71791.06 - 71852.66 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 18
0.1% Error 1838
0.1 Scale Factor Error with Delta=300 21077
0.05 Scale Factor Error with Delta=300 84311
0.01 Scale Factor Error with Delta=300 2107798
HPS
Sample Data Ylvi Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Ylvi Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Ylvi Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Ylvi Healing Taken Per Second
Count 9999
Mean 2524.83
Minimum 1950.25
Maximum 3604.36
Spread ( max - min ) 1654.11
Range [ ( max - min ) / 2 * 100% ] 32.76%
TMI
Sample Data Ylvi Theck-Meloree Index
Count 9999
Mean 181828.75
Minimum 151994.70
Maximum 215164.08
Spread ( max - min ) 63169.38
Range [ ( max - min ) / 2 * 100% ] 17.37%
Standard Deviation 10270.1512
5th Percentile 166395.07
95th Percentile 198776.63
( 95th Percentile - 5th Percentile ) 32381.57
Mean Distribution
Standard Deviation 102.7066
95.00% Confidence Intervall ( 181627.45 - 182030.05 )
Normalized 95.00% Confidence Intervall ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 122
0.1% Error 12255
0.1 Scale Factor Error with Delta=300 900403
0.05 Scale Factor Error with Delta=300 3601615
0.01 Scale Factor Error with Delta=300 90040384
ETMI
Sample Data YlviTheck-Meloree Index (Effective)
Count 9999
Mean 182255.39
Minimum 154271.71
Maximum 215104.73
Spread ( max - min ) 60833.02
Range [ ( max - min ) / 2 * 100% ] 16.69%
Standard Deviation 9797.4803
5th Percentile 167052.10
95th Percentile 198402.87
( 95th Percentile - 5th Percentile ) 31350.78
Mean Distribution
Standard Deviation 97.9797
95.00% Confidence Intervall ( 182063.35 - 182447.43 )
Normalized 95.00% Confidence Intervall ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 111
0.1% Error 11101
0.1 Scale Factor Error with Delta=300 819431
0.05 Scale Factor Error with Delta=300 3277724
0.01 Scale Factor Error with Delta=300 81943115
MSD
Sample Data Ylvi Max Spike Value
Count 1247
Mean 167.06
Minimum 127.31
Maximum 210.64
Spread ( max - min ) 83.33
Range [ ( max - min ) / 2 * 100% ] 24.94%
Standard Deviation 14.3986
5th Percentile 143.59
95th Percentile 190.88
( 95th Percentile - 5th Percentile ) 47.30
Mean Distribution
Standard Deviation 0.4077
95.00% Confidence Intervall ( 166.27 - 167.86 )
Normalized 95.00% Confidence Intervall ( 99.52% - 100.48% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 285
0.1% Error 28534
0.1 Scale Factor Error with Delta=300 1
0.05 Scale Factor Error with Delta=300 7
0.01 Scale Factor Error with Delta=300 176

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=greater_draenic_strength_flask
1 0.00 food,type=buttered_sturgeon
2 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
3 0.00 potion,name=draenic_strength
Default action list Executed every time the actor is available.
# count action,conditions
4 22.36 intercept
5 1.00 auto_attack
6 7.96 use_item,name=purified_shard_of_the_third_moon
0.00 blood_fury
0.00 berserking
0.00 arcane_torrent
7 0.00 call_action_list,name=prot
actions.prot
# count action,conditions
8 39.94 shield_block,if=!buff.neltharions_fury.up&((cooldown.shield_slam.remains<6&!buff.shield_block.up)|(cooldown.shield_slam.remains<6+buff.shield_block.remains&buff.shield_block.up))
9 34.99 ignore_pain,if=(rage>=60&!talent.vengeance.enabled)|(buff.vengeance_ignore_pain.up&buff.ultimatum.up)|(buff.vengeance_ignore_pain.up&rage>=30)|(talent.vengeance.enabled&!buff.ultimatum.up&!buff.vengeance_ignore_pain.up&!buff.vengeance_focused_rage.up&rage<30)
A 36.32 focused_rage,if=(buff.vengeance_focused_rage.up&!buff.vengeance_ignore_pain.up)|(buff.ultimatum.up&buff.vengeance_focused_rage.up&!buff.vengeance_ignore_pain.up)|(talent.vengeance.enabled&buff.ultimatum.up&!buff.vengeance_ignore_pain.up&!buff.vengeance_focused_rage.up)|(talent.vengeance.enabled&!buff.vengeance_ignore_pain.up&!buff.vengeance_focused_rage.up&rage>=30)|(buff.ultimatum.up&buff.vengeance_ignore_pain.up&cooldown.shield_slam.remains=0&rage<10)|(rage>=100)
B 5.36 demoralizing_shout,if=incoming_damage_2500ms>health.max*0.20
C 2.17 shield_wall,if=incoming_damage_2500ms>health.max*0.50
D 4.91 last_stand,if=incoming_damage_2500ms>health.max*0.50&!cooldown.shield_wall.remains=0
E 1.00 potion,name=draenic_strength,if=(incoming_damage_2500ms>health.max*0.15&!buff.potion.up)|target.time_to_die<=25
F 0.00 call_action_list,name=prot_aoe,if=spell_targets.neltharions_fury>=2
0.00 focused_rage,if=talent.ultimatum.enabled&buff.ultimatum.up&!talent.vengeance.enabled
G 7.78 battle_cry,if=(talent.vengeance.enabled&talent.ultimatum.enabled&cooldown.shield_slam.remains<=5-gcd.max-0.5)|!talent.vengeance.enabled
0.00 demoralizing_shout,if=talent.booming_voice.enabled&buff.battle_cry.up
0.00 ravager,if=talent.ravager.enabled&buff.battle_cry.up
0.00 neltharions_fury,if=incoming_damage_2500ms>health.max*0.20&!buff.shield_block.up
H 64.74 shield_slam,if=!(cooldown.shield_block.remains<=gcd.max*2&!buff.shield_block.up&talent.heavy_repercussions.enabled)
I 43.50 revenge,if=cooldown.shield_slam.remains<=gcd.max*2
J 228.15 devastate

Sample Sequence

0134568GH8AJH9AJJJBIJHJJ8JIJH9AJHJJ49CDJIJH8JAJJIJ8HJJJH9JJHAJJ48JJIH9AJJJJIJ8H9AJJEJ6GI4J8H9AJJJIJHJ9JJIJJ8H4A9JJJI8JHAJJJHJBJ8H9JJ4AJIJH9AJJJDIJJJ8H9AJ6JGH48JJ9JIJHAJJ8JIJH9AJHJ49JJIJJJ8HAJJJH89AJJJI49IHAJJ8JJIHJJH9J6JJGI48AHJBJJJH9JII8HAJJJJI48H9JJJDHAJJJIJJJI8HJ49JJI8JHAJJJIJJ68HJJJ49GIJHAJ8JJIJH9JJCJI8HAJ49JJJIHAJJ8JBJIHJJJ9J48IAHJJJI9JJJJ6DJIJJGJ48AH9AJH8J9AJHJJJH9JH8AJJJ4I9JHAJJJ8IJHJJJI8J9H4AJJJI9JJJJ8H6AJJHJJJ49BGIJJJ8HAJJJIJJJJJ8H49JJJI8JHAJJJIIJ8H9AJJ4JH9JDJJIJ8H6AJJH9AJJJGI48I9HAJJJH9JJJI8J

Sample Sequence Table

time name target resources buffs
Pre flask Ylvi 0.0/100: 0% rage
Pre food Ylvi 0.0/100: 0% rage
Pre potion Fluffy_Pillow 0.0/100: 0% rage draenic_strength_potion
0:00.000 intercept Fluffy_Pillow 0.0/100: 0% rage draenic_strength_potion
0:00.000 auto_attack Fluffy_Pillow 20.0/100: 20% rage archmages_greater_incandescence_str, mark_of_bleeding_hollow, draenic_strength_potion
0:00.000 use_item_purified_shard_of_the_third_moon Fluffy_Pillow 23.6/100: 24% rage archmages_greater_incandescence_str, mark_of_bleeding_hollow, draenic_strength_potion
0:00.000 shield_block Fluffy_Pillow 23.6/100: 24% rage archmages_greater_incandescence_str, mark_of_bleeding_hollow, draenic_strength_potion, bulwark_of_purity
0:00.000 battle_cry Fluffy_Pillow 13.6/100: 14% rage archmages_greater_incandescence_str, shield_block, mark_of_bleeding_hollow, draenic_strength_potion, bulwark_of_purity
0:00.000 shield_slam Fluffy_Pillow 13.6/100: 14% rage archmages_greater_incandescence_str, battle_cry, shield_block, mark_of_bleeding_hollow, draenic_strength_potion, bulwark_of_purity
0:01.374 shield_block Fluffy_Pillow 28.6/100: 29% rage bloodlust, archmages_greater_incandescence_str, ultimatum, battle_cry, shield_block, mark_of_bleeding_hollow, draenic_strength_potion, bulwark_of_purity
0:01.374 focused_rage Fluffy_Pillow 18.6/100: 19% rage bloodlust, archmages_greater_incandescence_str, ultimatum, battle_cry, shield_block, mark_of_bleeding_hollow, draenic_strength_potion, bulwark_of_purity
0:01.374 devastate Fluffy_Pillow 18.6/100: 19% rage bloodlust, archmages_greater_incandescence_str, focused_rage, battle_cry, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow, draenic_strength_potion, bulwark_of_purity
0:02.433 shield_slam Fluffy_Pillow 22.2/100: 22% rage bloodlust, archmages_greater_incandescence_str, focused_rage, battle_cry, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow, draenic_strength_potion, bulwark_of_purity
0:03.491 ignore_pain Ylvi 37.2/100: 37% rage bloodlust, archmages_greater_incandescence_str, ultimatum, battle_cry, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow, draenic_strength_potion, bulwark_of_purity
0:03.491 focused_rage Fluffy_Pillow 0.0/100: 0% rage bloodlust, archmages_greater_incandescence_str, ultimatum, ignore_pain, battle_cry, shield_block, vengeance_focused_rage, mark_of_bleeding_hollow, draenic_strength_potion, bulwark_of_purity
0:03.491 devastate Fluffy_Pillow 0.0/100: 0% rage bloodlust, archmages_greater_incandescence_str, focused_rage, ignore_pain, battle_cry, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow, draenic_strength_potion, bulwark_of_purity
0:04.549 devastate Fluffy_Pillow 3.6/100: 4% rage bloodlust, archmages_greater_incandescence_str, focused_rage, ignore_pain, battle_cry, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow, draenic_strength_potion, bulwark_of_purity
0:05.606 devastate Fluffy_Pillow 3.6/100: 4% rage bloodlust, archmages_greater_incandescence_str, focused_rage, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow, draenic_strength_potion
0:06.666 demoralizing_shout Fluffy_Pillow 3.6/100: 4% rage bloodlust, archmages_greater_incandescence_str, focused_rage, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow, draenic_strength_potion
0:06.666 revenge Fluffy_Pillow 3.6/100: 4% rage bloodlust, archmages_greater_incandescence_str, demoralizing_shout, focused_rage, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow, draenic_strength_potion
0:07.724 devastate Fluffy_Pillow 8.6/100: 9% rage bloodlust, archmages_greater_incandescence_str, demoralizing_shout, focused_rage, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow, draenic_strength_potion
0:08.783 shield_slam Fluffy_Pillow 8.6/100: 9% rage bloodlust, archmages_greater_incandescence_str, demoralizing_shout, focused_rage, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow, draenic_strength_potion
0:09.841 devastate Fluffy_Pillow 27.2/100: 27% rage bloodlust, archmages_greater_incandescence_str, demoralizing_shout, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow, draenic_strength_potion
0:10.900 devastate Fluffy_Pillow 27.2/100: 27% rage bloodlust, demoralizing_shout, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow, draenic_strength_potion
0:11.958 shield_block Fluffy_Pillow 27.2/100: 27% rage bloodlust, demoralizing_shout, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow, draenic_strength_potion
0:11.958 devastate Fluffy_Pillow 17.2/100: 17% rage bloodlust, demoralizing_shout, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow, draenic_strength_potion
0:13.017 revenge Fluffy_Pillow 17.2/100: 17% rage bloodlust, demoralizing_shout, shield_block, vengeance_ignore_pain, draenic_strength_potion
0:14.075 devastate Fluffy_Pillow 22.2/100: 22% rage bloodlust, demoralizing_shout, shield_block, vengeance_ignore_pain, draenic_strength_potion
0:15.134 shield_slam Fluffy_Pillow 22.2/100: 22% rage bloodlust, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow, draenic_strength_potion
0:16.191 ignore_pain Ylvi 37.2/100: 37% rage bloodlust, ultimatum, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow, draenic_strength_potion
0:16.191 focused_rage Fluffy_Pillow 0.0/100: 0% rage bloodlust, ultimatum, ignore_pain, shield_block, vengeance_focused_rage, mark_of_bleeding_hollow, draenic_strength_potion
0:16.191 devastate Fluffy_Pillow 0.0/100: 0% rage bloodlust, focused_rage, ignore_pain, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow, draenic_strength_potion
0:17.249 shield_slam Fluffy_Pillow 0.0/100: 0% rage bloodlust, focused_rage, ignore_pain, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow, draenic_strength_potion
0:18.310 devastate Fluffy_Pillow 15.0/100: 15% rage bloodlust, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow, draenic_strength_potion
0:19.368 devastate Fluffy_Pillow 15.0/100: 15% rage bloodlust, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow, draenic_strength_potion
0:20.428 intercept Fluffy_Pillow 18.6/100: 19% rage bloodlust, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow, draenic_strength_potion
0:20.428 ignore_pain Ylvi 38.6/100: 39% rage bloodlust, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow, draenic_strength_potion
0:20.428 shield_wall Fluffy_Pillow 0.0/100: 0% rage bloodlust, ignore_pain, shield_block, vengeance_focused_rage, mark_of_bleeding_hollow, draenic_strength_potion
0:20.428 last_stand Fluffy_Pillow 0.0/100: 0% rage bloodlust, ignore_pain, shield_block, shield_wall, vengeance_focused_rage, mark_of_bleeding_hollow, draenic_strength_potion
0:20.428 devastate Fluffy_Pillow 0.0/100: 0% rage bloodlust, last_stand, ignore_pain, shield_block, shield_wall, vengeance_focused_rage, mark_of_bleeding_hollow, draenic_strength_potion
0:21.486 revenge Fluffy_Pillow 0.0/100: 0% rage bloodlust, last_stand, ignore_pain, shield_block, shield_wall, vengeance_focused_rage, mark_of_bleeding_hollow, draenic_strength_potion
0:22.543 devastate Fluffy_Pillow 5.0/100: 5% rage bloodlust, last_stand, shield_block, shield_wall, vengeance_focused_rage, mark_of_bleeding_hollow, draenic_strength_potion
0:23.603 shield_slam Fluffy_Pillow 8.6/100: 9% rage bloodlust, last_stand, shield_block, shield_wall, vengeance_focused_rage, mark_of_bleeding_hollow
0:24.661 shield_block Fluffy_Pillow 23.6/100: 24% rage bloodlust, last_stand, shield_block, shield_wall, vengeance_focused_rage, mark_of_bleeding_hollow
0:24.661 devastate Fluffy_Pillow 13.6/100: 14% rage bloodlust, last_stand, shield_block, shield_wall, vengeance_focused_rage, mark_of_bleeding_hollow
0:25.719 focused_rage Fluffy_Pillow 17.2/100: 17% rage bloodlust, last_stand, shield_block, shield_wall, vengeance_focused_rage, mark_of_bleeding_hollow
0:25.719 devastate Fluffy_Pillow 2.2/100: 2% rage bloodlust, focused_rage, last_stand, shield_block, shield_wall, vengeance_ignore_pain, mark_of_bleeding_hollow
0:26.778 devastate Fluffy_Pillow 2.2/100: 2% rage bloodlust, focused_rage, last_stand, shield_block, shield_wall, vengeance_ignore_pain, mark_of_bleeding_hollow
0:27.836 revenge Fluffy_Pillow 5.8/100: 6% rage bloodlust, focused_rage, last_stand, shield_block, shield_wall, vengeance_ignore_pain
0:28.894 devastate Fluffy_Pillow 10.8/100: 11% rage bloodlust, focused_rage, last_stand, shield_block, vengeance_ignore_pain
0:29.952 shield_block Fluffy_Pillow 10.8/100: 11% rage bloodlust, focused_rage, last_stand, shield_block, vengeance_ignore_pain
0:30.150 shield_slam Fluffy_Pillow 0.8/100: 1% rage bloodlust, focused_rage, last_stand, shield_block, vengeance_ignore_pain
0:31.208 devastate Fluffy_Pillow 19.4/100: 19% rage bloodlust, last_stand, shield_block, vengeance_ignore_pain
0:32.268 devastate Fluffy_Pillow 19.4/100: 19% rage bloodlust, last_stand, shield_block, vengeance_ignore_pain
0:33.327 devastate Fluffy_Pillow 23.0/100: 23% rage bloodlust, last_stand, shield_block, vengeance_ignore_pain
0:34.386 shield_slam Fluffy_Pillow 23.0/100: 23% rage bloodlust, last_stand, shield_block, vengeance_ignore_pain
0:35.445 ignore_pain Ylvi 38.0/100: 38% rage bloodlust, shield_block, vengeance_ignore_pain
0:35.445 devastate Fluffy_Pillow 0.0/100: 0% rage bloodlust, ignore_pain, shield_block, vengeance_focused_rage
0:36.503 devastate Fluffy_Pillow 3.6/100: 4% rage bloodlust, shield_block, vengeance_focused_rage
0:37.562 shield_slam Fluffy_Pillow 3.6/100: 4% rage bloodlust, shield_block, vengeance_focused_rage
0:38.619 focused_rage Fluffy_Pillow 18.6/100: 19% rage bloodlust, shield_block, vengeance_focused_rage
0:38.619 devastate Fluffy_Pillow 3.6/100: 4% rage bloodlust, focused_rage, shield_block, vengeance_ignore_pain
0:39.676 devastate Fluffy_Pillow 3.6/100: 4% rage bloodlust, focused_rage, shield_block, vengeance_ignore_pain
0:40.734 intercept Fluffy_Pillow 3.6/100: 4% rage bloodlust, focused_rage, shield_block, vengeance_ignore_pain
0:40.734 shield_block Fluffy_Pillow 23.6/100: 24% rage bloodlust, focused_rage, shield_block, vengeance_ignore_pain
0:40.734 devastate Fluffy_Pillow 13.6/100: 14% rage bloodlust, focused_rage, shield_block, vengeance_ignore_pain
0:41.792 devastate Fluffy_Pillow 13.6/100: 14% rage focused_rage, shield_block, vengeance_ignore_pain
0:43.166 revenge Fluffy_Pillow 13.6/100: 14% rage focused_rage, shield_block, vengeance_ignore_pain
0:44.539 shield_slam Fluffy_Pillow 22.2/100: 22% rage focused_rage, shield_block, vengeance_ignore_pain
0:46.128 ignore_pain Ylvi 37.2/100: 37% rage ultimatum, shield_block, vengeance_ignore_pain
0:46.128 focused_rage Fluffy_Pillow 0.0/100: 0% rage ultimatum, ignore_pain, shield_block, vengeance_focused_rage
0:46.128 devastate Fluffy_Pillow 0.0/100: 0% rage focused_rage, ignore_pain, shield_block, vengeance_ignore_pain
0:47.500 devastate Fluffy_Pillow 0.0/100: 0% rage focused_rage, ignore_pain, shield_block, vengeance_ignore_pain
0:48.874 devastate Fluffy_Pillow 0.0/100: 0% rage focused_rage, shield_block, vengeance_ignore_pain
0:50.248 devastate Fluffy_Pillow 0.0/100: 0% rage focused_rage, shield_block, vengeance_ignore_pain
0:51.623 revenge Fluffy_Pillow 3.6/100: 4% rage focused_rage, vengeance_ignore_pain
0:52.998 devastate Fluffy_Pillow 8.6/100: 9% rage focused_rage, vengeance_ignore_pain
0:54.372 shield_block Fluffy_Pillow 12.2/100: 12% rage focused_rage, vengeance_ignore_pain
0:54.372 shield_slam Fluffy_Pillow 2.2/100: 2% rage focused_rage, shield_block, vengeance_ignore_pain
0:55.747 ignore_pain Ylvi 17.2/100: 17% rage ultimatum, shield_block, vengeance_ignore_pain
0:55.747 focused_rage Fluffy_Pillow 0.0/100: 0% rage ultimatum, ignore_pain, shield_block, vengeance_focused_rage
0:55.747 devastate Fluffy_Pillow 0.0/100: 0% rage focused_rage, ignore_pain, shield_block, vengeance_ignore_pain
0:57.121 devastate Fluffy_Pillow 0.0/100: 0% rage focused_rage, shield_block, vengeance_ignore_pain
0:58.497 potion Fluffy_Pillow 0.0/100: 0% rage focused_rage, shield_block, vengeance_ignore_pain
0:58.497 devastate Fluffy_Pillow 0.0/100: 0% rage focused_rage, shield_block, vengeance_ignore_pain, draenic_strength_potion
0:59.871 use_item_purified_shard_of_the_third_moon Fluffy_Pillow 0.0/100: 0% rage focused_rage, shield_block, vengeance_ignore_pain, draenic_strength_potion
1:00.000 battle_cry Fluffy_Pillow 0.0/100: 0% rage focused_rage, shield_block, vengeance_ignore_pain, draenic_strength_potion, bulwark_of_purity
1:00.000 revenge Fluffy_Pillow 0.0/100: 0% rage focused_rage, battle_cry, shield_block, vengeance_ignore_pain, draenic_strength_potion, bulwark_of_purity
1:01.375 intercept Fluffy_Pillow 5.0/100: 5% rage focused_rage, battle_cry, shield_block, vengeance_ignore_pain, draenic_strength_potion, bulwark_of_purity
1:01.375 devastate Fluffy_Pillow 25.0/100: 25% rage focused_rage, battle_cry, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow, draenic_strength_potion, bulwark_of_purity
1:02.750 shield_block Fluffy_Pillow 25.0/100: 25% rage focused_rage, battle_cry, vengeance_ignore_pain, mark_of_bleeding_hollow, draenic_strength_potion
1:02.750 shield_slam Fluffy_Pillow 15.0/100: 15% rage focused_rage, battle_cry, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow, draenic_strength_potion
1:04.125 ignore_pain Ylvi 33.6/100: 34% rage ultimatum, battle_cry, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow, draenic_strength_potion
1:04.125 focused_rage Fluffy_Pillow 0.0/100: 0% rage ultimatum, ignore_pain, battle_cry, shield_block, vengeance_focused_rage, mark_of_bleeding_hollow, draenic_strength_potion
1:04.125 devastate Fluffy_Pillow 0.0/100: 0% rage focused_rage, ignore_pain, battle_cry, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow, draenic_strength_potion
1:05.502 devastate Fluffy_Pillow 3.6/100: 4% rage focused_rage, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow, draenic_strength_potion
1:06.877 devastate Fluffy_Pillow 3.6/100: 4% rage focused_rage, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow, draenic_strength_potion
1:08.254 revenge Fluffy_Pillow 3.6/100: 4% rage focused_rage, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow, draenic_strength_potion
1:09.629 devastate Fluffy_Pillow 8.6/100: 9% rage focused_rage, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow, draenic_strength_potion
1:11.004 shield_slam Fluffy_Pillow 12.2/100: 12% rage focused_rage, vengeance_ignore_pain, mark_of_bleeding_hollow, draenic_strength_potion
1:12.379 devastate Fluffy_Pillow 27.2/100: 27% rage vengeance_ignore_pain, mark_of_bleeding_hollow, draenic_strength_potion
1:13.754 ignore_pain Ylvi 30.8/100: 31% rage vengeance_ignore_pain, mark_of_bleeding_hollow, draenic_strength_potion
1:13.754 devastate Fluffy_Pillow 0.0/100: 0% rage ignore_pain, vengeance_focused_rage, mark_of_bleeding_hollow, draenic_strength_potion
1:15.129 devastate Fluffy_Pillow 0.0/100: 0% rage vengeance_focused_rage, mark_of_bleeding_hollow, draenic_strength_potion
1:16.504 revenge Fluffy_Pillow 0.0/100: 0% rage vengeance_focused_rage, mark_of_bleeding_hollow, draenic_strength_potion
1:17.878 devastate Fluffy_Pillow 8.6/100: 9% rage vengeance_focused_rage, mark_of_bleeding_hollow, draenic_strength_potion
1:19.254 devastate Fluffy_Pillow 8.6/100: 9% rage vengeance_focused_rage, mark_of_bleeding_hollow, draenic_strength_potion
1:20.628 shield_block Fluffy_Pillow 12.2/100: 12% rage vengeance_focused_rage, draenic_strength_potion
1:20.628 shield_slam Fluffy_Pillow 2.2/100: 2% rage shield_block, vengeance_focused_rage, draenic_strength_potion
1:22.001 intercept Fluffy_Pillow 17.2/100: 17% rage ultimatum, shield_block, vengeance_focused_rage, draenic_strength_potion
1:22.001 focused_rage Fluffy_Pillow 37.2/100: 37% rage ultimatum, shield_block, vengeance_focused_rage, draenic_strength_potion
1:22.001 ignore_pain Ylvi 37.2/100: 37% rage focused_rage, shield_block, vengeance_ignore_pain, draenic_strength_potion
1:22.001 devastate Fluffy_Pillow 0.0/100: 0% rage focused_rage, ignore_pain, shield_block, vengeance_focused_rage, draenic_strength_potion
1:23.377 devastate Fluffy_Pillow 3.6/100: 4% rage focused_rage, ignore_pain, shield_block, vengeance_focused_rage, draenic_strength_potion
1:24.751 devastate Fluffy_Pillow 7.2/100: 7% rage focused_rage, shield_block, vengeance_focused_rage
1:26.125 revenge Fluffy_Pillow 7.2/100: 7% rage focused_rage, shield_block, vengeance_focused_rage
1:27.500 shield_block Fluffy_Pillow 12.2/100: 12% rage focused_rage, shield_block, vengeance_focused_rage
1:27.500 devastate Fluffy_Pillow 2.2/100: 2% rage focused_rage, shield_block, vengeance_focused_rage
1:28.874 shield_slam Fluffy_Pillow 2.2/100: 2% rage focused_rage, shield_block, vengeance_focused_rage
1:30.249 focused_rage Fluffy_Pillow 17.2/100: 17% rage shield_block, vengeance_focused_rage
1:30.249 devastate Fluffy_Pillow 2.2/100: 2% rage focused_rage, shield_block, vengeance_ignore_pain
1:31.624 devastate Fluffy_Pillow 5.8/100: 6% rage focused_rage, shield_block, vengeance_ignore_pain
1:32.998 devastate Fluffy_Pillow 5.8/100: 6% rage focused_rage, shield_block, vengeance_ignore_pain
1:34.370 shield_slam Fluffy_Pillow 9.4/100: 9% rage focused_rage, shield_block, vengeance_ignore_pain
1:35.746 devastate Fluffy_Pillow 24.4/100: 24% rage shield_block, vengeance_ignore_pain
1:37.121 demoralizing_shout Fluffy_Pillow 28.0/100: 28% rage shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow
1:37.121 devastate Fluffy_Pillow 28.0/100: 28% rage demoralizing_shout, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow
1:38.496 shield_block Fluffy_Pillow 28.0/100: 28% rage demoralizing_shout, vengeance_ignore_pain, mark_of_bleeding_hollow
1:38.496 shield_slam Fluffy_Pillow 18.0/100: 18% rage demoralizing_shout, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow
1:39.870 ignore_pain Ylvi 36.6/100: 37% rage demoralizing_shout, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow
1:39.870 devastate Fluffy_Pillow 0.0/100: 0% rage demoralizing_shout, ignore_pain, shield_block, vengeance_focused_rage, mark_of_bleeding_hollow
1:41.244 devastate Fluffy_Pillow 3.6/100: 4% rage demoralizing_shout, shield_block, vengeance_focused_rage, mark_of_bleeding_hollow
1:42.619 intercept Fluffy_Pillow 3.6/100: 4% rage demoralizing_shout, shield_block, vengeance_focused_rage, mark_of_bleeding_hollow
1:42.619 focused_rage Fluffy_Pillow 23.6/100: 24% rage demoralizing_shout, shield_block, vengeance_focused_rage, mark_of_bleeding_hollow
1:42.619 devastate Fluffy_Pillow 8.6/100: 9% rage demoralizing_shout, focused_rage, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow
1:43.994 revenge Fluffy_Pillow 8.6/100: 9% rage demoralizing_shout, focused_rage, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow
1:45.369 devastate Fluffy_Pillow 13.6/100: 14% rage focused_rage, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow
1:46.742 shield_slam Fluffy_Pillow 13.6/100: 14% rage focused_rage, vengeance_ignore_pain, mark_of_bleeding_hollow
1:48.118 ignore_pain Ylvi 28.6/100: 29% rage ultimatum, vengeance_ignore_pain
1:48.118 focused_rage Fluffy_Pillow 0.0/100: 0% rage ultimatum, ignore_pain, vengeance_focused_rage
1:48.118 devastate Fluffy_Pillow 0.0/100: 0% rage focused_rage, ignore_pain, vengeance_ignore_pain
1:49.492 devastate Fluffy_Pillow 0.0/100: 0% rage focused_rage, ignore_pain, vengeance_ignore_pain
1:50.866 devastate Fluffy_Pillow 0.0/100: 0% rage focused_rage, vengeance_ignore_pain
1:52.242 last_stand Fluffy_Pillow 0.0/100: 0% rage focused_rage, vengeance_ignore_pain
1:52.242 revenge Fluffy_Pillow 0.0/100: 0% rage focused_rage, last_stand, vengeance_ignore_pain
1:53.617 devastate Fluffy_Pillow 8.6/100: 9% rage focused_rage, last_stand, vengeance_ignore_pain
1:54.991 devastate Fluffy_Pillow 8.6/100: 9% rage focused_rage, last_stand, vengeance_ignore_pain
1:56.366 devastate Fluffy_Pillow 8.6/100: 9% rage focused_rage, last_stand, vengeance_ignore_pain
1:57.742 shield_block Fluffy_Pillow 12.2/100: 12% rage focused_rage, last_stand, vengeance_ignore_pain
1:57.742 shield_slam Fluffy_Pillow 2.2/100: 2% rage focused_rage, last_stand, shield_block, vengeance_ignore_pain
1:59.115 ignore_pain Ylvi 17.2/100: 17% rage ultimatum, last_stand, shield_block, vengeance_ignore_pain
1:59.115 focused_rage Fluffy_Pillow 0.0/100: 0% rage ultimatum, last_stand, ignore_pain, shield_block, vengeance_focused_rage
1:59.115 devastate Fluffy_Pillow 0.0/100: 0% rage focused_rage, last_stand, ignore_pain, shield_block, vengeance_ignore_pain
2:00.490 use_item_purified_shard_of_the_third_moon Fluffy_Pillow 0.0/100: 0% rage focused_rage, last_stand, shield_block, vengeance_ignore_pain
2:00.490 devastate Fluffy_Pillow 0.0/100: 0% rage focused_rage, last_stand, shield_block, vengeance_ignore_pain, bulwark_of_purity
2:01.865 battle_cry Fluffy_Pillow 0.0/100: 0% rage focused_rage, last_stand, shield_block, vengeance_ignore_pain, bulwark_of_purity
2:01.865 shield_slam Fluffy_Pillow 0.0/100: 0% rage focused_rage, last_stand, battle_cry, shield_block, vengeance_ignore_pain, bulwark_of_purity
2:03.241 intercept Fluffy_Pillow 18.6/100: 19% rage last_stand, battle_cry, shield_block, vengeance_ignore_pain
2:03.241 shield_block Fluffy_Pillow 38.6/100: 39% rage last_stand, battle_cry, shield_block, vengeance_ignore_pain
2:03.241 devastate Fluffy_Pillow 28.6/100: 29% rage last_stand, battle_cry, shield_block, vengeance_ignore_pain
2:04.615 devastate Fluffy_Pillow 28.6/100: 29% rage last_stand, battle_cry, shield_block, vengeance_ignore_pain
2:05.989 ignore_pain Ylvi 32.2/100: 32% rage last_stand, battle_cry, shield_block, vengeance_ignore_pain
2:05.989 devastate Fluffy_Pillow 0.0/100: 0% rage last_stand, ignore_pain, battle_cry, shield_block, vengeance_focused_rage
2:07.365 revenge Fluffy_Pillow 0.0/100: 0% rage shield_block, vengeance_focused_rage
2:08.740 devastate Fluffy_Pillow 5.0/100: 5% rage shield_block, vengeance_focused_rage
2:10.116 shield_slam Fluffy_Pillow 8.6/100: 9% rage shield_block, vengeance_focused_rage
2:11.490 focused_rage Fluffy_Pillow 23.6/100: 24% rage shield_block, vengeance_focused_rage, mark_of_bleeding_hollow
2:11.490 devastate Fluffy_Pillow 8.6/100: 9% rage focused_rage, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow
2:12.862 devastate Fluffy_Pillow 12.2/100: 12% rage focused_rage, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow
2:14.237 shield_block Fluffy_Pillow 12.2/100: 12% rage focused_rage, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow
2:14.237 devastate Fluffy_Pillow 2.2/100: 2% rage focused_rage, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow
2:15.609 revenge Fluffy_Pillow 5.8/100: 6% rage focused_rage, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow
2:16.987 devastate Fluffy_Pillow 14.4/100: 14% rage focused_rage, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow
2:18.363 shield_slam Fluffy_Pillow 14.4/100: 14% rage focused_rage, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow
2:19.737 ignore_pain Ylvi 33.0/100: 33% rage archmages_greater_incandescence_str, ultimatum, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow
2:19.737 focused_rage Fluffy_Pillow 0.0/100: 0% rage archmages_greater_incandescence_str, ultimatum, ignore_pain, shield_block, vengeance_focused_rage, mark_of_bleeding_hollow
2:19.737 devastate Fluffy_Pillow 0.0/100: 0% rage archmages_greater_incandescence_str, focused_rage, ignore_pain, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow
2:21.112 shield_slam Fluffy_Pillow 0.0/100: 0% rage archmages_greater_incandescence_str, focused_rage, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow
2:22.487 devastate Fluffy_Pillow 15.0/100: 15% rage archmages_greater_incandescence_str, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow
2:23.862 intercept Fluffy_Pillow 15.0/100: 15% rage archmages_greater_incandescence_str, vengeance_ignore_pain
2:23.862 ignore_pain Ylvi 35.0/100: 35% rage archmages_greater_incandescence_str, vengeance_ignore_pain
2:23.862 devastate Fluffy_Pillow 0.0/100: 0% rage archmages_greater_incandescence_str, ignore_pain, vengeance_focused_rage
2:25.235 devastate Fluffy_Pillow 0.0/100: 0% rage archmages_greater_incandescence_str, vengeance_focused_rage
2:26.609 revenge Fluffy_Pillow 3.6/100: 4% rage archmages_greater_incandescence_str, vengeance_focused_rage, mark_of_bleeding_hollow
2:27.983 devastate Fluffy_Pillow 8.6/100: 9% rage archmages_greater_incandescence_str, vengeance_focused_rage, mark_of_bleeding_hollow
2:29.358 devastate Fluffy_Pillow 8.6/100: 9% rage vengeance_focused_rage, mark_of_bleeding_hollow
2:30.733 devastate Fluffy_Pillow 8.6/100: 9% rage vengeance_focused_rage, mark_of_bleeding_hollow
2:32.108 shield_block Fluffy_Pillow 12.2/100: 12% rage vengeance_focused_rage, mark_of_bleeding_hollow
2:32.108 shield_slam Fluffy_Pillow 2.2/100: 2% rage shield_block, vengeance_focused_rage, mark_of_bleeding_hollow
2:33.482 focused_rage Fluffy_Pillow 20.8/100: 21% rage shield_block, vengeance_focused_rage, mark_of_bleeding_hollow
2:33.482 devastate Fluffy_Pillow 5.8/100: 6% rage focused_rage, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow
2:34.857 devastate Fluffy_Pillow 5.8/100: 6% rage focused_rage, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow
2:36.232 devastate Fluffy_Pillow 9.4/100: 9% rage focused_rage, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow
2:37.604 shield_slam Fluffy_Pillow 9.4/100: 9% rage focused_rage, shield_block, vengeance_ignore_pain
2:38.980 shield_block Fluffy_Pillow 24.4/100: 24% rage ultimatum, shield_block, vengeance_ignore_pain
2:38.980 ignore_pain Ylvi 14.4/100: 14% rage ultimatum, shield_block, vengeance_ignore_pain
2:38.980 focused_rage Fluffy_Pillow 0.0/100: 0% rage ultimatum, ignore_pain, shield_block, vengeance_focused_rage
2:38.980 devastate Fluffy_Pillow 0.0/100: 0% rage focused_rage, ignore_pain, shield_block, vengeance_ignore_pain
2:40.355 devastate Fluffy_Pillow 0.0/100: 0% rage focused_rage, shield_block, vengeance_ignore_pain
2:41.730 devastate Fluffy_Pillow 3.6/100: 4% rage focused_rage, shield_block, vengeance_ignore_pain
2:43.104 revenge Fluffy_Pillow 7.2/100: 7% rage focused_rage, shield_block, vengeance_ignore_pain
2:44.478 intercept Fluffy_Pillow 15.8/100: 16% rage focused_rage, shield_block, vengeance_ignore_pain
2:44.478 ignore_pain Ylvi 35.8/100: 36% rage focused_rage, shield_block, vengeance_ignore_pain
2:44.478 revenge Fluffy_Pillow 0.0/100: 0% rage focused_rage, ignore_pain, shield_block, vengeance_focused_rage
2:45.855 shield_slam Fluffy_Pillow 5.0/100: 5% rage focused_rage, ignore_pain, shield_block, vengeance_focused_rage
2:47.231 focused_rage Fluffy_Pillow 23.6/100: 24% rage shield_block, vengeance_focused_rage
2:47.231 devastate Fluffy_Pillow 8.6/100: 9% rage focused_rage, shield_block, vengeance_ignore_pain
2:48.605 devastate Fluffy_Pillow 8.6/100: 9% rage focused_rage, shield_block, vengeance_ignore_pain
2:49.977 shield_block Fluffy_Pillow 12.2/100: 12% rage focused_rage, vengeance_ignore_pain
2:49.977 devastate Fluffy_Pillow 2.2/100: 2% rage focused_rage, shield_block, vengeance_ignore_pain
2:51.351 devastate Fluffy_Pillow 2.2/100: 2% rage focused_rage, shield_block, vengeance_ignore_pain
2:52.725 revenge Fluffy_Pillow 2.2/100: 2% rage focused_rage, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow
2:54.099 shield_slam Fluffy_Pillow 10.8/100: 11% rage focused_rage, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow
2:55.474 devastate Fluffy_Pillow 25.8/100: 26% rage shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow
2:56.847 devastate Fluffy_Pillow 29.4/100: 29% rage shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow
2:58.222 shield_slam Fluffy_Pillow 29.4/100: 29% rage vengeance_ignore_pain, mark_of_bleeding_hollow
2:59.596 ignore_pain Ylvi 44.4/100: 44% rage vengeance_ignore_pain, mark_of_bleeding_hollow
2:59.596 devastate Fluffy_Pillow 0.0/100: 0% rage ignore_pain, vengeance_focused_rage, mark_of_bleeding_hollow
3:00.972 use_item_purified_shard_of_the_third_moon Fluffy_Pillow 0.0/100: 0% rage vengeance_focused_rage, mark_of_bleeding_hollow
3:00.972 devastate Fluffy_Pillow 0.0/100: 0% rage vengeance_focused_rage, mark_of_bleeding_hollow, bulwark_of_purity
3:02.347 devastate Fluffy_Pillow 0.0/100: 0% rage vengeance_focused_rage, mark_of_bleeding_hollow
3:03.722 battle_cry Fluffy_Pillow 0.0/100: 0% rage vengeance_focused_rage, mark_of_bleeding_hollow
3:03.722 revenge Fluffy_Pillow 0.0/100: 0% rage battle_cry, vengeance_focused_rage, mark_of_bleeding_hollow
3:05.097 intercept Fluffy_Pillow 5.0/100: 5% rage battle_cry, vengeance_focused_rage
3:05.097 shield_block Fluffy_Pillow 25.0/100: 25% rage battle_cry, vengeance_focused_rage
3:05.097 focused_rage Fluffy_Pillow 15.0/100: 15% rage battle_cry, shield_block, vengeance_focused_rage
3:05.097 shield_slam Fluffy_Pillow 0.0/100: 0% rage focused_rage, battle_cry, shield_block, vengeance_ignore_pain
3:06.471 devastate Fluffy_Pillow 15.0/100: 15% rage battle_cry, shield_block, vengeance_ignore_pain
3:07.845 demoralizing_shout Fluffy_Pillow 15.0/100: 15% rage battle_cry, shield_block, vengeance_ignore_pain
3:07.845 devastate Fluffy_Pillow 15.0/100: 15% rage demoralizing_shout, battle_cry, shield_block, vengeance_ignore_pain
3:09.221 devastate Fluffy_Pillow 18.6/100: 19% rage demoralizing_shout, shield_block, vengeance_ignore_pain
3:10.597 devastate Fluffy_Pillow 18.6/100: 19% rage demoralizing_shout, shield_block, vengeance_ignore_pain
3:11.971 shield_slam Fluffy_Pillow 22.2/100: 22% rage demoralizing_shout, shield_block, vengeance_ignore_pain
3:13.346 ignore_pain Ylvi 40.8/100: 41% rage demoralizing_shout, shield_block, vengeance_ignore_pain
3:13.346 devastate Fluffy_Pillow 0.0/100: 0% rage demoralizing_shout, ignore_pain, shield_block, vengeance_focused_rage
3:14.721 revenge Fluffy_Pillow 0.0/100: 0% rage demoralizing_shout, vengeance_focused_rage
3:16.095 revenge Fluffy_Pillow 8.6/100: 9% rage vengeance_focused_rage
3:17.470 shield_block Fluffy_Pillow 13.6/100: 14% rage archmages_greater_incandescence_str, vengeance_focused_rage, mark_of_bleeding_hollow
3:17.470 shield_slam Fluffy_Pillow 3.6/100: 4% rage archmages_greater_incandescence_str, shield_block, vengeance_focused_rage, mark_of_bleeding_hollow
3:18.846 focused_rage Fluffy_Pillow 18.6/100: 19% rage archmages_greater_incandescence_str, shield_block, vengeance_focused_rage, mark_of_bleeding_hollow
3:18.846 devastate Fluffy_Pillow 3.6/100: 4% rage archmages_greater_incandescence_str, focused_rage, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow
3:20.220 devastate Fluffy_Pillow 3.6/100: 4% rage archmages_greater_incandescence_str, focused_rage, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow
3:21.596 devastate Fluffy_Pillow 3.6/100: 4% rage archmages_greater_incandescence_str, focused_rage, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow
3:22.972 devastate Fluffy_Pillow 3.6/100: 4% rage archmages_greater_incandescence_str, focused_rage, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow
3:24.346 revenge Fluffy_Pillow 7.2/100: 7% rage archmages_greater_incandescence_str, focused_rage, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow
3:25.720 intercept Fluffy_Pillow 12.2/100: 12% rage archmages_greater_incandescence_str, focused_rage, vengeance_ignore_pain, mark_of_bleeding_hollow
3:25.720 shield_block Fluffy_Pillow 32.2/100: 32% rage archmages_greater_incandescence_str, focused_rage, vengeance_ignore_pain, mark_of_bleeding_hollow
3:25.720 shield_slam Fluffy_Pillow 22.2/100: 22% rage archmages_greater_incandescence_str, focused_rage, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow
3:27.094 ignore_pain Ylvi 37.2/100: 37% rage shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow
3:27.094 devastate Fluffy_Pillow 0.0/100: 0% rage ignore_pain, shield_block, vengeance_focused_rage, mark_of_bleeding_hollow
3:28.469 devastate Fluffy_Pillow 0.0/100: 0% rage shield_block, vengeance_focused_rage, mark_of_bleeding_hollow
3:29.843 devastate Fluffy_Pillow 0.0/100: 0% rage shield_block, vengeance_focused_rage
3:31.218 last_stand Fluffy_Pillow 0.0/100: 0% rage shield_block, vengeance_focused_rage
3:31.218 shield_slam Fluffy_Pillow 0.0/100: 0% rage last_stand, shield_block, vengeance_focused_rage
3:32.593 focused_rage Fluffy_Pillow 15.0/100: 15% rage last_stand, shield_block, vengeance_focused_rage
3:32.593 devastate Fluffy_Pillow 0.0/100: 0% rage focused_rage, last_stand, shield_block, vengeance_ignore_pain
3:33.968 devastate Fluffy_Pillow 0.0/100: 0% rage focused_rage, last_stand, shield_block, vengeance_ignore_pain
3:35.342 devastate Fluffy_Pillow 0.0/100: 0% rage focused_rage, last_stand, vengeance_ignore_pain
3:36.717 revenge Fluffy_Pillow 3.6/100: 4% rage focused_rage, last_stand, vengeance_ignore_pain
3:38.093 devastate Fluffy_Pillow 8.6/100: 9% rage focused_rage, last_stand, vengeance_ignore_pain
3:39.466 devastate Fluffy_Pillow 8.6/100: 9% rage focused_rage, last_stand, vengeance_ignore_pain
3:40.841 devastate Fluffy_Pillow 8.6/100: 9% rage focused_rage, last_stand, vengeance_ignore_pain
3:42.215 revenge Fluffy_Pillow 8.6/100: 9% rage focused_rage, last_stand, vengeance_ignore_pain
3:43.590 shield_block Fluffy_Pillow 17.2/100: 17% rage archmages_greater_incandescence_str, focused_rage, last_stand, vengeance_ignore_pain
3:43.590 shield_slam Fluffy_Pillow 7.2/100: 7% rage archmages_greater_incandescence_str, focused_rage, last_stand, shield_block, vengeance_ignore_pain
3:44.966 devastate Fluffy_Pillow 22.2/100: 22% rage archmages_greater_incandescence_str, last_stand, shield_block, vengeance_ignore_pain
3:46.341 intercept Fluffy_Pillow 22.2/100: 22% rage archmages_greater_incandescence_str, shield_block, vengeance_ignore_pain
3:46.341 ignore_pain Ylvi 42.2/100: 42% rage archmages_greater_incandescence_str, shield_block, vengeance_ignore_pain
3:46.341 devastate Fluffy_Pillow 0.0/100: 0% rage archmages_greater_incandescence_str, ignore_pain, shield_block, vengeance_focused_rage
3:47.714 devastate Fluffy_Pillow 3.6/100: 4% rage archmages_greater_incandescence_str, ignore_pain, shield_block, vengeance_focused_rage
3:49.087 revenge Fluffy_Pillow 7.2/100: 7% rage archmages_greater_incandescence_str, shield_block, vengeance_focused_rage
3:50.463 shield_block Fluffy_Pillow 12.2/100: 12% rage archmages_greater_incandescence_str, shield_block, vengeance_focused_rage
3:50.463 devastate Fluffy_Pillow 2.2/100: 2% rage archmages_greater_incandescence_str, shield_block, vengeance_focused_rage
3:51.836 shield_slam Fluffy_Pillow 5.8/100: 6% rage archmages_greater_incandescence_str, shield_block, vengeance_focused_rage
3:53.209 focused_rage Fluffy_Pillow 20.8/100: 21% rage shield_block, vengeance_focused_rage
3:53.209 devastate Fluffy_Pillow 5.8/100: 6% rage focused_rage, shield_block, vengeance_ignore_pain
3:54.583 devastate Fluffy_Pillow 9.4/100: 9% rage focused_rage, shield_block, vengeance_ignore_pain
3:55.957 devastate Fluffy_Pillow 9.4/100: 9% rage focused_rage, shield_block, vengeance_ignore_pain
3:57.330 revenge Fluffy_Pillow 9.4/100: 9% rage focused_rage, shield_block, vengeance_ignore_pain
3:58.705 devastate Fluffy_Pillow 14.4/100: 14% rage focused_rage, vengeance_ignore_pain
4:00.079 devastate Fluffy_Pillow 14.4/100: 14% rage focused_rage, vengeance_ignore_pain
4:01.453 use_item_purified_shard_of_the_third_moon Fluffy_Pillow 18.0/100: 18% rage focused_rage, vengeance_ignore_pain
4:01.453 shield_block Fluffy_Pillow 18.0/100: 18% rage focused_rage, vengeance_ignore_pain, bulwark_of_purity
4:01.453 shield_slam Fluffy_Pillow 8.0/100: 8% rage focused_rage, shield_block, vengeance_ignore_pain, bulwark_of_purity
4:02.826 devastate Fluffy_Pillow 23.0/100: 23% rage archmages_greater_incandescence_str, shield_block, vengeance_ignore_pain, bulwark_of_purity
4:04.201 devastate Fluffy_Pillow 23.0/100: 23% rage archmages_greater_incandescence_str, shield_block, vengeance_ignore_pain, bulwark_of_purity
4:05.575 devastate Fluffy_Pillow 23.0/100: 23% rage archmages_greater_incandescence_str, shield_block, vengeance_ignore_pain, bulwark_of_purity
4:06.950 intercept Fluffy_Pillow 23.0/100: 23% rage archmages_greater_incandescence_str, shield_block, vengeance_ignore_pain
4:06.950 ignore_pain Ylvi 43.0/100: 43% rage archmages_greater_incandescence_str, shield_block, vengeance_ignore_pain
4:06.950 battle_cry Fluffy_Pillow 0.0/100: 0% rage archmages_greater_incandescence_str, ignore_pain, shield_block, vengeance_focused_rage
4:06.950 revenge Fluffy_Pillow 0.0/100: 0% rage archmages_greater_incandescence_str, ignore_pain, battle_cry, shield_block, vengeance_focused_rage
4:08.325 devastate Fluffy_Pillow 5.0/100: 5% rage archmages_greater_incandescence_str, battle_cry, shield_block, vengeance_focused_rage
4:09.700 shield_slam Fluffy_Pillow 5.0/100: 5% rage archmages_greater_incandescence_str, battle_cry, vengeance_focused_rage
4:11.074 focused_rage Fluffy_Pillow 23.6/100: 24% rage archmages_greater_incandescence_str, ultimatum, battle_cry, vengeance_focused_rage
4:11.074 devastate Fluffy_Pillow 23.6/100: 24% rage archmages_greater_incandescence_str, focused_rage, battle_cry, vengeance_ignore_pain
4:12.448 shield_block Fluffy_Pillow 23.6/100: 24% rage focused_rage, vengeance_ignore_pain
4:12.557 devastate Fluffy_Pillow 13.6/100: 14% rage archmages_greater_incandescence_str, focused_rage, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow
4:13.933 devastate Fluffy_Pillow 13.6/100: 14% rage archmages_greater_incandescence_str, focused_rage, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow
4:15.308 revenge Fluffy_Pillow 17.2/100: 17% rage archmages_greater_incandescence_str, focused_rage, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow
4:16.680 devastate Fluffy_Pillow 22.2/100: 22% rage archmages_greater_incandescence_str, focused_rage, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow
4:18.055 shield_slam Fluffy_Pillow 25.8/100: 26% rage archmages_greater_incandescence_str, focused_rage, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow
4:19.432 ignore_pain Ylvi 40.8/100: 41% rage archmages_greater_incandescence_str, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow
4:19.432 devastate Fluffy_Pillow 0.0/100: 0% rage archmages_greater_incandescence_str, ignore_pain, shield_block, vengeance_focused_rage, mark_of_bleeding_hollow
4:20.806 devastate Fluffy_Pillow 3.6/100: 4% rage archmages_greater_incandescence_str, vengeance_focused_rage, mark_of_bleeding_hollow
4:22.180 shield_wall Fluffy_Pillow 7.2/100: 7% rage archmages_greater_incandescence_str, vengeance_focused_rage, mark_of_bleeding_hollow
4:22.180 devastate Fluffy_Pillow 7.2/100: 7% rage archmages_greater_incandescence_str, shield_wall, vengeance_focused_rage, mark_of_bleeding_hollow
4:23.555 revenge Fluffy_Pillow 7.2/100: 7% rage shield_wall, vengeance_focused_rage, mark_of_bleeding_hollow
4:24.930 shield_block Fluffy_Pillow 15.8/100: 16% rage archmages_greater_incandescence_str, shield_wall, vengeance_focused_rage, mark_of_bleeding_hollow
4:24.930 shield_slam Fluffy_Pillow 5.8/100: 6% rage archmages_greater_incandescence_str, shield_block, shield_wall, vengeance_focused_rage, mark_of_bleeding_hollow
4:26.305 focused_rage Fluffy_Pillow 20.8/100: 21% rage archmages_greater_incandescence_str, ultimatum, shield_block, shield_wall, vengeance_focused_rage, mark_of_bleeding_hollow
4:26.305 devastate Fluffy_Pillow 20.8/100: 21% rage archmages_greater_incandescence_str, focused_rage, shield_block, shield_wall, vengeance_ignore_pain, mark_of_bleeding_hollow
4:27.679 intercept Fluffy_Pillow 24.4/100: 24% rage archmages_greater_incandescence_str, focused_rage, shield_block, shield_wall, vengeance_ignore_pain, mark_of_bleeding_hollow
4:27.679 ignore_pain Ylvi 44.4/100: 44% rage archmages_greater_incandescence_str, focused_rage, shield_block, shield_wall, vengeance_ignore_pain, mark_of_bleeding_hollow
4:27.679 devastate Fluffy_Pillow 0.0/100: 0% rage archmages_greater_incandescence_str, focused_rage, ignore_pain, shield_block, shield_wall, vengeance_focused_rage, mark_of_bleeding_hollow
4:29.054 devastate Fluffy_Pillow 0.0/100: 0% rage archmages_greater_incandescence_str, focused_rage, shield_block, shield_wall, vengeance_focused_rage, mark_of_bleeding_hollow
4:30.429 devastate Fluffy_Pillow 3.6/100: 4% rage archmages_greater_incandescence_str, focused_rage, shield_block, vengeance_focused_rage, mark_of_bleeding_hollow
4:31.803 revenge Fluffy_Pillow 7.2/100: 7% rage archmages_greater_incandescence_str, focused_rage, shield_block, vengeance_focused_rage, mark_of_bleeding_hollow
4:33.178 shield_slam Fluffy_Pillow 12.2/100: 12% rage archmages_greater_incandescence_str, focused_rage, vengeance_focused_rage, mark_of_bleeding_hollow
4:34.553 focused_rage Fluffy_Pillow 27.2/100: 27% rage vengeance_focused_rage, mark_of_bleeding_hollow
4:34.553 devastate Fluffy_Pillow 12.2/100: 12% rage focused_rage, vengeance_ignore_pain, mark_of_bleeding_hollow
4:35.928 devastate Fluffy_Pillow 12.2/100: 12% rage focused_rage, vengeance_ignore_pain, mark_of_bleeding_hollow
4:37.302 shield_block Fluffy_Pillow 12.2/100: 12% rage focused_rage, vengeance_ignore_pain, mark_of_bleeding_hollow
4:37.302 devastate Fluffy_Pillow 2.2/100: 2% rage focused_rage, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow
4:38.674 demoralizing_shout Fluffy_Pillow 2.2/100: 2% rage focused_rage, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow
4:38.674 devastate Fluffy_Pillow 2.2/100: 2% rage demoralizing_shout, focused_rage, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow
4:40.049 revenge Fluffy_Pillow 2.2/100: 2% rage demoralizing_shout, focused_rage, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow
4:41.423 shield_slam Fluffy_Pillow 10.8/100: 11% rage demoralizing_shout, focused_rage, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow
4:42.798 devastate Fluffy_Pillow 25.8/100: 26% rage demoralizing_shout, shield_block, vengeance_ignore_pain
4:44.173 devastate Fluffy_Pillow 29.4/100: 29% rage demoralizing_shout, shield_block, vengeance_ignore_pain
4:45.548 devastate Fluffy_Pillow 29.4/100: 29% rage demoralizing_shout, vengeance_ignore_pain
4:46.922 ignore_pain Ylvi 33.0/100: 33% rage vengeance_ignore_pain
4:46.922 devastate Fluffy_Pillow 0.0/100: 0% rage ignore_pain, vengeance_focused_rage
4:48.297 intercept Fluffy_Pillow 0.0/100: 0% rage vengeance_focused_rage
4:48.297 shield_block Fluffy_Pillow 20.0/100: 20% rage vengeance_focused_rage
4:48.297 revenge Fluffy_Pillow 10.0/100: 10% rage shield_block, vengeance_focused_rage
4:49.673 focused_rage Fluffy_Pillow 15.0/100: 15% rage shield_block, vengeance_focused_rage
4:49.673 shield_slam Fluffy_Pillow 0.0/100: 0% rage focused_rage, shield_block, vengeance_ignore_pain
4:51.048 devastate Fluffy_Pillow 18.6/100: 19% rage shield_block, vengeance_ignore_pain
4:52.423 devastate Fluffy_Pillow 18.6/100: 19% rage shield_block, vengeance_ignore_pain
4:53.798 devastate Fluffy_Pillow 22.2/100: 22% rage shield_block, vengeance_ignore_pain
4:55.172 revenge Fluffy_Pillow 25.8/100: 26% rage shield_block, vengeance_ignore_pain
4:56.547 ignore_pain Ylvi 30.8/100: 31% rage vengeance_ignore_pain, mark_of_bleeding_hollow
4:56.547 devastate Fluffy_Pillow 0.0/100: 0% rage ignore_pain, vengeance_focused_rage, mark_of_bleeding_hollow
4:57.923 devastate Fluffy_Pillow 0.0/100: 0% rage vengeance_focused_rage, mark_of_bleeding_hollow
4:59.297 devastate Fluffy_Pillow 0.0/100: 0% rage vengeance_focused_rage, mark_of_bleeding_hollow
5:00.670 devastate Fluffy_Pillow 0.0/100: 0% rage vengeance_focused_rage, mark_of_bleeding_hollow
5:02.044 use_item_purified_shard_of_the_third_moon Fluffy_Pillow 0.0/100: 0% rage vengeance_focused_rage, mark_of_bleeding_hollow
5:02.044 last_stand Fluffy_Pillow 0.0/100: 0% rage vengeance_focused_rage, mark_of_bleeding_hollow, bulwark_of_purity
5:02.044 devastate Fluffy_Pillow 0.0/100: 0% rage last_stand, vengeance_focused_rage, mark_of_bleeding_hollow, bulwark_of_purity
5:03.420 revenge Fluffy_Pillow 0.0/100: 0% rage last_stand, vengeance_focused_rage, mark_of_bleeding_hollow
5:04.795 devastate Fluffy_Pillow 8.6/100: 9% rage last_stand, vengeance_focused_rage, mark_of_bleeding_hollow
5:06.170 devastate Fluffy_Pillow 8.6/100: 9% rage last_stand, vengeance_focused_rage, mark_of_bleeding_hollow
5:07.544 battle_cry Fluffy_Pillow 8.6/100: 9% rage last_stand, vengeance_focused_rage
5:07.544 devastate Fluffy_Pillow 8.6/100: 9% rage last_stand, battle_cry, vengeance_focused_rage
5:08.918 intercept Fluffy_Pillow 8.6/100: 9% rage last_stand, battle_cry, vengeance_focused_rage
5:08.918 shield_block Fluffy_Pillow 28.6/100: 29% rage last_stand, battle_cry, vengeance_focused_rage
5:08.918 focused_rage Fluffy_Pillow 18.6/100: 19% rage last_stand, battle_cry, shield_block, vengeance_focused_rage
5:08.918 shield_slam Fluffy_Pillow 3.6/100: 4% rage focused_rage, last_stand, battle_cry, shield_block, vengeance_ignore_pain
5:10.293 ignore_pain Ylvi 18.6/100: 19% rage ultimatum, last_stand, battle_cry, shield_block, vengeance_ignore_pain
5:10.293 focused_rage Fluffy_Pillow 0.0/100: 0% rage ultimatum, last_stand, ignore_pain, battle_cry, shield_block, vengeance_focused_rage
5:10.293 devastate Fluffy_Pillow 0.0/100: 0% rage focused_rage, last_stand, ignore_pain, battle_cry, shield_block, vengeance_ignore_pain
5:11.667 shield_slam Fluffy_Pillow 3.6/100: 4% rage focused_rage, last_stand, ignore_pain, battle_cry, shield_block, vengeance_ignore_pain
5:13.042 shield_block Fluffy_Pillow 18.6/100: 19% rage ultimatum, last_stand, shield_block, vengeance_ignore_pain
5:13.042 devastate Fluffy_Pillow 8.6/100: 9% rage ultimatum, last_stand, shield_block, vengeance_ignore_pain
5:14.414 ignore_pain Ylvi 12.2/100: 12% rage ultimatum, last_stand, shield_block, vengeance_ignore_pain
5:14.414 focused_rage Fluffy_Pillow 0.0/100: 0% rage ultimatum, last_stand, ignore_pain, shield_block, vengeance_focused_rage
5:14.414 devastate Fluffy_Pillow 0.0/100: 0% rage focused_rage, last_stand, ignore_pain, shield_block, vengeance_ignore_pain
5:15.789 shield_slam Fluffy_Pillow 0.0/100: 0% rage focused_rage, last_stand, ignore_pain, shield_block, vengeance_ignore_pain
5:17.164 devastate Fluffy_Pillow 18.6/100: 19% rage shield_block, vengeance_ignore_pain
5:18.539 devastate Fluffy_Pillow 22.2/100: 22% rage shield_block, vengeance_ignore_pain
5:19.915 devastate Fluffy_Pillow 22.2/100: 22% rage shield_block, vengeance_ignore_pain
5:21.289 shield_slam Fluffy_Pillow 22.2/100: 22% rage shield_block, vengeance_ignore_pain
5:22.665 ignore_pain Ylvi 37.2/100: 37% rage shield_block, vengeance_ignore_pain
5:22.665 devastate Fluffy_Pillow 0.0/100: 0% rage ignore_pain, shield_block, vengeance_focused_rage
5:24.039 shield_slam Fluffy_Pillow 0.0/100: 0% rage shield_block, vengeance_focused_rage
5:25.414 shield_block Fluffy_Pillow 18.6/100: 19% rage ultimatum, shield_block, vengeance_focused_rage
5:25.414 focused_rage Fluffy_Pillow 8.6/100: 9% rage ultimatum, shield_block, vengeance_focused_rage
5:25.414 devastate Fluffy_Pillow 8.6/100: 9% rage focused_rage, shield_block, vengeance_ignore_pain
5:26.788 devastate Fluffy_Pillow 8.6/100: 9% rage focused_rage, shield_block, vengeance_ignore_pain
5:28.161 devastate Fluffy_Pillow 8.6/100: 9% rage focused_rage, shield_block, vengeance_ignore_pain
5:29.535 intercept Fluffy_Pillow 8.6/100: 9% rage focused_rage, shield_block, vengeance_ignore_pain
5:29.535 revenge Fluffy_Pillow 28.6/100: 29% rage focused_rage, shield_block, vengeance_ignore_pain
5:30.910 ignore_pain Ylvi 37.2/100: 37% rage focused_rage, shield_block, vengeance_ignore_pain
5:30.910 devastate Fluffy_Pillow 0.0/100: 0% rage focused_rage, ignore_pain, shield_block, vengeance_focused_rage
5:32.284 shield_slam Fluffy_Pillow 0.0/100: 0% rage focused_rage, shield_block, vengeance_focused_rage
5:33.658 focused_rage Fluffy_Pillow 18.6/100: 19% rage shield_block, vengeance_focused_rage
5:33.658 devastate Fluffy_Pillow 3.6/100: 4% rage focused_rage, shield_block, vengeance_ignore_pain
5:35.033 devastate Fluffy_Pillow 7.2/100: 7% rage focused_rage, shield_block, vengeance_ignore_pain
5:36.408 devastate Fluffy_Pillow 7.2/100: 7% rage focused_rage, vengeance_ignore_pain
5:37.781 shield_block Fluffy_Pillow 10.8/100: 11% rage focused_rage, vengeance_ignore_pain
5:37.781 revenge Fluffy_Pillow 0.8/100: 1% rage focused_rage, shield_block, vengeance_ignore_pain
5:39.154 devastate Fluffy_Pillow 5.8/100: 6% rage focused_rage, shield_block, vengeance_ignore_pain
5:40.528 shield_slam Fluffy_Pillow 9.4/100: 9% rage focused_rage, shield_block, vengeance_ignore_pain
5:41.902 devastate Fluffy_Pillow 24.4/100: 24% rage shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow
5:43.274 devastate Fluffy_Pillow 24.4/100: 24% rage shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow
5:44.650 devastate Fluffy_Pillow 28.0/100: 28% rage shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow
5:46.023 revenge Fluffy_Pillow 28.0/100: 28% rage vengeance_ignore_pain, mark_of_bleeding_hollow
5:47.399 shield_block Fluffy_Pillow 36.6/100: 37% rage vengeance_ignore_pain, mark_of_bleeding_hollow
5:47.573 devastate Fluffy_Pillow 26.6/100: 27% rage shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow
5:48.948 ignore_pain Ylvi 26.6/100: 27% rage shield_block, mark_of_bleeding_hollow
5:48.948 shield_slam Fluffy_Pillow 0.0/100: 0% rage ignore_pain, shield_block, vengeance_focused_rage, mark_of_bleeding_hollow
5:50.324 intercept Fluffy_Pillow 18.6/100: 19% rage shield_block, vengeance_focused_rage, mark_of_bleeding_hollow
5:50.324 focused_rage Fluffy_Pillow 38.6/100: 39% rage shield_block, vengeance_focused_rage, mark_of_bleeding_hollow
5:50.324 devastate Fluffy_Pillow 23.6/100: 24% rage focused_rage, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow
5:51.698 devastate Fluffy_Pillow 27.2/100: 27% rage focused_rage, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow
5:53.072 devastate Fluffy_Pillow 27.2/100: 27% rage focused_rage, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow
5:54.447 revenge Fluffy_Pillow 27.2/100: 27% rage focused_rage, shield_block, vengeance_ignore_pain
5:55.822 ignore_pain Ylvi 32.2/100: 32% rage focused_rage, vengeance_ignore_pain
5:55.822 devastate Fluffy_Pillow 0.0/100: 0% rage focused_rage, ignore_pain, vengeance_focused_rage
5:57.196 devastate Fluffy_Pillow 3.6/100: 4% rage focused_rage, vengeance_focused_rage
5:58.571 devastate Fluffy_Pillow 3.6/100: 4% rage focused_rage, vengeance_focused_rage
5:59.945 devastate Fluffy_Pillow 7.2/100: 7% rage focused_rage, vengeance_focused_rage
6:01.318 shield_block Fluffy_Pillow 10.8/100: 11% rage focused_rage, vengeance_focused_rage
6:01.318 shield_slam Fluffy_Pillow 0.8/100: 1% rage focused_rage, shield_block, vengeance_focused_rage
6:02.694 use_item_purified_shard_of_the_third_moon Fluffy_Pillow 15.8/100: 16% rage shield_block, vengeance_focused_rage
6:02.694 focused_rage Fluffy_Pillow 15.8/100: 16% rage shield_block, vengeance_focused_rage, bulwark_of_purity
6:02.694 devastate Fluffy_Pillow 0.8/100: 1% rage focused_rage, shield_block, vengeance_ignore_pain, bulwark_of_purity
6:04.068 devastate Fluffy_Pillow 0.8/100: 1% rage focused_rage, shield_block, vengeance_ignore_pain, bulwark_of_purity
6:05.442 shield_slam Fluffy_Pillow 0.8/100: 1% rage focused_rage, shield_block, vengeance_ignore_pain, bulwark_of_purity
6:06.817 devastate Fluffy_Pillow 15.8/100: 16% rage shield_block, vengeance_ignore_pain
6:08.190 devastate Fluffy_Pillow 19.4/100: 19% rage shield_block, vengeance_ignore_pain
6:09.565 devastate Fluffy_Pillow 19.4/100: 19% rage shield_block, vengeance_ignore_pain
6:10.942 intercept Fluffy_Pillow 19.4/100: 19% rage vengeance_ignore_pain
6:10.942 ignore_pain Ylvi 39.4/100: 39% rage vengeance_ignore_pain
6:10.942 demoralizing_shout Fluffy_Pillow 0.0/100: 0% rage ignore_pain, vengeance_focused_rage
6:10.942 battle_cry Fluffy_Pillow 0.0/100: 0% rage demoralizing_shout, ignore_pain, vengeance_focused_rage
6:10.942 revenge Fluffy_Pillow 0.0/100: 0% rage demoralizing_shout, ignore_pain, battle_cry, vengeance_focused_rage
6:12.316 devastate Fluffy_Pillow 5.0/100: 5% rage demoralizing_shout, battle_cry, vengeance_focused_rage
6:13.691 devastate Fluffy_Pillow 8.6/100: 9% rage archmages_greater_incandescence_str, demoralizing_shout, battle_cry, vengeance_focused_rage
6:15.065 devastate Fluffy_Pillow 8.6/100: 9% rage archmages_greater_incandescence_str, demoralizing_shout, battle_cry, vengeance_focused_rage
6:16.440 shield_block Fluffy_Pillow 12.2/100: 12% rage archmages_greater_incandescence_str, demoralizing_shout, vengeance_focused_rage
6:16.440 shield_slam Fluffy_Pillow 2.2/100: 2% rage archmages_greater_incandescence_str, demoralizing_shout, shield_block, vengeance_focused_rage
6:17.815 focused_rage Fluffy_Pillow 17.2/100: 17% rage archmages_greater_incandescence_str, demoralizing_shout, shield_block, vengeance_focused_rage
6:17.815 devastate Fluffy_Pillow 2.2/100: 2% rage archmages_greater_incandescence_str, demoralizing_shout, focused_rage, shield_block, vengeance_ignore_pain
6:19.188 devastate Fluffy_Pillow 2.2/100: 2% rage archmages_greater_incandescence_str, focused_rage, shield_block, vengeance_ignore_pain
6:20.562 devastate Fluffy_Pillow 2.2/100: 2% rage archmages_greater_incandescence_str, focused_rage, shield_block, vengeance_ignore_pain
6:21.936 revenge Fluffy_Pillow 2.2/100: 2% rage archmages_greater_incandescence_str, focused_rage, shield_block, vengeance_ignore_pain
6:23.311 devastate Fluffy_Pillow 7.2/100: 7% rage focused_rage, shield_block, vengeance_ignore_pain
6:24.686 devastate Fluffy_Pillow 7.2/100: 7% rage focused_rage, vengeance_ignore_pain
6:26.061 devastate Fluffy_Pillow 7.2/100: 7% rage focused_rage, vengeance_ignore_pain
6:27.434 devastate Fluffy_Pillow 7.2/100: 7% rage focused_rage, vengeance_ignore_pain
6:28.809 devastate Fluffy_Pillow 7.2/100: 7% rage focused_rage, vengeance_ignore_pain, mark_of_bleeding_hollow
6:30.183 shield_block Fluffy_Pillow 10.8/100: 11% rage focused_rage, vengeance_ignore_pain, mark_of_bleeding_hollow
6:30.183 shield_slam Fluffy_Pillow 0.8/100: 1% rage focused_rage, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow
6:31.558 intercept Fluffy_Pillow 15.8/100: 16% rage shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow
6:31.558 ignore_pain Ylvi 35.8/100: 36% rage shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow
6:31.558 devastate Fluffy_Pillow 0.0/100: 0% rage ignore_pain, shield_block, vengeance_focused_rage, mark_of_bleeding_hollow
6:32.932 devastate Fluffy_Pillow 3.6/100: 4% rage shield_block, vengeance_focused_rage, mark_of_bleeding_hollow
6:34.307 devastate Fluffy_Pillow 7.2/100: 7% rage shield_block, vengeance_focused_rage, mark_of_bleeding_hollow
6:35.680 revenge Fluffy_Pillow 7.2/100: 7% rage shield_block, vengeance_focused_rage, mark_of_bleeding_hollow
6:37.055 shield_block Fluffy_Pillow 12.2/100: 12% rage shield_block, vengeance_focused_rage, mark_of_bleeding_hollow
6:37.055 devastate Fluffy_Pillow 2.2/100: 2% rage shield_block, vengeance_focused_rage, mark_of_bleeding_hollow
6:38.427 shield_slam Fluffy_Pillow 2.2/100: 2% rage shield_block, vengeance_focused_rage, mark_of_bleeding_hollow
6:39.801 focused_rage Fluffy_Pillow 17.2/100: 17% rage shield_block, vengeance_focused_rage, mark_of_bleeding_hollow
6:39.801 devastate Fluffy_Pillow 2.2/100: 2% rage focused_rage, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow
6:41.175 devastate Fluffy_Pillow 2.2/100: 2% rage focused_rage, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow
6:42.551 devastate Fluffy_Pillow 5.8/100: 6% rage focused_rage, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow
6:43.925 revenge Fluffy_Pillow 9.4/100: 9% rage focused_rage, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow
6:45.300 revenge Fluffy_Pillow 18.0/100: 18% rage focused_rage, vengeance_ignore_pain, mark_of_bleeding_hollow
6:46.673 devastate Fluffy_Pillow 23.0/100: 23% rage focused_rage, vengeance_ignore_pain, mark_of_bleeding_hollow
6:48.046 shield_block Fluffy_Pillow 26.6/100: 27% rage focused_rage, vengeance_ignore_pain, mark_of_bleeding_hollow
6:48.046 shield_slam Fluffy_Pillow 16.6/100: 17% rage focused_rage, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow
6:49.420 ignore_pain Ylvi 31.6/100: 32% rage ultimatum, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow
6:49.420 focused_rage Fluffy_Pillow 0.0/100: 0% rage ultimatum, ignore_pain, shield_block, vengeance_focused_rage, mark_of_bleeding_hollow
6:49.420 devastate Fluffy_Pillow 0.0/100: 0% rage focused_rage, ignore_pain, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow
6:50.795 devastate Fluffy_Pillow 0.0/100: 0% rage focused_rage, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow
6:52.172 intercept Fluffy_Pillow 0.0/100: 0% rage focused_rage, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow
6:52.172 devastate Fluffy_Pillow 20.0/100: 20% rage focused_rage, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow
6:53.548 shield_slam Fluffy_Pillow 20.0/100: 20% rage focused_rage, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow
6:54.921 ignore_pain Ylvi 35.0/100: 35% rage shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow
6:54.921 devastate Fluffy_Pillow 0.0/100: 0% rage ignore_pain, shield_block, vengeance_focused_rage, mark_of_bleeding_hollow
6:56.295 last_stand Fluffy_Pillow 3.6/100: 4% rage archmages_greater_incandescence_str, shield_block, vengeance_focused_rage, mark_of_bleeding_hollow
6:56.295 devastate Fluffy_Pillow 3.6/100: 4% rage archmages_greater_incandescence_str, last_stand, shield_block, vengeance_focused_rage, mark_of_bleeding_hollow
6:57.668 devastate Fluffy_Pillow 3.6/100: 4% rage archmages_greater_incandescence_str, last_stand, vengeance_focused_rage, mark_of_bleeding_hollow
6:59.042 revenge Fluffy_Pillow 3.6/100: 4% rage archmages_greater_incandescence_str, last_stand, vengeance_focused_rage
7:00.415 devastate Fluffy_Pillow 8.6/100: 9% rage archmages_greater_incandescence_str, last_stand, vengeance_focused_rage
7:01.790 shield_block Fluffy_Pillow 12.2/100: 12% rage archmages_greater_incandescence_str, last_stand, vengeance_focused_rage
7:01.790 shield_slam Fluffy_Pillow 2.2/100: 2% rage archmages_greater_incandescence_str, last_stand, shield_block, vengeance_focused_rage
7:03.165 use_item_purified_shard_of_the_third_moon Fluffy_Pillow 17.2/100: 17% rage archmages_greater_incandescence_str, last_stand, shield_block, vengeance_focused_rage
7:03.165 focused_rage Fluffy_Pillow 17.2/100: 17% rage archmages_greater_incandescence_str, last_stand, shield_block, vengeance_focused_rage, bulwark_of_purity
7:03.165 devastate Fluffy_Pillow 2.2/100: 2% rage archmages_greater_incandescence_str, focused_rage, last_stand, shield_block, vengeance_ignore_pain, bulwark_of_purity
7:04.540 devastate Fluffy_Pillow 2.2/100: 2% rage archmages_greater_incandescence_str, focused_rage, last_stand, shield_block, vengeance_ignore_pain, bulwark_of_purity
7:05.914 shield_slam Fluffy_Pillow 2.2/100: 2% rage archmages_greater_incandescence_str, focused_rage, last_stand, shield_block, vengeance_ignore_pain, bulwark_of_purity
7:07.289 ignore_pain Ylvi 17.2/100: 17% rage ultimatum, last_stand, shield_block, vengeance_ignore_pain
7:07.289 focused_rage Fluffy_Pillow 0.0/100: 0% rage ultimatum, last_stand, ignore_pain, shield_block, vengeance_focused_rage
7:07.289 devastate Fluffy_Pillow 0.0/100: 0% rage focused_rage, last_stand, ignore_pain, shield_block, vengeance_ignore_pain
7:08.661 devastate Fluffy_Pillow 3.6/100: 4% rage focused_rage, last_stand, shield_block, vengeance_ignore_pain
7:10.036 devastate Fluffy_Pillow 3.6/100: 4% rage focused_rage, last_stand, shield_block, vengeance_ignore_pain
7:11.410 battle_cry Fluffy_Pillow 7.2/100: 7% rage focused_rage, vengeance_ignore_pain
7:11.410 revenge Fluffy_Pillow 7.2/100: 7% rage focused_rage, battle_cry, vengeance_ignore_pain
7:12.785 intercept Fluffy_Pillow 15.8/100: 16% rage focused_rage, battle_cry, vengeance_ignore_pain
7:12.785 shield_block Fluffy_Pillow 35.8/100: 36% rage focused_rage, battle_cry, vengeance_ignore_pain
7:12.785 revenge Fluffy_Pillow 25.8/100: 26% rage focused_rage, battle_cry, shield_block, vengeance_ignore_pain
7:14.158 ignore_pain Ylvi 30.8/100: 31% rage focused_rage, battle_cry, shield_block, vengeance_ignore_pain
7:14.158 shield_slam Fluffy_Pillow 0.0/100: 0% rage focused_rage, ignore_pain, battle_cry, shield_block, vengeance_focused_rage
7:15.532 focused_rage Fluffy_Pillow 18.6/100: 19% rage ultimatum, ignore_pain, battle_cry, shield_block, vengeance_focused_rage
7:15.532 devastate Fluffy_Pillow 18.6/100: 19% rage focused_rage, ignore_pain, battle_cry, shield_block, vengeance_ignore_pain
7:16.906 devastate Fluffy_Pillow 22.2/100: 22% rage focused_rage, shield_block, vengeance_ignore_pain
7:18.280 devastate Fluffy_Pillow 22.2/100: 22% rage focused_rage, shield_block, vengeance_ignore_pain
7:19.654 shield_slam Fluffy_Pillow 22.2/100: 22% rage focused_rage, shield_block, vengeance_ignore_pain
7:21.028 ignore_pain Ylvi 37.2/100: 37% rage archmages_greater_incandescence_str, shield_block, vengeance_ignore_pain, mark_of_bleeding_hollow
7:21.028 devastate Fluffy_Pillow 0.0/100: 0% rage archmages_greater_incandescence_str, ignore_pain, shield_block, vengeance_focused_rage, mark_of_bleeding_hollow
7:22.402 devastate Fluffy_Pillow 3.6/100: 4% rage archmages_greater_incandescence_str, vengeance_focused_rage, mark_of_bleeding_hollow
7:23.775 devastate Fluffy_Pillow 3.6/100: 4% rage archmages_greater_incandescence_str, vengeance_focused_rage, mark_of_bleeding_hollow
7:25.150 revenge Fluffy_Pillow 7.2/100: 7% rage archmages_greater_incandescence_str, vengeance_focused_rage, mark_of_bleeding_hollow
7:26.526 shield_block Fluffy_Pillow 15.8/100: 16% rage archmages_greater_incandescence_str, vengeance_focused_rage, mark_of_bleeding_hollow
7:26.526 devastate Fluffy_Pillow 5.8/100: 6% rage archmages_greater_incandescence_str, shield_block, vengeance_focused_rage, mark_of_bleeding_hollow

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 5745 5495 4035 (1794)
Agility 885 885 0
Stamina 8843 8843 5588
Intellect 710 710 0
Spirit 678 678 0
Health 530580 530580 0
Rage 100 100 0
Crit 22.44% 22.44% 1918
Haste 9.45% 8.20% 820
Damage / Heal Versatility 6.20% 6.20% 806
Mitigation Versatility 3.10% 3.10% 806
Attack Power 7336 7017 0
Mastery 41.53% 41.53% 2166
Armor 3226 3226 3226
Run Speed 8 0 0
Leech 3.16% 3.16% 221
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 24.11% 23.59% 1918
Tank-Block 28.54% 28.54% 0
Tank-Crit -6.00% -6.00% 0

Gear

Source Slot Average Item Level: 717.00
Local Head Faceguard of Iron Wrath
ilevel: 720, stats: { 333 Armor, +387 Str, +580 Sta, +323 Mastery, +191 Crit, +221 Leech }, gems: { +50 Mastery }
Local Neck Goreclasp Choker
ilevel: 725, stats: { +228 Str, +342 Sta, +165 Crit, +130 Haste }, enchant: { +75 Mastery }
Local Shoulders Pauldrons of Iron Wrath
ilevel: 720, stats: { 307 Armor, +290 Str, +435 Sta, +226 Crit, +160 Mastery }
Local Chest Stamped Felsteel Chestplate
ilevel: 721, stats: { 411 Armor, +390 StrInt, +585 Sta, +315 Crit, +204 Mastery }, gems: { +50 Mastery }
Local Waist Girdle of Demonic Wrath
ilevel: 720, stats: { 230 Armor, +290 StrInt, +435 Sta, +234 Mastery, +152 Haste }
Local Legs Legplates of Iron Wrath
ilevel: 720, stats: { 358 Armor, +387 Str, +580 Sta, +334 Crit, +180 Mastery }
Local Feet Shell-Resistant Stompers
ilevel: 721, stats: { 282 Armor, +292 StrInt, +439 Sta, +270 Crit, +120 Vers }
Local Wrists Felforged Vambraces
ilevel: 700, stats: { 168 Armor, +180 StrInt, +271 Sta, +120 Haste, +120 Mastery }
Local Hands Gauntlets of Iron Wrath
ilevel: 705, stats: { 244 Armor, +252 Str, +378 Sta, +204 Haste, +132 Mastery }, gems: { +50 Mastery }
Local Finger1 Spellbound Runic Band of Elemental Invincibility
ilevel: 715, stats: { +207 StrAgi, +311 Sta, +146 Mastery, +125 Vers }, enchant: { +50 Mastery }
Local Finger2 Mannoroth's Calcified Eye
ilevel: 725, stats: { +228 StrAgi, +342 Sta, +210 Vers, +93 Mastery }, enchant: { +50 Mastery }
Local Trinket1 Purified Shard of the Third Moon
ilevel: 715, stats: { +351 Vers }
Local Trinket2 Empty Drinking Horn
ilevel: 710, stats: { +311 Str }
Local Back Powerful Hexweave Cloak of the Peerless
ilevel: 725, stats: { 87 Armor, +228 Str, +342 Sta, +141 Crit, +159 Mastery }, enchant: { +100 Haste }
Local Main Hand Steelforged Saber of the Peerless
ilevel: 715, weapon: { 936 - 1740, 2.6 }, stats: { +237 Sta, +158 Str, +114 Crit, +90 Mastery }, enchant: mark_of_bleeding_hollow
Local Off Hand Felforged Aegis
ilevel: 715, stats: { 806 Armor, +207 StrInt, +311 Sta, +162 Crit, +114 Haste }
Local Tabard Ironforge Tabard
ilevel: 1

Talents

Level
15 Shockwave (Protection Warrior) Storm Bolt (Protection Warrior) Warbringer (Protection Warrior)
30 Impending Victory (Protection Warrior) Inspiring Presence (Protection Warrior) Safeguard (Protection Warrior)
45 Renewed Fury (Protection Warrior) Ultimatum (Protection Warrior) Avatar
60 Warlord's Challenge (Protection Warrior) Bounding Stride Crackling Thunder (Protection Warrior)
75 Best Served Cold (Protection Warrior) Never Surrender (Protection Warrior) Indomitable (Protection Warrior)
90 Vengeance (Protection Warrior) Into the Fray (Protection Warrior) Booming Voice (Protection Warrior)
100 Anger Management Heavy Repercussions (Protection Warrior) Ravager (Protection Warrior)

Profile

warrior="Ylvi"
origin="https://eu.api.battle.net/wow/character/hyjal/Ylvi/advanced"
thumbnail="http://eu.battle.net/static-render/eu/hyjal/177/126966449-avatar.jpg"
level=100
race=dwarf
role=tank
position=front
professions=jewelcrafting=700/mining=685
talents=http://eu.battle.net/wow/en/tool/talent-calculator#Zb!0111201
spec=protection

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=greater_draenic_strength_flask
actions.precombat+=/food,type=buttered_sturgeon
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=draenic_strength

# Executed every time the actor is available.
actions=intercept
actions+=/auto_attack
actions+=/use_item,name=purified_shard_of_the_third_moon
actions+=/blood_fury
actions+=/berserking
actions+=/arcane_torrent
actions+=/call_action_list,name=prot

actions.prot=shield_block,if=!buff.neltharions_fury.up&((cooldown.shield_slam.remains<6&!buff.shield_block.up)|(cooldown.shield_slam.remains<6+buff.shield_block.remains&buff.shield_block.up))
actions.prot+=/ignore_pain,if=(rage>=60&!talent.vengeance.enabled)|(buff.vengeance_ignore_pain.up&buff.ultimatum.up)|(buff.vengeance_ignore_pain.up&rage>=30)|(talent.vengeance.enabled&!buff.ultimatum.up&!buff.vengeance_ignore_pain.up&!buff.vengeance_focused_rage.up&rage<30)
actions.prot+=/focused_rage,if=(buff.vengeance_focused_rage.up&!buff.vengeance_ignore_pain.up)|(buff.ultimatum.up&buff.vengeance_focused_rage.up&!buff.vengeance_ignore_pain.up)|(talent.vengeance.enabled&buff.ultimatum.up&!buff.vengeance_ignore_pain.up&!buff.vengeance_focused_rage.up)|(talent.vengeance.enabled&!buff.vengeance_ignore_pain.up&!buff.vengeance_focused_rage.up&rage>=30)|(buff.ultimatum.up&buff.vengeance_ignore_pain.up&cooldown.shield_slam.remains=0&rage<10)|(rage>=100)
actions.prot+=/demoralizing_shout,if=incoming_damage_2500ms>health.max*0.20
actions.prot+=/shield_wall,if=incoming_damage_2500ms>health.max*0.50
actions.prot+=/last_stand,if=incoming_damage_2500ms>health.max*0.50&!cooldown.shield_wall.remains=0
actions.prot+=/potion,name=draenic_strength,if=(incoming_damage_2500ms>health.max*0.15&!buff.potion.up)|target.time_to_die<=25
actions.prot+=/call_action_list,name=prot_aoe,if=spell_targets.neltharions_fury>=2
actions.prot+=/focused_rage,if=talent.ultimatum.enabled&buff.ultimatum.up&!talent.vengeance.enabled
actions.prot+=/battle_cry,if=(talent.vengeance.enabled&talent.ultimatum.enabled&cooldown.shield_slam.remains<=5-gcd.max-0.5)|!talent.vengeance.enabled
actions.prot+=/demoralizing_shout,if=talent.booming_voice.enabled&buff.battle_cry.up
actions.prot+=/ravager,if=talent.ravager.enabled&buff.battle_cry.up
actions.prot+=/neltharions_fury,if=incoming_damage_2500ms>health.max*0.20&!buff.shield_block.up
actions.prot+=/shield_slam,if=!(cooldown.shield_block.remains<=gcd.max*2&!buff.shield_block.up&talent.heavy_repercussions.enabled)
actions.prot+=/revenge,if=cooldown.shield_slam.remains<=gcd.max*2
actions.prot+=/devastate

actions.prot_aoe=focused_rage,if=talent.ultimatum.enabled&buff.ultimatum.up&!talent.vengeance.enabled
actions.prot_aoe+=/battle_cry,if=(talent.vengeance.enabled&talent.ultimatum.enabled&cooldown.shield_slam.remains<=5-gcd.max-0.5)|!talent.vengeance.enabled
actions.prot_aoe+=/demoralizing_shout,if=talent.booming_voice.enabled&buff.battle_cry.up
actions.prot_aoe+=/ravager,if=talent.ravager.enabled&buff.battle_cry.up
actions.prot_aoe+=/neltharions_fury,if=buff.battle_cry.up
actions.prot_aoe+=/shield_slam,if=!(cooldown.shield_block.remains<=gcd.max*2&!buff.shield_block.up&talent.heavy_repercussions.enabled)
actions.prot_aoe+=/revenge
actions.prot_aoe+=/thunder_clap,if=spell_targets.thunder_clap>=3
actions.prot_aoe+=/devastate

head=faceguard_of_iron_wrath,id=124334,bonus_id=564/41/566,upgrade=2,gems=50mastery
neck=goreclasp_choker,id=109963,bonus_id=642/758,upgrade=2,enchant=75mastery
shoulders=pauldrons_of_iron_wrath,id=124346,bonus_id=566,upgrade=2
back=powerful_hexweave_cloak,id=114817,bonus_id=618/537/52,upgrade=2,enchant=gift_of_haste
chest=stamped_felsteel_chestplate,id=124315,bonus_id=561/564/566,upgrade=2,gems=50mastery
tabard=ironforge_tabard,id=45577
wrists=felforged_vambraces,id=138159,bonus_id=3387/3388
hands=gauntlets_of_iron_wrath,id=124329,bonus_id=563,upgrade=2,gems=50mastery
waist=girdle_of_demonic_wrath,id=124350,bonus_id=566,upgrade=2
legs=legplates_of_iron_wrath,id=124340,bonus_id=566,upgrade=2
feet=shellresistant_stompers,id=124320,bonus_id=561/566,upgrade=2
finger1=spellbound_runic_band_of_elemental_invincibility,id=118308,enchant=50mastery
finger2=mannoroths_calcified_eye,id=124204,bonus_id=566,upgrade=2,enchant=50mastery
trinket1=purified_shard_of_the_third_moon,id=133598
trinket2=empty_drinking_horn,id=124238,upgrade=2
main_hand=steelforged_saber,id=116454,bonus_id=61/549/620,upgrade=2,enchant=mark_of_bleeding_hollow
off_hand=felforged_aegis,id=124354,bonus_id=566,upgrade=2

# Gear Summary
# gear_ilvl=717.00
# gear_strength=4035
# gear_stamina=5588
# gear_crit_rating=1918
# gear_haste_rating=820
# gear_mastery_rating=2166
# gear_versatility_rating=806
# gear_leech_rating=221
# gear_armor=3226
# set_bonus=tier18_2pc=1
# set_bonus=tier18_4pc=1

Simulation & Raid Information

Iterations: 10007
Threads: 8
Confidence: 95.00%
Fight Length: 350 - 555 ( 450.4 )

Performance:

Total Events Processed: 1103755158
Max Event Queue: 630
Sim Seconds: 4507356
CPU Seconds: 3510.1540
Physical Seconds: 546.8058
Speed Up: 1284

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
Wadzak Wadzak augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Wadzak Wadzak auto_attack_mh 0 4341985 9640 19.17 25162 50319 143.9 143.9 19.9% 0.0% 0.0% 7.5% 3.15sec 6529997 450.42sec
Wadzak Wadzak deadly_grace 188091 1440921 3199 2.26 70826 141653 17.0 17.0 20.0% 0.0% 0.0% 0.0% 5.27sec 1440921 450.42sec
Wadzak Wadzak flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Wadzak Wadzak food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Wadzak Wadzak gaseous_bubble 214972 1185021 2631 1.06 124019 248038 8.0 8.0 20.0% 0.0% 0.0% 0.0% 59.80sec 1185021 450.42sec
Wadzak Wadzak potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Decalang Decalang augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Decalang Decalang auto_attack_mh 0 3290074 7304 29.79 14752 29503 223.7 223.7 18.7% 19.0% 0.0% 0.0% 2.02sec 4836720 450.42sec
Decalang Decalang auto_attack_oh 1 1647890 3659 29.79 7395 14792 223.7 223.7 18.7% 19.1% 0.0% 0.0% 2.02sec 2422555 450.42sec
Decalang Decalang avalanche 207150 1586574 3522 8.13 21921 43835 61.1 61.1 18.5% 0.0% 0.0% 0.0% 7.19sec 1586574 450.42sec
Decalang Decalang caber_toss 193347 782 2 0.40 218 436 3.0 3.0 18.8% 0.0% 0.0% 0.0% 180.33sec 1150 450.42sec
Decalang Decalang crystalline_swords 205165 3883673 8622 9.82 44420 88860 73.7 73.7 18.6% 0.0% 0.0% 0.0% 12.11sec 3883673 450.42sec
Decalang Decalang deadly_grace 188091 1685265 3742 3.04 62245 124490 22.8 22.8 18.6% 0.0% 0.0% 0.0% 3.83sec 1685265 450.42sec
Decalang Decalang empower_rune_weapon 47568 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 185.75sec 0 450.42sec
Decalang Decalang flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Decalang Decalang food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Decalang Decalang frost_fever ticks -55095 3558196 7907 19.98 20019 40057 38.0 149.8 18.6% 0.0% 0.0% 0.0% 12.06sec 3558196 450.42sec
Decalang Decalang frost_strike 49143 0 0 0.00 0 0 98.7 0.0 0.0% 0.0% 0.0% 0.0% 4.50sec 0 450.42sec
Decalang Decalang frost_strike_mh 222026 10084087 22388 13.15 86123 172342 98.7 98.7 18.6% 0.0% 0.0% 0.0% 4.50sec 10084087 450.42sec
Decalang Decalang frost_strike_offhand 66196 5042532 11195 13.15 43073 86098 98.7 98.7 18.6% 0.0% 0.0% 0.0% 4.50sec 5042532 450.42sec
Decalang Decalang frostscythe 207230 5732152 12726 3.96 0 192586 29.8 29.8 100.0% 0.0% 0.0% 0.0% 15.03sec 5732152 450.42sec
Decalang Decalang glacial_advance 194913 0 0 0.00 0 0 31.9 0.0 0.0% 0.0% 0.0% 0.0% 14.29sec 0 450.42sec
Decalang Decalang glacial_advance_damage 195975 5233348 11619 4.25 138099 276264 31.9 31.9 18.7% 0.0% 0.0% 0.0% 14.29sec 5233348 450.42sec
Decalang Decalang horn_of_winter 57330 0 0 0.00 0 0 14.9 0.0 0.0% 0.0% 0.0% 0.0% 30.88sec 0 450.42sec
Decalang Decalang howling_blast 49184 4481510 9950 5.07 99180 198422 38.0 38.0 18.8% 0.0% 0.0% 0.0% 12.06sec 4481510 450.42sec
Decalang Decalang obliterate 49020 0 0 0.00 0 0 78.3 0.0 0.0% 0.0% 0.0% 0.0% 5.75sec 0 450.42sec
Decalang Decalang obliterate_mh 222024 4678384 10387 10.42 44350 110023 78.3 78.3 23.5% 0.0% 0.0% 0.0% 5.75sec 6877668 450.42sec
Decalang Decalang obliterate_offhand 66198 2337705 5190 10.42 22176 55016 78.3 78.3 23.4% 0.0% 0.0% 0.0% 5.75sec 3436648 450.42sec
Decalang Decalang pillar_of_frost 51271 0 0 0.00 0 0 8.0 0.0 0.0% 0.0% 0.0% 0.0% 60.31sec 0 450.42sec
Decalang Decalang potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Decalang Decalang razorice_oh 50401 1268524 2816 47.68 2985 5969 357.9 357.9 18.7% 0.0% 0.0% 0.0% 1.26sec 1268524 450.42sec
Decalang Decalang unholy_strength 53365 0 0 0.00 0 0 29.4 0.0 0.0% 0.0% 0.0% 0.0% 15.32sec 0 450.42sec
Ethila Ethila augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Ethila Ethila auto_attack_mh 0 4041035 8972 29.96 17301 34601 224.9 224.9 22.8% 19.0% 0.0% 0.0% 2.01sec 5940704 450.42sec
Ethila Ethila auto_attack_oh 1 2024769 4495 29.96 8671 17340 224.9 224.9 22.8% 19.0% 0.0% 0.0% 2.01sec 2976602 450.42sec
Ethila Ethila brittle 214964 4211288 9350 7.17 63740 127481 53.8 53.8 22.8% 0.0% 0.0% 0.0% 7.98sec 4211288 450.42sec
Ethila Ethila crystalline_swords 205165 5460307 12123 10.88 54457 108906 81.7 81.7 22.7% 0.0% 0.0% 0.0% 10.96sec 5460307 450.42sec
Ethila Ethila deadly_grace 188091 1715773 3809 3.07 60712 121425 23.0 23.0 22.7% 0.0% 0.0% 0.0% 3.79sec 1715773 450.42sec
Ethila Ethila empower_rune_weapon 47568 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 186.33sec 0 450.42sec
Ethila Ethila flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Ethila Ethila food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Ethila Ethila frost_fever ticks -55095 5698608 12664 19.98 30963 61924 52.9 149.8 22.8% 0.0% 0.0% 0.0% 8.63sec 5698608 450.42sec
Ethila Ethila frost_strike 49143 0 0 0.00 0 0 115.8 0.0 0.0% 0.0% 0.0% 0.0% 3.87sec 0 450.42sec
Ethila Ethila frost_strike_mh 222026 14067726 31232 15.43 98851 197779 115.8 115.8 22.8% 0.0% 0.0% 0.0% 3.87sec 14067726 450.42sec
Ethila Ethila frost_strike_offhand 66196 7737659 17179 15.43 54382 108784 115.8 115.8 22.8% 0.0% 0.0% 0.0% 3.87sec 7737659 450.42sec
Ethila Ethila howling_blast 49184 7929764 17605 7.05 121978 243647 52.9 52.9 22.8% 0.0% 0.0% 0.0% 8.63sec 7929764 450.42sec
Ethila Ethila obliterate 49020 0 0 0.00 0 0 114.8 0.0 0.0% 0.0% 0.0% 0.0% 3.92sec 0 450.42sec
Ethila Ethila obliterate_mh 222024 10335834 22947 15.29 52291 123077 114.8 114.8 53.3% 0.0% 0.0% 0.0% 3.92sec 15194655 450.42sec
Ethila Ethila obliterate_offhand 66198 5683749 12619 15.29 28758 67702 114.8 114.8 53.3% 0.0% 0.0% 0.0% 3.92sec 8355650 450.42sec
Ethila Ethila obliteration 207256 0 0 0.00 0 0 5.5 0.0 0.0% 0.0% 0.0% 0.0% 90.34sec 0 450.42sec
Ethila Ethila pillar_of_frost 51271 0 0 0.00 0 0 9.9 0.0 0.0% 0.0% 0.0% 0.0% 48.29sec 0 450.42sec
Ethila Ethila potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Ethila Ethila razorice 50401 2813519 6246 55.00 5549 11096 412.9 412.9 22.8% 0.0% 0.0% 0.0% 1.09sec 2813519 450.42sec
Ethila Ethila unholy_strength 53365 0 0 0.00 0 0 29.5 0.0 0.0% 0.0% 0.0% 0.0% 15.16sec 0 450.42sec
Yåmm Yåmm annihilation 201427 10699103 23754 7.46 122230 273770 28.0 56.0 45.4% 0.0% 0.0% 0.0% 12.51sec 10699103 450.42sec
Yåmm Yåmm augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Yåmm Yåmm auto_attack_mh 0 4278612 9499 24.28 18548 37099 182.3 182.3 45.6% 19.0% 0.0% 0.0% 2.47sec 6289965 450.42sec
Yåmm Yåmm auto_attack_oh 1 2140782 4753 24.28 9274 18548 182.3 182.3 45.6% 19.0% 0.0% 0.0% 2.47sec 3147152 450.42sec
Yåmm Yåmm chaos_strike 162794 34134691 75784 30.81 94285 211168 115.7 231.3 45.6% 0.0% 0.0% 0.0% 3.57sec 34134691 450.42sec
Yåmm Yåmm consume_magic 183752 0 0 0.00 0 0 14.0 0.0 0.0% 0.0% 0.0% 0.0% 32.85sec 0 450.42sec
Yåmm Yåmm deadly_grace 188091 2798258 6213 3.59 71325 142665 26.9 26.9 45.6% 0.0% 0.0% 0.0% 10.78sec 2798258 450.42sec
Yåmm Yåmm demons_bite 162243 5352332 11883 11.22 43646 87292 84.2 84.2 45.6% 0.0% 0.0% 0.0% 5.40sec 7868435 450.42sec
Yåmm Yåmm eye_beam ticks -198013 4082965 9073 12.38 0 43990 9.3 92.8 100.0% 0.0% 0.0% 0.0% 48.34sec 4082965 450.42sec
Yåmm Yåmm anguish 202446 1870671 4153 1.23 139220 278282 0.0 9.2 45.7% 0.0% 0.0% 0.0% 0.00sec 1870671 450.42sec
Yåmm Yåmm fel_barrage 211053 8327428 18488 8.88 85781 171583 13.4 66.6 45.6% 0.0% 0.0% 0.0% 34.46sec 8327428 450.42sec
Yåmm Yåmm fel_rush 195072 9019656 20025 6.03 136949 273897 45.2 45.2 45.6% 0.0% 0.0% 0.0% 9.92sec 9019656 450.42sec
Yåmm Yåmm flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Yåmm Yåmm food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Yåmm Yåmm fury_of_the_illidari ticks -201467 5405306 12012 7.30 33907 67765 7.9 54.8 45.6% 0.0% 0.0% 0.0% 60.77sec 5405306 450.42sec
Yåmm Yåmm rage_of_the_illidari 217070 3231315 7174 1.04 414431 0 7.8 7.8 0.0% 0.0% 0.0% 0.0% 60.77sec 3231315 450.42sec
Yåmm Yåmm metamorphosis 191427 0 0 0.00 0 0 2.3 0.0 0.0% 0.0% 0.0% 0.0% 242.81sec 0 450.42sec
Yåmm Yåmm metamorphosis_impact 200166 193184 429 0.31 57347 114759 2.3 2.3 45.6% 0.0% 0.0% 0.0% 242.81sec 193184 450.42sec
Yåmm Yåmm potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Yåmm Yåmm throw_glaive 185123 7871309 17475 6.63 108662 217328 49.8 49.7 45.6% 0.0% 0.0% 0.0% 8.92sec 11571570 450.42sec
Yåmm Yåmm bloodlet ticks -207690 15499642 34444 27.64 74759 0 0.0 207.3 0.0% 0.0% 0.0% 0.0% 0.00sec 15499642 450.42sec
Yåmm Yåmm vengeful_retreat 198793 666712 1480 3.96 15403 30806 29.7 29.7 45.6% 0.0% 0.0% 0.0% 15.41sec 980129 450.42sec
Kehål Kehål augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Kehål Kehål auto_attack_mh 0 2661284 5908 27.09 12366 24731 203.4 203.4 24.8% 19.0% 0.0% 6.1% 2.22sec 4002915 450.42sec
Kehål Kehål auto_attack_oh 1 1281669 2845 26.10 6182 12362 196.0 196.0 24.8% 19.0% 0.0% 6.1% 2.30sec 1927740 450.42sec
Kehål Kehål cleansing_flame 201408 1996608 4433 3.83 69446 0 28.8 28.8 0.0% 0.0% 0.0% 0.0% 15.67sec 1996608 450.42sec
Kehål Kehål consume_soul_lesser 203794 0 0 0.00 0 0 73.5 0.0 0.0% 0.0% 0.0% 0.0% 5.94sec 0 450.42sec
Kehål Kehål demon_spikes 203720 0 0 0.00 0 0 31.2 0.0 0.0% 0.0% 0.0% 0.0% 14.54sec 0 450.42sec
Kehål Kehål empower_wards 218256 0 0 0.00 0 0 12.6 0.0 0.0% 0.0% 0.0% 0.0% 37.08sec 0 450.42sec
Kehål Kehål fiery_brand 204021 1576828 3501 1.06 158256 316412 8.0 8.0 24.8% 0.0% 0.0% 0.0% 60.42sec 2783971 450.42sec
Kehål Kehål fiery_brand ticks -204021 1207144 2683 4.20 30702 61405 8.0 31.5 24.7% 0.0% 0.0% 0.0% 60.42sec 2783971 450.42sec
Kehål Kehål flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Kehål Kehål food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Kehål Kehål immolation_aura 178740 7494419 16639 30.94 25869 51649 33.4 232.2 24.8% 0.0% 0.0% 0.0% 13.65sec 7494419 450.42sec
Kehål Kehål infernal_strike 189110 2170340 4818 3.17 73054 145902 23.8 23.8 24.9% 0.0% 0.0% 0.0% 19.70sec 2170340 450.42sec
Kehål Kehål sigil_of_flame_dmg 204598 1215694 2699 3.16 41082 82162 0.0 23.7 24.9% 0.0% 0.0% 0.0% 0.00sec 2791877 450.42sec
Kehål Kehål sigil_of_flame_dmg ticks -204598 1576182 3503 12.16 13843 27695 0.0 91.2 24.9% 0.0% 0.0% 0.0% 0.00sec 2791877 450.42sec
Kehål Kehål potion 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Kehål Kehål shear 203782 9154445 20324 28.23 34602 69206 211.9 211.9 24.9% 0.0% 0.0% 7.5% 2.12sec 13767563 450.42sec
Kehål Kehål sigil_of_flame 204596 710573 1578 2.00 37939 75925 15.1 15.0 24.8% 0.0% 0.0% 0.0% 30.76sec 1700876 450.42sec
Kehål Kehål sigil_of_flame ticks -204596 990303 2201 7.85 13463 26933 15.1 58.9 24.9% 0.0% 0.0% 0.0% 30.76sec 1700876 450.42sec
Kehål Kehål soul_barrier 227225 10864776 24121 16.15 89624 0 21.8 121.2 0.0% 0.0% 0.0% 0.0% 20.90sec 0 450.42sec
Kehål Kehål soul_carver 207407 1777939 3947 2.12 89186 178352 8.0 15.9 25.0% 0.0% 0.0% 7.5% 60.46sec 3147491 450.42sec
Kehål Kehål soul_carver ticks -207407 1369552 3043 3.17 46124 92236 8.0 23.8 24.8% 0.0% 0.0% 0.0% 60.46sec 3147491 450.42sec
Kehål Kehål soul_cleave 228477 4683787 10399 6.62 75541 151077 49.7 49.7 24.8% 0.0% 0.0% 7.5% 8.84sec 7043642 450.42sec
Kehål Kehål soul_cleave_heal 228477 0 0 0.00 0 0 49.7 0.0 0.0% 0.0% 0.0% 0.0% 8.84sec 0 450.42sec
Kaptah Kaptah augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Kaptah Kaptah celestial_alignment 194223 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 185.18sec 0 450.42sec
Kaptah Kaptah deadly_grace 188091 1992250 4423 2.92 78909 157737 21.9 21.9 15.2% 0.0% 0.0% 0.0% 10.80sec 1992250 450.42sec
Kaptah Kaptah flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Kaptah Kaptah food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Kaptah Kaptah full_moon 202771 4864549 10800 1.29 435103 870206 10.4 9.7 15.2% 0.0% 0.0% 0.0% 44.54sec 4864549 450.42sec
Kaptah Kaptah half_moon 202768 2699244 5993 1.43 217552 435104 10.8 10.7 15.5% 0.0% 0.0% 0.0% 43.33sec 2699244 450.42sec
Kaptah Kaptah lunar_strike 194153 7752854 17212 7.48 114753 229467 56.2 56.2 20.3% 0.0% 0.0% 0.0% 7.86sec 7752854 450.42sec
Kaptah Kaptah moonfire 8921 602217 1337 2.81 24827 49638 21.1 21.1 15.2% 0.0% 0.0% 0.0% 21.94sec 4283059 450.42sec
Kaptah Kaptah moonfire ticks -8921 3680843 8180 34.19 12457 24913 21.1 256.4 15.2% 0.0% 0.0% 0.0% 21.94sec 4283059 450.42sec
Kaptah Kaptah moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Kaptah Kaptah new_moon 202767 1385387 3076 1.47 108777 217553 10.1 11.0 15.3% 0.0% 0.0% 0.0% 44.41sec 1385387 450.42sec
Kaptah Kaptah nithramus 187625 0 0 0.00 0 0 4.1 0.0 0.0% 0.0% 0.0% 0.0% 120.62sec 0 450.42sec
Kaptah Kaptah potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Kaptah Kaptah shooting_stars 202497 565912 1256 6.25 10474 20950 51.1 46.9 15.2% 0.0% 0.0% 0.0% 8.67sec 565912 450.42sec
Kaptah Kaptah solar_wrath 190984 8717203 19353 15.09 66750 133650 113.6 113.3 15.2% 0.0% 0.0% 0.0% 3.89sec 8717203 450.42sec
Kaptah Kaptah starsurge 78674 12057123 26769 8.81 158167 316298 66.3 66.1 15.3% 0.0% 0.0% 0.0% 6.74sec 12057123 450.42sec
Kaptah Kaptah stellar_flare 202347 1592881 3536 2.58 71219 142767 19.4 19.4 15.5% 0.0% 0.0% 0.0% 23.76sec 8409141 450.42sec
Kaptah Kaptah stellar_flare ticks -202347 6816260 15147 33.98 23205 46379 19.4 254.9 15.3% 0.0% 0.0% 0.0% 23.76sec 8409141 450.42sec
Kaptah Kaptah sunfire 93402 363191 806 1.72 24387 48767 12.9 12.9 15.2% 0.0% 0.0% 0.0% 36.05sec 4025278 450.42sec
Kaptah Kaptah sunfire ticks -93402 3662087 8138 34.01 12458 24918 12.9 255.1 15.2% 0.0% 0.0% 0.0% 36.05sec 4025278 450.42sec
Beckîe Beckîe a_murder_of_crows 131894 0 0 0.00 0 0 8.0 0.0 0.0% 0.0% 0.0% 0.0% 60.24sec 0 450.42sec
Beckîe Beckîe crow_peck 131900 8322772 18478 16.74 50983 102992 0.0 125.6 29.3% 0.0% 0.0% 0.0% 0.00sec 12235263 450.42sec
Beckîe Beckîe aspect_of_the_wild 193530 0 0 0.00 0 0 4.0 0.0 0.0% 0.0% 0.0% 0.0% 127.51sec 0 450.42sec
Beckîe Beckîe augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Beckîe Beckîe auto_shot 0 4705149 10446 23.51 20601 41540 176.5 176.5 28.9% 0.0% 0.0% 0.0% 2.56sec 6917015 450.42sec
Beckîe Beckîe bestial_wrath 19574 0 0 0.00 0 0 12.5 0.0 0.0% 0.0% 0.0% 0.0% 37.22sec 0 450.42sec
Beckîe Beckîe cobra_shot 193455 11199905 24865 13.46 84655 171730 101.3 101.0 30.1% 0.0% 0.0% 0.0% 4.43sec 16464922 450.42sec
Beckîe Beckîe deadly_grace 188091 2211513 4910 2.97 75488 153106 22.3 22.3 30.4% 0.0% 0.0% 0.0% 3.88sec 2211513 450.42sec
Beckîe Beckîe dire_beast 120679 0 0 0.00 0 0 47.9 0.0 0.0% 0.0% 0.0% 0.0% 9.46sec 0 450.42sec
Beckîe Beckîe_dire_beast dire_beast_melee 0 7192011 20501 41.56 22915 45938 243.0 243.0 29.0% 0.0% 0.0% 0.0% 1.85sec 10572937 350.81sec
Beckîe Beckîe_dire_beast stomp 201754 7433573 21190 8.19 120326 240993 47.9 47.9 29.0% 0.0% 0.0% 0.0% 9.46sec 10928057 350.81sec
Beckîe Beckîe flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Beckîe Beckîe food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Beckîe Beckîe kill_command 34026 0 0 0.00 0 0 66.4 0.0 0.0% 0.0% 0.0% 0.0% 6.80sec 0 450.42sec
Beckîe Beckîe_cat kill_command 83381 13560231 30106 8.84 144742 293983 66.4 66.4 39.9% 0.0% 0.0% 0.0% 6.80sec 19934824 450.42sec
Beckîe Beckîe_cat jaws_of_thunder 197162 2032281 4512 2.65 102067 0 19.9 19.9 0.0% 0.0% 0.0% 0.0% 21.87sec 2032281 450.42sec
Beckîe Beckîe_hati kill_command 83381 4167469 9252 8.84 48421 97705 66.4 66.4 29.1% 0.0% 0.0% 0.0% 6.80sec 6126575 450.42sec
Beckîe Beckîe_hati jaws_of_thunder 197162 625624 1389 2.65 31400 0 19.9 19.9 0.0% 0.0% 0.0% 0.0% 22.07sec 625624 450.42sec
Beckîe Beckîe potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Beckîe Beckîe stampede ticks -201430 3601872 8004 6.97 53806 107579 3.0 52.3 28.1% 0.0% 0.0% 0.0% 186.36sec 5295093 450.42sec
Beckîe Beckîe summon_pet 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Beckîe Beckîe_cat claw 16827 6416582 14246 20.07 30021 61555 150.6 150.6 39.9% 0.0% 0.0% 0.0% 3.00sec 9432983 450.42sec
Beckîe Beckîe_cat melee 0 6332420 14059 38.50 15528 31535 289.0 289.0 39.9% 0.0% 0.0% 0.0% 1.56sec 9309257 450.42sec
Beckîe Beckîe_hati hati_melee 0 6797663 15092 35.12 19909 40175 262.6 263.6 29.0% 0.0% 0.0% 0.0% 1.71sec 9993208 450.42sec
Rinotor Rinotor a_murder_of_crows 131894 0 0 0.00 0 0 8.0 0.0 0.0% 0.0% 0.0% 0.0% 60.45sec 0 450.42sec
Rinotor Rinotor crow_peck 131900 6600080 14653 16.68 41619 83592 0.0 125.2 26.4% 0.0% 0.0% 0.0% 0.00sec 9702743 450.42sec
Rinotor Rinotor aspect_of_the_wild 193530 0 0 0.00 0 0 4.0 0.0 0.0% 0.0% 0.0% 0.0% 127.70sec 0 450.42sec
Rinotor Rinotor augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Rinotor Rinotor auto_shot 0 3605376 8004 23.30 16347 32828 174.9 174.9 25.9% 0.0% 0.0% 0.0% 2.58sec 5300244 450.42sec
Rinotor Rinotor bestial_wrath 19574 0 0 0.00 0 0 12.4 0.0 0.0% 0.0% 0.0% 0.0% 37.76sec 0 450.42sec
Rinotor Rinotor chimaera_shot 53209 0 0 0.00 0 0 38.9 0.0 0.0% 0.0% 0.0% 0.0% 11.52sec 0 450.42sec
Rinotor Rinotor chimaera_shot_frost 171454 1028690 2284 2.58 42148 84519 0.0 19.4 25.9% 0.0% 0.0% 0.0% 0.00sec 1028690 450.42sec
Rinotor Rinotor chimaera_shot_nature 171457 1029327 2285 2.59 42148 84566 0.0 19.4 25.6% 0.0% 0.0% 0.0% 0.00sec 1029327 450.42sec
Rinotor Rinotor cobra_shot 193455 8507682 18888 12.04 74270 149146 90.6 90.4 26.5% 0.0% 0.0% 0.0% 4.96sec 12507098 450.42sec
Rinotor Rinotor dark_blast 215407 1952168 4334 1.10 187476 376520 8.3 8.3 25.9% 0.0% 0.0% 0.0% 50.28sec 1952168 450.42sec
Rinotor Rinotor deadly_grace 188091 2004641 4451 3.06 68272 137695 23.0 23.0 27.2% 0.0% 0.0% 0.0% 3.79sec 2004641 450.42sec
Rinotor Rinotor dire_beast 120679 0 0 0.00 0 0 46.3 0.0 0.0% 0.0% 0.0% 0.0% 9.80sec 0 450.42sec
Rinotor Rinotor_dire_beast dire_beast_melee 0 6022364 17332 40.60 20332 40665 235.1 235.1 26.0% 0.0% 0.0% 0.0% 1.91sec 8853445 347.47sec
Rinotor Rinotor flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Rinotor Rinotor food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Rinotor Rinotor kill_command 34026 0 0 0.00 0 0 91.0 0.0 0.0% 0.0% 0.0% 0.0% 4.95sec 0 450.42sec
Rinotor Rinotor_cat kill_command 83381 15654372 34755 12.12 124204 250245 91.0 91.0 38.0% 0.0% 0.0% 0.0% 4.95sec 23013409 450.42sec
Rinotor Rinotor_cat jaws_of_thunder 197162 782785 1738 1.21 85908 0 9.1 9.1 0.0% 0.0% 0.0% 0.0% 45.51sec 782785 450.42sec
Rinotor Rinotor potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Rinotor Rinotor summon_pet 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Rinotor Rinotor_cat claw 16827 7817903 17357 20.07 37625 76402 150.6 150.6 36.8% 0.0% 0.0% 0.0% 3.00sec 11493057 450.42sec
Rinotor Rinotor_cat melee 0 5134204 11399 38.12 13072 26306 286.1 286.1 36.8% 0.0% 0.0% 0.0% 1.57sec 7547766 450.42sec
Rinotor Rinotor_hati hati_melee 0 5081826 11282 34.78 15463 30927 260.1 261.1 25.9% 0.0% 0.0% 0.0% 1.73sec 7470766 450.42sec
Lâstykökö Lâstykökö augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Lâstykökö Lâstykökö combustion 190319 0 0 0.00 0 0 4.3 0.0 0.0% 0.0% 0.0% 0.0% 120.37sec 0 450.42sec
Lâstykökö Lâstykökö counterspell 2139 0 0 0.00 0 0 10.8 0.0 0.0% 0.0% 0.0% 0.0% 43.01sec 0 450.42sec
Lâstykökö Lâstykökö deadly_grace 188091 2809912 6238 2.92 68869 159231 21.9 21.9 65.5% 0.0% 0.0% 0.0% 7.10sec 2809912 450.42sec
Lâstykökö Lâstykökö fire_blast 108853 5117888 11362 7.50 0 90960 56.3 56.3 100.0% 0.0% 0.0% 0.0% 8.06sec 5117888 450.42sec
Lâstykökö Lâstykökö fireball 133 16389834 36388 22.98 60347 126171 172.7 172.5 52.7% 0.0% 0.0% 0.0% 2.53sec 16389834 450.42sec
Lâstykökö Lâstykökö flame_on 205029 0 0 0.00 0 0 8.2 0.0 0.0% 0.0% 0.0% 0.0% 59.08sec 0 450.42sec
Lâstykökö Lâstykökö flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Lâstykökö Lâstykökö food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Lâstykökö Lâstykökö ignite ticks -12846 14525748 32279 59.89 32340 0 351.7 449.2 0.0% 0.0% 0.0% 0.0% 1.29sec 14525748 450.42sec
Lâstykökö Lâstykökö meteor 153561 0 0 0.00 0 0 8.3 0.0 0.0% 0.0% 0.0% 0.0% 60.46sec 0 450.42sec
Lâstykökö Lâstykökö meteor_impact 153564 2525419 5607 1.11 168632 359481 8.3 8.3 70.9% 0.0% 0.0% 0.0% 58.52sec 2525419 450.42sec
Lâstykökö Lâstykökö meteor_burn ticks -155158 641250 1425 0.00 5624 13402 57.5 0.0 71.2% 0.0% 0.0% 0.0% 7.65sec 641250 450.42sec
Lâstykökö Lâstykökö phoenixs_flames 194466 2210217 4907 1.40 0 210045 10.6 10.5 100.0% 0.0% 0.0% 0.0% 46.09sec 2210217 450.42sec
Lâstykökö Lâstykökö phoenixs_flames_splash 224637 0 0 0.00 0 0 10.5 0.0 0.0% 0.0% 0.0% 0.0% 46.13sec 0 450.42sec
Lâstykökö Lâstykökö potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Lâstykökö Lâstykökö pyroblast 11366 23131261 51355 13.87 127142 292894 103.3 104.1 57.3% 0.0% 0.0% 0.0% 4.36sec 23131261 450.42sec
Lâstykökö Lâstykökö scorch 2948 1393 3 0.01 0 35272 0.0 0.0 100.0% 0.0% 0.0% 0.0% 233.19sec 1393 450.42sec
Lâstykökö Lâstykökö unstable_magic_explosion 157976 2053379 4559 5.76 47488 0 43.2 43.2 0.0% 0.0% 0.0% 0.0% 9.92sec 2053379 450.42sec
Ehöl Ehöl augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Ehöl Ehöl blackout_kick 100784 10924196 24253 10.16 112076 224109 76.3 76.3 27.8% 0.0% 0.0% 0.0% 5.78sec 16059603 450.42sec
Ehöl Ehöl chi_wave 115098 0 0 0.00 0 0 28.5 0.0 0.0% 0.0% 0.0% 0.0% 16.02sec 0 450.42sec
Ehöl Ehöl chi_wave_heal 132463 0 0 0.00 0 0 113.2 0.0 0.0% 0.0% 0.0% 0.0% 3.97sec 0 450.42sec
Ehöl Ehöl chi_wave_damage ticks -132467 4416182 9814 0.00 30533 61037 113.4 0.0 27.6% 0.0% 0.0% 0.0% 3.97sec 4416182 450.42sec
Ehöl Ehöl deadly_grace 188091 1499958 3330 3.17 49421 98851 23.8 23.8 27.6% 0.0% 0.0% 0.0% 6.31sec 1499958 450.42sec
Ehöl Ehöl energizing_elixir 115288 0 0 0.00 0 0 7.7 0.0 0.0% 0.0% 0.0% 0.0% 61.71sec 0 450.42sec
Ehöl Ehöl fists_of_fury ticks -113656 19233686 42742 13.99 143654 287388 21.1 104.9 27.6% 0.0% 0.0% 0.0% 21.66sec 28275340 450.42sec
Ehöl Ehöl flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Ehöl Ehöl food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Ehöl Ehöl melee_main_hand 0 2956059 6563 21.86 16578 33165 164.1 164.1 27.6% 19.0% 0.0% 0.0% 2.76sec 4345687 450.42sec
Ehöl Ehöl melee_off_hand 1 1471233 3266 21.73 8295 16590 163.1 163.1 27.7% 19.0% 0.0% 0.0% 2.76sec 2162851 450.42sec
Ehöl Ehöl potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Ehöl Ehöl rising_sun_kick 107428 13251329 29420 5.63 245364 491281 42.2 42.2 27.8% 0.0% 0.0% 0.0% 10.61sec 19480708 450.42sec
Ehöl Ehöl shadow_wave 215047 2698742 5992 2.52 111937 223686 18.9 18.9 27.7% 0.0% 0.0% 0.0% 21.42sec 2698742 450.42sec
Ehöl Ehöl storm_earth_and_fire 137639 0 0 0.00 0 0 7.4 0.0 0.0% 0.0% 0.0% 0.0% 62.94sec 0 450.42sec
Ehöl Ehöl strike_of_the_windlord 205320 6028090 13383 1.50 419471 841372 11.2 11.2 27.7% 0.0% 0.0% 0.0% 41.60sec 8861864 450.42sec
Ehöl Ehöl strike_of_the_windlord_offhand 205414 3012593 6688 1.50 209780 420453 0.0 11.2 27.6% 0.0% 0.0% 0.0% 0.00sec 4428797 450.42sec
Ehöl Ehöl tiger_palm 100780 3585330 7960 13.51 27698 55377 101.4 101.4 27.7% 0.0% 0.0% 0.0% 4.44sec 5270774 450.42sec
Ehöl Ehöl touch_of_death ticks -115080 4410916 9802 0.49 1209244 0 3.7 3.6 0.0% 0.0% 0.0% 0.0% 145.16sec 0 450.42sec
Ehöl Ehöl gale_burst 195403 1682102 3735 0.49 454395 0 3.7 3.7 0.0% 0.0% 0.0% 0.0% 136.38sec 1682102 450.42sec
Ehöl Ehöl whirling_dragon_punch ticks -152175 8160440 18134 8.28 102967 205925 20.7 62.1 27.7% 0.0% 0.0% 0.0% 21.83sec 11996620 450.42sec
Ehöl Ehöl_fire_spirit auto_attack_mh 0 436954 4616 26.50 9619 19235 41.8 41.8 27.7% 19.1% 0.0% 0.0% 10.08sec 642364 94.67sec
Ehöl Ehöl_fire_spirit auto_attack_oh 0 218424 2307 26.50 4809 9618 41.8 41.8 27.7% 19.1% 0.0% 0.0% 10.08sec 321104 94.67sec
Ehöl Ehöl_fire_spirit blackout_kick 100784 1005772 10624 8.60 58053 116100 13.6 13.6 27.7% 0.0% 0.0% 0.0% 31.66sec 1478580 94.67sec
Ehöl Ehöl_fire_spirit chi_wave 115098 0 0 0.00 0 0 5.8 0.0 0.0% 0.0% 0.0% 0.0% 82.82sec 0 94.67sec
Ehöl Ehöl_fire_spirit chi_wave_damage 132467 526644 5563 14.67 17802 35686 0.0 23.2 27.7% 0.0% 0.0% 0.0% 0.00sec 526644 94.67sec
Ehöl Ehöl_fire_spirit fists_of_fury ticks -113656 3046887 6771 3.96 80440 160906 6.1 29.7 27.6% 0.0% 0.0% 0.0% 77.79sec 4479213 94.67sec
Ehöl Ehöl_fire_spirit rising_sun_kick 107428 1673002 17672 6.34 131001 262110 10.0 10.0 27.7% 0.0% 0.0% 0.0% 44.33sec 2459471 94.67sec
Ehöl Ehöl_fire_spirit strike_of_the_windlord 222029 1357355 14338 3.41 197837 395631 0.0 5.4 27.6% 0.0% 0.0% 0.0% 0.00sec 1995440 94.67sec
Ehöl Ehöl_fire_spirit strike_of_the_windlord_offhand 205414 684391 7229 3.41 99757 199447 0.0 5.4 27.6% 0.0% 0.0% 0.0% 0.00sec 1006120 94.67sec
Ehöl Ehöl_fire_spirit tiger_palm 100780 372796 3938 12.69 14593 29185 20.0 20.0 27.6% 0.0% 0.0% 0.0% 21.53sec 548046 94.67sec
Ehöl Ehöl_fire_spirit whirling_dragon_punch ticks -152175 571110 1269 1.11 53517 107031 2.9 8.4 27.7% 0.0% 0.0% 0.0% 130.39sec 839586 94.67sec
Ehöl Ehöl_earth_spirit auto_attack_mh 0 436808 4614 26.50 9618 19237 41.8 41.8 27.6% 19.0% 0.0% 0.0% 10.08sec 642150 94.67sec
Ehöl Ehöl_earth_spirit auto_attack_oh 0 218607 2309 26.50 4809 9617 41.8 41.8 27.7% 19.0% 0.0% 0.0% 10.08sec 321374 94.67sec
Ehöl Ehöl_earth_spirit blackout_kick 100784 1005290 10619 8.60 58054 116096 13.6 13.6 27.6% 0.0% 0.0% 0.0% 31.66sec 1477871 94.67sec
Ehöl Ehöl_earth_spirit chi_wave 115098 0 0 0.00 0 0 5.8 0.0 0.0% 0.0% 0.0% 0.0% 82.82sec 0 94.67sec
Ehöl Ehöl_earth_spirit chi_wave_damage 132467 525865 5555 14.67 17814 35626 0.0 23.2 27.5% 0.0% 0.0% 0.0% 0.00sec 525865 94.67sec
Ehöl Ehöl_earth_spirit fists_of_fury ticks -113656 3049156 6776 3.96 80444 160883 6.1 29.7 27.7% 0.0% 0.0% 0.0% 77.79sec 4482549 94.67sec
Ehöl Ehöl_earth_spirit rising_sun_kick 107428 1673108 17673 6.34 131018 262024 10.0 10.0 27.7% 0.0% 0.0% 0.0% 44.33sec 2459627 94.67sec
Ehöl Ehöl_earth_spirit strike_of_the_windlord 222029 1356681 14331 3.41 197847 395580 0.0 5.4 27.6% 0.0% 0.0% 0.0% 0.00sec 1994450 94.67sec
Ehöl Ehöl_earth_spirit strike_of_the_windlord_offhand 205414 686647 7253 3.41 99744 199514 0.0 5.4 28.0% 0.0% 0.0% 0.0% 0.00sec 1009437 94.67sec
Ehöl Ehöl_earth_spirit tiger_palm 100780 373132 3941 12.69 14594 29178 20.0 20.0 27.7% 0.0% 0.0% 0.0% 21.53sec 548539 94.67sec
Ehöl Ehöl_earth_spirit whirling_dragon_punch ticks -152175 569944 1267 1.11 53511 107061 2.9 8.4 27.5% 0.0% 0.0% 0.0% 130.39sec 837872 94.67sec
Malikoom Malikoom blackout_kick 100784 233393 518 3.81 8999 17999 28.6 28.6 20.6% 30.0% 0.0% 0.0% 14.67sec 457993 450.42sec
Malikoom Malikoom chi_wave 115098 0 0 3.95 0 0 29.6 29.6 0.0% 100.0% 0.0% 0.0% 15.43sec 0 450.42sec
Malikoom Malikoom energizing_elixir 115288 0 0 0.00 0 0 6.7 0.0 0.0% 0.0% 0.0% 0.0% 70.60sec 0 450.42sec
Malikoom Malikoom fists_of_fury ticks -113656 813756 1808 10.27 11666 23336 15.5 77.0 20.6% 30.1% 0.0% 0.0% 29.34sec 1596856 450.42sec
Malikoom Malikoom flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Malikoom Malikoom food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Malikoom Malikoom melee_main_hand 0 16296 36 22.26 0 0 167.1 167.1 0.0% 49.1% 50.9% 0.0% 2.71sec 31978 450.42sec
Malikoom Malikoom melee_off_hand 1 8087 18 22.12 0 0 166.1 166.1 0.0% 49.0% 51.0% 0.0% 2.71sec 15869 450.42sec
Malikoom Malikoom potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Malikoom Malikoom rising_sun_kick 107428 501163 1113 3.56 20666 41278 26.7 26.7 20.7% 30.0% 0.0% 0.0% 16.68sec 983445 450.42sec
Malikoom Malikoom rushing_jade_wind ticks -116847 377786 840 35.06 1586 3171 29.5 262.9 20.6% 30.0% 0.0% 0.0% 14.92sec 741339 450.42sec
Malikoom Malikoom storm_earth_and_fire 137639 0 0 0.00 0 0 7.5 0.0 0.0% 0.0% 0.0% 0.0% 62.66sec 0 450.42sec
Malikoom Malikoom tiger_palm 100780 157354 349 9.63 2405 4810 72.3 72.3 20.6% 30.1% 0.0% 0.0% 6.24sec 308779 450.42sec
Malikoom Malikoom touch_of_death 115080 0 0 0.58 0 0 4.3 4.3 0.0% 100.0% 0.0% 0.0% 120.36sec 0 450.42sec
Malikoom Malikoom whirling_dragon_punch ticks -152175 254017 564 3.89 9597 19170 13.9 29.2 20.8% 29.9% 0.0% 0.0% 32.42sec 498465 450.42sec
Malikoom Malikoom_fire_spirit auto_attack_mh 0 2375 25 26.47 0 0 42.1 42.1 0.0% 49.1% 50.9% 0.0% 10.06sec 4660 95.39sec
Malikoom Malikoom_fire_spirit auto_attack_oh 0 1188 12 26.47 0 0 42.1 42.1 0.0% 49.0% 51.0% 0.0% 10.06sec 2332 95.39sec
Malikoom Malikoom_fire_spirit blackout_kick 100784 1783 19 3.17 0 0 5.0 5.0 0.0% 30.2% 69.8% 0.0% 68.28sec 3498 95.39sec
Malikoom Malikoom_fire_spirit chi_wave 115098 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 78.02sec 0 95.39sec
Malikoom Malikoom_fire_spirit fists_of_fury ticks -113656 9900 22 2.71 0 0 4.2 20.3 0.0% 29.9% 70.1% 0.0% 108.64sec 19428 95.39sec
Malikoom Malikoom_fire_spirit rising_sun_kick 107428 5359 56 3.94 0 0 6.3 6.3 0.0% 30.0% 70.0% 0.0% 67.88sec 10517 95.39sec
Malikoom Malikoom_fire_spirit rushing_jade_wind ticks -116847 3959 9 7.17 0 0 6.1 53.7 0.0% 30.1% 69.9% 0.0% 66.19sec 7768 95.39sec
Malikoom Malikoom_fire_spirit tiger_palm 100780 1522 16 9.83 0 0 15.6 15.6 0.0% 30.2% 69.8% 0.0% 27.95sec 2986 95.39sec
Malikoom Malikoom_fire_spirit whirling_dragon_punch ticks -152175 3228 7 1.11 0 0 2.9 8.3 0.0% 30.1% 69.9% 0.0% 134.38sec 6335 95.39sec
Malikoom Malikoom_earth_spirit auto_attack_mh 0 2376 25 26.47 0 0 42.1 42.1 0.0% 49.0% 51.0% 0.0% 10.06sec 4663 95.39sec
Malikoom Malikoom_earth_spirit auto_attack_oh 0 1189 12 26.47 0 0 42.1 42.1 0.0% 49.0% 51.0% 0.0% 10.06sec 2333 95.39sec
Malikoom Malikoom_earth_spirit blackout_kick 100784 1791 19 3.17 0 0 5.0 5.0 0.0% 29.9% 70.1% 0.0% 68.28sec 3514 95.39sec
Malikoom Malikoom_earth_spirit chi_wave 115098 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 78.02sec 0 95.39sec
Malikoom Malikoom_earth_spirit fists_of_fury ticks -113656 9896 22 2.71 0 0 4.2 20.3 0.0% 29.9% 70.1% 0.0% 108.64sec 19419 95.39sec
Malikoom Malikoom_earth_spirit rising_sun_kick 107428 5343 56 3.94 0 0 6.3 6.3 0.0% 30.2% 69.8% 0.0% 67.88sec 10484 95.39sec
Malikoom Malikoom_earth_spirit rushing_jade_wind ticks -116847 3968 9 7.17 0 0 6.1 53.7 0.0% 30.0% 70.0% 0.0% 66.19sec 7786 95.39sec
Malikoom Malikoom_earth_spirit tiger_palm 100780 1525 16 9.83 0 0 15.6 15.6 0.0% 30.0% 70.0% 0.0% 27.95sec 2993 95.39sec
Malikoom Malikoom_earth_spirit whirling_dragon_punch ticks -152175 3237 7 1.11 0 0 2.9 8.3 0.0% 30.0% 70.0% 0.0% 134.38sec 6352 95.39sec
Müjnir Müjnir blackout_kick 228649 10512355 23339 16.01 72871 145741 120.2 120.2 20.0% 0.0% 0.0% 0.0% 3.72sec 15454157 450.42sec
Müjnir Müjnir blackout_kick_totm_proc 228649 10515510 23346 16.01 72871 145741 0.0 120.2 20.1% 0.0% 0.0% 0.0% 0.00sec 15458796 450.42sec
Müjnir Müjnir chi_burst 123986 0 0 0.00 0 0 14.2 0.0 0.0% 0.0% 0.0% 0.0% 32.90sec 0 450.42sec
Müjnir Müjnir chi_burst_damage 148135 2216714 4921 1.89 130432 260864 14.2 14.2 19.9% 0.0% 0.0% 0.0% 32.90sec 2216714 450.42sec
Müjnir Müjnir chi_burst_heal 130654 0 0 0.00 0 0 14.2 0.0 0.0% 0.0% 0.0% 0.0% 32.90sec 0 450.42sec
Müjnir Müjnir deadly_grace 188091 1223499 2716 1.73 78452 156904 13.0 13.0 20.1% 0.0% 0.0% 0.0% 1.80sec 1223499 450.42sec
Müjnir Müjnir flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Müjnir Müjnir food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Müjnir Müjnir melee_main_hand 0 4671087 10371 19.24 26937 53874 144.4 144.4 20.1% 0.0% 0.0% 0.0% 3.14sec 6866941 450.42sec
Müjnir Müjnir potion 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Müjnir Müjnir pulse 215263 0 0 0.00 0 0 13.7 0.0 0.0% 0.0% 0.0% 0.0% 32.95sec 0 450.42sec
Müjnir Müjnir rising_sun_kick 107428 11242185 24959 6.37 195727 391454 47.8 47.8 20.1% 0.0% 0.0% 0.0% 9.48sec 16527077 450.42sec
Müjnir Müjnir tiger_palm 100780 4021088 8927 22.44 19875 39749 168.5 168.5 20.1% 0.0% 0.0% 0.0% 2.67sec 5911381 450.42sec
Waleràn Waleràn augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Waleràn Waleràn deadly_grace 188091 1629437 3618 2.90 66322 135203 21.7 21.7 12.5% 0.0% 0.0% 0.0% 21.91sec 1629437 450.42sec
Waleràn Waleràn dispersion 47585 0 0 0.00 0 0 4.9 0.0 0.0% 0.0% 0.0% 0.0% 92.70sec 0 450.42sec
Waleràn Waleràn flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Waleràn Waleràn food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Waleràn Waleràn mind_blast 8092 4782726 10618 7.81 72262 147356 57.6 58.6 12.5% 0.0% 0.0% 0.0% 7.74sec 4782726 450.42sec
Waleràn Waleràn mind_flay ticks -15407 5008574 11130 42.47 13918 28410 116.8 318.5 12.5% 0.0% 0.0% 0.0% 3.83sec 5008574 450.42sec
Waleràn Waleràn mindbender 200174 0 0 0.00 0 0 8.0 0.0 0.0% 0.0% 0.0% 0.0% 60.63sec 0 450.42sec
Waleràn Waleràn potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Waleràn Waleràn shadow_word_death 32379 1808607 4015 2.08 102575 209167 15.6 15.6 12.4% 0.0% 0.0% 0.0% 10.67sec 1808607 450.42sec
Waleràn Waleràn shadow_word_pain 589 150473 334 1.11 16032 32863 8.3 8.3 12.2% 0.0% 0.0% 0.0% 51.12sec 6139569 450.42sec
Waleràn Waleràn shadow_word_pain ticks -589 5989096 13309 39.35 17948 36755 8.3 295.1 12.5% 0.0% 0.0% 0.0% 51.12sec 6139569 450.42sec
Waleràn Waleràn shadowy_apparitions 78203 850331 1888 6.79 14752 30106 51.5 50.9 12.6% 0.0% 0.0% 0.0% 8.58sec 850331 450.42sec
Waleràn Waleràn vampiric_touch ticks -34914 6880452 15290 26.17 31014 63502 3.0 196.3 12.4% 0.0% 0.0% 0.0% 119.49sec 6880452 450.42sec
Waleràn Waleràn void_bolt 205448 5989021 13297 8.81 80146 163967 66.3 66.1 12.4% 0.0% 0.0% 0.0% 6.61sec 5989021 450.42sec
Waleràn Waleràn void_eruption 228360 867273 1925 3.15 32476 66161 11.9 23.6 12.5% 0.0% 0.0% 0.0% 38.61sec 867273 450.42sec
Waleràn Waleràn void_torrent ticks -205065 3160539 7023 6.36 58645 119783 7.4 47.7 12.5% 0.0% 0.0% 0.0% 63.89sec 3160539 450.42sec
Waleràn Waleràn_mindbender melee 0 3768790 32209 49.91 34417 68854 97.3 97.3 12.5% 0.0% 0.0% 0.0% 4.52sec 3768790 117.01sec
Waleràn Waleràn_mindbender shadowcrawl 63619 0 0 0.00 0 0 23.5 0.0 0.0% 0.0% 0.0% 0.0% 19.16sec 0 117.01sec
Ptitfille Ptitfille augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Ptitfille Ptitfille auto_attack_mh 0 3773572 8378 36.24 12957 25926 272.1 272.1 26.0% 19.0% 0.0% 0.0% 1.66sec 5547508 450.42sec
Ptitfille Ptitfille auto_attack_oh 1 1876442 4166 36.04 6477 12952 270.6 270.6 26.1% 19.0% 0.0% 0.0% 1.66sec 2758548 450.42sec
Ptitfille Ptitfille cleansing_flame 201408 2411913 5355 3.69 87041 0 27.7 27.7 0.0% 0.0% 0.0% 0.0% 16.24sec 2411913 450.42sec
Ptitfille Ptitfille deadly_grace 188091 2301449 5110 2.96 82096 164188 22.2 22.2 26.0% 0.0% 0.0% 0.0% 7.02sec 2301449 450.42sec
Ptitfille Ptitfille deadly_poison_dot ticks -2818 2894372 6432 19.93 15363 30732 468.1 149.4 26.1% 0.0% 0.0% 0.0% 1.10sec 2894372 450.42sec
Ptitfille Ptitfille deadly_poison_instant 113780 5646702 12537 62.22 9593 19185 467.1 467.1 26.0% 0.0% 0.0% 0.0% 1.10sec 5646702 450.42sec
Ptitfille Ptitfille envenom 32645 7504189 16660 4.07 194733 389510 30.6 30.6 26.1% 0.0% 0.0% 0.0% 14.38sec 7504189 450.42sec
Ptitfille Ptitfille exsanguinate 200806 0 0 0.00 0 0 7.5 0.0 0.0% 0.0% 0.0% 0.0% 61.82sec 0 450.42sec
Ptitfille Ptitfille flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Ptitfille Ptitfille food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Ptitfille Ptitfille garrote ticks -703 8426150 18725 32.75 27223 54447 28.8 245.6 26.0% 0.0% 0.0% 0.0% 15.95sec 8426150 450.42sec
Ptitfille Ptitfille kingsbane ticks -192759 2827019 6282 6.87 43465 86970 7.5 51.5 26.2% 0.0% 0.0% 0.0% 61.84sec 2827019 450.42sec
Ptitfille Ptitfille kingsbane_mh 222062 700771 1556 1.00 73900 147800 7.5 7.5 26.0% 0.0% 0.0% 0.0% 61.84sec 700771 450.42sec
Ptitfille Ptitfille kingsbane_oh 192760 350884 779 1.00 36950 73900 7.5 7.5 26.1% 0.0% 0.0% 0.0% 61.84sec 350884 450.42sec
Ptitfille Ptitfille maalus 187626 0 0 0.00 0 0 4.1 0.0 0.0% 0.0% 0.0% 0.0% 120.16sec 0 450.42sec
Ptitfille Ptitfille mutilate 1329 0 0 0.00 0 0 128.6 0.0 0.0% 0.0% 0.0% 0.0% 3.50sec 0 450.42sec
Ptitfille Ptitfille mutilate_mh 5374 8445751 18751 17.13 52099 104102 128.6 128.6 26.1% 0.0% 0.0% 0.0% 3.50sec 12416054 450.42sec
Ptitfille Ptitfille mutilate_oh 27576 4220822 9371 17.13 26037 52104 128.6 128.6 26.0% 0.0% 0.0% 0.0% 3.50sec 6205009 450.42sec
Ptitfille Ptitfille potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Ptitfille Ptitfille rupture ticks -1943 25301359 56225 38.12 70206 140512 27.4 285.9 26.0% 0.0% 0.0% 0.0% 16.63sec 25301359 450.42sec
Ptitfille Ptitfille vanish 1856 0 0 0.00 0 0 4.0 0.0 0.0% 0.0% 0.0% 0.0% 126.41sec 0 450.42sec
Ptitfille Ptitfille vendetta 79140 0 0 0.00 0 0 4.5 0.0 0.0% 0.0% 0.0% 0.0% 118.09sec 0 450.42sec
Mastoria Mastoria ascendance 114050 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 180.79sec 0 450.42sec
Mastoria Mastoria augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Mastoria Mastoria deadly_grace 188091 1756926 3901 3.23 60265 122940 24.3 24.3 19.3% 0.0% 0.0% 0.0% 9.03sec 1756926 450.42sec
Mastoria Mastoria earth_shock 8042 14899243 33079 5.57 273524 700301 41.8 41.8 19.3% 0.0% 0.0% 0.0% 10.66sec 14899243 450.42sec
Mastoria Mastoria elemental_mastery 16166 0 0 0.00 0 0 4.3 0.0 0.0% 0.0% 0.0% 0.0% 120.49sec 0 450.42sec
Mastoria Mastoria fire_elemental 198067 0 0 0.00 0 0 2.6 0.0 0.0% 0.0% 0.0% 0.0% 223.96sec 0 450.42sec
Mastoria Mastoria flame_shock 188389 593720 1318 1.91 31909 81726 14.3 14.3 19.0% 0.0% 0.0% 0.0% 32.34sec 7726196 450.42sec
Mastoria Mastoria flame_shock ticks -188389 7132476 15850 41.64 17588 45033 14.3 312.3 19.1% 0.0% 0.0% 0.0% 32.34sec 7726196 450.42sec
Mastoria Mastoria flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Mastoria Mastoria food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Mastoria Mastoria lava_burst 51505 18017799 40002 11.57 0 207358 87.0 86.9 100.0% 0.0% 0.0% 0.0% 5.16sec 18017799 450.42sec
Mastoria Mastoria lava_burst_overload 77451 7725583 17152 6.77 0 152036 50.9 50.8 100.0% 0.0% 0.0% 0.0% 8.78sec 7725583 450.42sec
Mastoria Mastoria lightning_bolt 188196 14315083 31782 24.22 60644 155205 181.8 181.8 19.1% 0.0% 0.0% 0.0% 2.45sec 14315083 450.42sec
Mastoria Mastoria lightning_bolt_overload 45284 9355491 20771 20.45 46884 120238 153.5 153.5 19.2% 0.0% 0.0% 0.0% 3.33sec 9355491 450.42sec
Mastoria Mastoria potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Mastoria Mastoria stormkeeper 205495 0 0 0.00 0 0 7.5 0.0 0.0% 0.0% 0.0% 0.0% 65.01sec 0 450.42sec
Mastoria Mastoria totem_mastery 210643 0 0 0.00 0 0 4.5 0.0 0.0% 0.0% 0.0% 0.0% 111.20sec 0 450.42sec
Mastoria Mastoria_primal_fire_elemental fire_blast 57984 10304590 70183 23.98 147385 294789 58.7 58.7 19.2% 0.0% 0.0% 0.0% 6.63sec 10304590 146.83sec
Mastoria Mastoria_primal_fire_elemental fire_nova 117588 832632 5671 5.21 54765 109526 12.8 12.8 19.2% 0.0% 0.0% 0.0% 32.45sec 832632 146.83sec
Mastoria Mastoria_primal_fire_elemental immolate 118297 383700 2613 3.01 43636 87280 7.4 7.4 19.3% 0.0% 0.0% 0.0% 59.41sec 1841363 146.83sec
Mastoria Mastoria_primal_fire_elemental immolate ticks -118297 1457664 3239 10.57 15430 30838 7.4 79.3 19.2% 0.0% 0.0% 0.0% 59.41sec 1841363 146.83sec
Dèmonos Dèmonos augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Dèmonos Dèmonos chaos_bolt 116858 15908604 35319 6.87 0 308446 51.8 51.6 100.0% 0.0% 0.0% 0.0% 8.57sec 15908604 450.42sec
Dèmonos Dèmonos conflagrate 17962 3872335 8597 5.65 78078 156334 42.4 42.4 17.0% 0.0% 0.0% 0.0% 10.69sec 3872335 450.42sec
Dèmonos Dèmonos deadly_grace 188091 1442307 3202 2.58 63509 127017 19.4 19.4 17.3% 0.0% 0.0% 0.0% 6.30sec 1442307 450.42sec
Dèmonos Dèmonos demonic_power 196100 5152041 11438 22.04 26622 53250 164.5 165.5 17.0% 0.0% 0.0% 0.0% 2.73sec 5152041 450.42sec
Dèmonos Dèmonos dimensional_rift 196586 0 0 0.00 0 0 19.8 0.0 0.0% 0.0% 0.0% 0.0% 23.93sec 0 450.42sec
Dèmonos Dèmonos flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Dèmonos Dèmonos food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Dèmonos Dèmonos grimoire_of_sacrifice 108503 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Dèmonos Dèmonos immolate 348 1441718 3201 3.40 45262 90761 25.5 25.5 24.7% 0.0% 0.0% 0.0% 17.90sec 6495072 450.42sec
Dèmonos Dèmonos immolate ticks -348 5053354 11230 22.04 24457 48955 25.5 165.3 24.9% 0.0% 0.0% 0.0% 17.90sec 6495072 450.42sec
Dèmonos Dèmonos incinerate 29722 14850148 32970 19.40 87197 174544 145.3 145.7 16.9% 0.0% 0.0% 0.0% 3.00sec 14850148 450.42sec
Dèmonos Dèmonos nithramus 187625 0 0 0.00 0 0 4.1 0.0 0.0% 0.0% 0.0% 0.0% 120.55sec 0 450.42sec
Dèmonos Dèmonos potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Dèmonos Dèmonos summon_doomguard 18540 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 181.78sec 0 450.42sec
Dèmonos Dèmonos summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Dèmonos Dèmonos_doomguard doom_bolt 85692 1424671 19949 21.88 46763 93533 26.1 26.0 17.0% 0.0% 0.0% 0.0% 14.64sec 1424671 71.41sec
Dèmonos Dèmonos_shadowy_tear shadow_bolt ticks -196657 2830752 6291 7.20 44998 90039 6.6 54.0 16.9% 0.0% 0.0% 0.0% 63.38sec 2830752 79.16sec
Dèmonos Dèmonos_chaos_tear chaos_bolt 215279 1801306 57445 12.36 0 278923 6.5 6.5 100.0% 0.0% 0.0% 0.0% 64.00sec 1801306 31.36sec
Dèmonos Dèmonos_chaos_portal chaos_barrage ticks -187394 2484607 5521 22.18 12812 25620 6.6 166.3 17.0% 0.0% 0.0% 0.0% 64.95sec 2484607 31.39sec
Eldiabløød Eldiabløød augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Eldiabløød Eldiabløød chaos_bolt 116858 16457660 36538 6.24 0 351121 47.1 46.9 100.0% 0.0% 0.0% 0.0% 9.37sec 16457660 450.42sec
Eldiabløød Eldiabløød conflagrate 17962 4474398 9934 5.85 83875 167947 43.9 43.9 21.4% 0.0% 0.0% 0.0% 10.23sec 4474398 450.42sec
Eldiabløød Eldiabløød deadly_grace 188091 1425812 3166 2.44 64215 128431 18.3 18.3 21.2% 0.0% 0.0% 0.0% 8.82sec 1425812 450.42sec
Eldiabløød Eldiabløød dimensional_rift 196586 0 0 0.00 0 0 19.2 0.0 0.0% 0.0% 0.0% 0.0% 24.76sec 0 450.42sec
Eldiabløød Eldiabløød flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Eldiabløød Eldiabløød food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Eldiabløød Eldiabløød immolate 348 1851274 4110 3.89 52272 104583 29.2 29.2 21.4% 0.0% 0.0% 0.0% 15.57sec 11121635 450.42sec
Eldiabløød Eldiabløød immolate ticks -348 9270361 20601 23.39 43534 87098 29.2 175.4 21.4% 0.0% 0.0% 0.0% 15.57sec 11121635 450.42sec
Eldiabløød Eldiabløød incinerate 29722 15561425 34549 17.99 94966 189870 134.6 135.0 21.4% 0.0% 0.0% 0.0% 3.22sec 15561425 450.42sec
Eldiabløød Eldiabløød life_tap 1454 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Eldiabløød Eldiabløød potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Eldiabløød Eldiabløød service_imp 111859 0 0 0.00 0 0 5.3 0.0 0.0% 0.0% 0.0% 0.0% 93.13sec 0 450.42sec
Eldiabløød Eldiabløød summon_doomguard 18540 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 184.65sec 0 450.42sec
Eldiabløød Eldiabløød summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Eldiabløød Eldiabløød_imp firebolt 3110 5289661 11744 17.64 32927 65847 133.1 132.4 21.3% 0.0% 0.0% 0.0% 3.38sec 5289661 450.42sec
Eldiabløød Eldiabløød_service_imp firebolt 3110 4696798 33983 25.31 66372 132742 58.6 58.3 21.4% 0.0% 0.0% 0.0% 7.23sec 4696798 138.21sec
Eldiabløød Eldiabløød_doomguard doom_bolt 85692 1842274 26211 24.03 53928 107838 28.3 28.2 21.4% 0.0% 0.0% 0.0% 13.45sec 1842274 70.29sec
Eldiabløød Eldiabløød_shadowy_tear shadow_bolt ticks -196657 3405578 7568 7.12 52704 105329 6.4 53.4 21.5% 0.0% 0.0% 0.0% 66.63sec 3405578 77.39sec
Eldiabløød Eldiabløød_chaos_tear chaos_bolt 215279 2063640 67591 12.39 0 327305 6.3 6.3 100.0% 0.0% 0.0% 0.0% 64.62sec 2063640 30.53sec
Eldiabløød Eldiabløød_chaos_portal chaos_barrage ticks -187394 2980756 6624 22.31 14720 29440 6.4 167.3 21.5% 0.0% 0.0% 0.0% 66.16sec 2980756 30.48sec
Elidi Elidi augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Elidi Elidi auto_attack_mh 0 8173368 18146 21.14 41324 82412 158.7 158.7 24.8% 0.0% 0.0% 0.0% 2.86sec 12015625 450.42sec
Elidi Elidi battle_cry 1719 0 0 0.00 0 0 8.0 0.0 0.0% 0.0% 0.0% 0.0% 60.32sec 0 450.42sec
Elidi Elidi bladestorm 227847 0 0 0.00 0 0 5.1 0.0 0.0% 0.0% 0.0% 0.0% 97.43sec 0 450.42sec
Elidi Elidi bladestorm_mh 50622 1867103 4145 2.31 73269 164288 0.0 17.4 37.6% 0.0% 0.0% 0.0% 0.00sec 2744818 450.42sec
Elidi Elidi charge 100 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Elidi Elidi colossus_smash 167105 7388643 16404 6.64 118854 236493 49.9 49.9 24.9% 0.0% 0.0% 0.0% 8.98sec 10862006 450.42sec
Elidi Elidi deadly_grace 188091 1234111 2740 1.82 66851 133701 13.7 13.7 34.9% 0.0% 0.0% 0.0% 1.71sec 1234111 450.42sec
Elidi Elidi execute 163201 12899894 28640 3.89 286188 628961 29.2 29.2 45.3% 0.0% 0.0% 0.0% 2.94sec 18964065 450.42sec
Elidi Elidi flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Elidi Elidi food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Elidi Elidi heroic_leap 6544 389594 865 1.88 20694 40951 14.1 14.1 34.1% 0.0% 0.0% 0.0% 32.88sec 572739 450.42sec
Elidi Elidi mortal_strike 12294 20875184 46346 10.76 169373 387656 80.7 80.7 40.8% 0.0% 0.0% 0.0% 4.44sec 30688499 450.42sec
Elidi Elidi nitro_boosts 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Elidi Elidi opportunity_strikes 203178 7854806 17439 13.10 64014 127074 98.4 98.4 25.1% 0.0% 0.0% 0.0% 4.32sec 11547310 450.42sec
Elidi Elidi potion 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Elidi Elidi slam 1464 17807769 39536 18.80 101417 201023 141.1 141.1 24.9% 0.0% 0.0% 0.0% 2.51sec 26179107 450.42sec
Elidi Elidi trauma ticks -215537 4503312 10007 23.68 19659 42491 0.0 177.6 25.0% 0.0% 0.0% 0.0% 0.00sec 4503312 450.42sec
Elidi Elidi warbreaker 209577 2010245 4463 1.01 196255 386307 7.6 7.6 36.7% 0.0% 0.0% 0.0% 63.01sec 2010245 450.42sec
Zuan Zuan augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Zuan Zuan auto_attack_mh 0 8021418 17809 18.61 47256 98156 139.7 139.7 20.0% 0.0% 0.0% 0.0% 3.25sec 11792245 450.42sec
Zuan Zuan avatar 107574 0 0 0.00 0 0 5.5 0.0 0.0% 0.0% 0.0% 0.0% 90.36sec 0 450.42sec
Zuan Zuan battle_cry 1719 0 0 0.00 0 0 8.0 0.0 0.0% 0.0% 0.0% 0.0% 60.39sec 0 450.42sec
Zuan Zuan bladestorm 227847 0 0 0.00 0 0 4.9 0.0 0.0% 0.0% 0.0% 0.0% 99.35sec 0 450.42sec
Zuan Zuan bladestorm_mh 50622 1626006 3610 2.20 85858 167477 0.0 16.5 15.2% 0.0% 0.0% 0.0% 0.00sec 2390383 450.42sec
Zuan Zuan charge 100 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Zuan Zuan colossus_smash 167105 8922028 19808 6.44 153666 315347 48.3 48.3 19.2% 0.0% 0.0% 0.0% 9.32sec 13116227 450.42sec
Zuan Zuan corrupted_blood_of_zakajz ticks -209569 8653094 19229 6.16 187344 0 0.0 46.2 0.0% 0.0% 0.0% 0.0% 0.00sec 8653094 450.42sec
Zuan Zuan deadly_grace 188091 2267221 5034 2.92 78638 160647 21.9 21.9 30.4% 0.0% 0.0% 0.0% 20.38sec 2267221 450.42sec
Zuan Zuan execute 163201 13495920 29963 3.68 350395 785309 27.6 27.6 31.7% 0.0% 0.0% 0.0% 3.12sec 19840280 450.42sec
Zuan Zuan flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Zuan Zuan food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Zuan Zuan heroic_leap 6544 324916 721 1.30 25287 53293 9.7 9.7 28.9% 0.0% 0.0% 0.0% 48.53sec 477657 450.42sec
Zuan Zuan mortal_strike 12294 27797174 61714 13.06 195879 468939 98.0 98.0 32.1% 0.0% 0.0% 0.0% 3.64sec 40864479 450.42sec
Zuan Zuan opportunity_strikes 203178 7839889 17406 11.84 73388 148100 88.9 88.9 19.8% 0.0% 0.0% 0.0% 4.75sec 11525380 450.42sec
Zuan Zuan potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Zuan Zuan slam 1464 13437731 29834 12.87 115855 239014 96.6 96.6 18.9% 0.0% 0.0% 0.0% 3.65sec 19754738 450.42sec
Zuan Zuan trauma ticks -215537 3267453 7261 21.84 15926 36903 0.0 163.8 19.2% 0.0% 0.0% 0.0% 0.00sec 3267453 450.42sec
Zuan Zuan warbreaker 209577 2827748 6278 1.02 232068 463643 7.6 7.6 59.4% 0.0% 0.0% 0.0% 62.23sec 2827748 450.42sec
Ulthuan Ulthuan augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Ulthuan Ulthuan auto_attack_mh 0 9466753 21018 26.06 40044 83924 195.7 195.7 25.4% 7.0% 0.0% 0.0% 2.31sec 13917023 450.42sec
Ulthuan Ulthuan auto_attack_oh 1 4734752 10512 26.06 20022 41954 195.7 195.7 25.4% 7.0% 0.0% 0.0% 2.31sec 6960534 450.42sec
Ulthuan Ulthuan avatar 107574 0 0 0.00 0 0 4.4 0.0 0.0% 0.0% 0.0% 0.0% 118.32sec 0 450.42sec
Ulthuan Ulthuan battle_cry 1719 0 0 0.00 0 0 7.8 0.0 0.0% 0.0% 0.0% 0.0% 61.68sec 0 450.42sec
Ulthuan Ulthuan bloodthirst 23881 11452057 25425 13.37 83419 168565 100.4 100.4 36.0% 0.0% 0.0% 0.0% 4.49sec 16835608 450.42sec
Ulthuan Ulthuan charge 100 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Ulthuan Ulthuan deadly_grace 188091 3032688 6733 2.95 95360 208930 22.2 22.2 36.5% 0.0% 0.0% 0.0% 19.96sec 3032688 450.42sec
Ulthuan Ulthuan execute 5308 3927179 8719 2.75 140213 286191 20.7 20.7 34.2% 0.0% 0.0% 0.0% 4.47sec 5773325 450.42sec
Ulthuan Ulthuan execute_offhand 163558 1964767 4362 2.75 70174 142836 0.0 20.7 34.3% 0.0% 0.0% 0.0% 0.00sec 2888393 450.42sec
Ulthuan Ulthuan flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Ulthuan Ulthuan food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Ulthuan Ulthuan furious_slash 100130 2458819 5459 5.92 43948 95910 44.4 44.4 21.9% 0.0% 0.0% 0.0% 8.99sec 3614696 450.42sec
Ulthuan Ulthuan heroic_leap 6544 192803 428 1.39 15125 30937 10.4 10.4 21.4% 0.0% 0.0% 0.0% 45.37sec 283438 450.42sec
Ulthuan Ulthuan odyns_fury 205545 0 0 0.00 0 0 8.1 0.0 0.0% 0.0% 0.0% 0.0% 60.89sec 0 450.42sec
Ulthuan Ulthuan odyns_fury_mh 205546 2166465 4810 1.08 115777 272684 0.0 8.1 97.2% 0.0% 0.0% 0.0% 0.00sec 5302407 450.42sec
Ulthuan Ulthuan odyns_fury_mh ticks -205546 3135942 6969 4.26 43209 101499 0.0 31.9 94.4% 0.0% 0.0% 0.0% 0.00sec 5302407 450.42sec
Ulthuan Ulthuan odyns_fury_oh 205547 1083177 2405 1.08 57801 136351 0.0 8.1 97.2% 0.0% 0.0% 0.0% 0.00sec 1083177 450.42sec
Ulthuan Ulthuan potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Ulthuan Ulthuan raging_blow 85288 0 0 0.00 0 0 101.8 0.0 0.0% 0.0% 0.0% 0.0% 4.42sec 0 450.42sec
Ulthuan Ulthuan raging_blow_oh 85384 9126708 20263 13.56 68638 153299 0.0 101.8 24.8% 0.0% 0.0% 0.0% 0.00sec 13417126 450.42sec
Ulthuan Ulthuan raging_blow_mh 96103 18260337 40541 13.56 137230 306837 0.0 101.8 24.8% 0.0% 0.0% 0.0% 0.00sec 26844425 450.42sec
Ulthuan Ulthuan rampage 184367 0 0 0.00 0 0 39.3 0.0 0.0% 0.0% 0.0% 0.0% 9.99sec 0 450.42sec
Ulthuan Ulthuan rampage1 218617 912273 2025 5.24 17167 39355 0.0 39.3 27.2% 0.0% 0.0% 0.0% 0.00sec 1341128 450.42sec
Ulthuan Ulthuan rampage2 184707 1736113 3854 5.24 32661 71264 0.0 39.3 29.8% 0.0% 0.0% 0.0% 0.00sec 2552250 450.42sec
Ulthuan Ulthuan rampage3 184709 2317406 5145 5.23 43712 95239 0.0 39.3 29.6% 0.0% 0.0% 0.0% 0.00sec 3406806 450.42sec
Ulthuan Ulthuan rampage4 201364 3307116 7342 5.23 65536 139067 0.0 39.3 25.3% 0.0% 0.0% 0.0% 0.00sec 4861774 450.42sec
Ulthuan Ulthuan rampage5 201363 3849363 8546 5.23 76342 162050 0.0 39.3 25.2% 0.0% 0.0% 0.0% 0.00sec 5658929 450.42sec
Ylvi Ylvi auto_attack_mh 0 43367 96 26.38 0 0 198.1 198.1 0.0% 42.0% 58.0% 13.0% 2.28sec 91244 450.42sec
Ylvi Ylvi battle_cry 1719 0 0 0.00 0 0 7.8 0.0 0.0% 0.0% 0.0% 0.0% 61.76sec 0 450.42sec
Ylvi Ylvi deep_wounds ticks -115767 1654244 3676 19.70 8617 17651 157.5 147.8 28.5% 0.0% 0.0% 0.0% 2.86sec 1654244 450.42sec
Ylvi Ylvi demoralizing_shout 1160 0 0 0.30 0 0 5.4 2.3 0.0% 100.0% 0.0% 0.0% 91.08sec 0 450.42sec
Ylvi Ylvi devastate 20243 1798375 3993 30.39 10401 21377 228.1 228.1 16.9% 42.0% 0.0% 13.0% 1.97sec 3783981 450.42sec
Ylvi Ylvi fel_burn ticks -184256 213244 474 32.91 669 1345 28.9 246.8 28.8% 0.0% 0.0% 0.0% 15.86sec 213244 450.42sec
Ylvi Ylvi flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Ylvi Ylvi focused_rage 204488 0 0 0.00 0 0 36.3 0.0 0.0% 0.0% 0.0% 0.0% 12.45sec 0 450.42sec
Ylvi Ylvi food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Ylvi Ylvi ignore_pain 190456 1779789 3951 4.66 50864 0 70.0 35.0 0.0% 0.0% 0.0% 0.0% 12.88sec 0 450.42sec
Ylvi Ylvi intercept 198304 0 0 1.25 0 0 22.4 9.3 0.0% 100.0% 0.0% 0.0% 20.61sec 0 450.42sec
Ylvi Ylvi last_stand 12975 0 0 0.00 0 0 4.9 0.0 0.0% 0.0% 0.0% 0.0% 97.09sec 0 450.42sec
Ylvi Ylvi potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.42sec
Ylvi Ylvi revenge 6572 493969 1097 5.80 14795 30539 43.5 43.5 17.5% 41.8% 0.0% 13.1% 10.29sec 1039776 450.42sec
Ylvi Ylvi shield_block 2565 0 0 0.00 0 0 39.9 0.0 0.0% 0.0% 0.0% 0.0% 11.66sec 0 450.42sec
Ylvi Ylvi shield_block_heavy_repercussions 2565 0 0 3.41 0 0 61.1 25.6 0.0% 100.0% 0.0% 0.0% 7.44sec 0 450.42sec
Ylvi Ylvi shield_slam 23922 1775258 3941 8.62 35246 72976 64.7 64.7 18.6% 42.1% 0.0% 13.0% 7.02sec 3734375 450.42sec
Ylvi Ylvi shield_wall 871 0 0 0.00 0 0 2.2 0.0 0.0% 0.0% 0.0% 0.0% 246.58sec 0 450.42sec

Fluffy_Pillow : 216901 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
216901.3 216901.3 63.7 / 0.029% 12831.2 / 5.9% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 84.52% 5.4 100.0% 100%

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% B% Up%
Fluffy_Pillow 216901
melee_main_hand_Kehål 42549 19.6% 223.7 2.00sec 85693 42847 Direct 181.5 144460 0 105608 0.0% 26.9% 0.0%  

Stats details: melee_main_hand_Kehål

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 223.72 181.53 0.00 0.00 2.0000 0.0000 19171061.86 35145259.23 45.45 42846.78 42846.78
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 132.71 73.11% 144460.13 1 203415 144475.30 133612 155772 19171062 35145259 45.45
parry 30.50 16.80% 0.00 0 0 0.00 0 0 0 0 0.00
dodge 18.32 10.09% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: melee_main_hand_Kehål

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Kehål
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:238283.10
  • base_dd_max:291234.90
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
melee_main_hand_Wadzak 65456 30.2% 223.7 2.00sec 131789 65895 Direct 217.4 159231 0 135596 0.0% 14.8% 0.0%  

Stats details: melee_main_hand_Wadzak

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 223.72 217.44 0.00 0.00 2.0000 0.0000 29483514.63 49023916.11 39.86 65894.81 65894.81
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 185.16 85.16% 159231.03 3 176348 159241.28 155719 162322 29483515 49023916 39.86
parry 32.28 14.84% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: melee_main_hand_Wadzak

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Wadzak
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:238283.10
  • base_dd_max:291234.90
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
melee_main_hand_Ylvi 51262 23.6% 223.7 2.00sec 103270 51635 Direct 218.2 111700 0 105871 0.0% 5.2% 70.8%  

Stats details: melee_main_hand_Ylvi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 223.72 218.22 0.00 0.00 2.0000 0.0000 23103338.26 54763710.68 57.81 51635.30 51635.30
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 52.37 24.00% 169040.19 2 202277 168994.43 152139 183265 8852483 13863096 36.16
hit (blocked) 86.19 39.50% 115434.43 7 141594 115410.70 104818 124432 9949197 22821164 56.41
hit (crit blocked) 68.27 31.29% 63006.36 3 80911 62996.01 53565 70438 4301659 18079451 76.21
parry 11.39 5.22% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: melee_main_hand_Ylvi

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Ylvi
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:238283.10
  • base_dd_max:291234.90
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
melee_nuke_Kehål 4829 2.2% 15.7 29.15sec 138479 69242 Direct 12.9 168495 0 168495 0.0% 0.0% 0.0%  

Stats details: melee_nuke_Kehål

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.71 12.91 0.00 0.00 2.0000 0.0000 2175431.90 4041505.88 46.17 69241.58 69241.58
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.91 100.00% 168495.02 1 240398 168599.50 120806 204716 2175432 4041506 46.14
 
 

Action details: melee_nuke_Kehål

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:27.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Kehål
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:281607.30
  • base_dd_max:344186.70
 
melee_nuke_Wadzak 6011 2.8% 15.7 29.15sec 172537 86271 Direct 15.4 175711 0 175711 0.0% 0.0% 0.0%  

Stats details: melee_nuke_Wadzak

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.71 15.43 0.00 0.00 2.0000 0.0000 2710465.01 4831276.65 43.90 86271.09 86271.09
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.43 100.00% 175710.97 1 208411 175601.88 159236 196905 2710465 4831277 43.93
 
 

Action details: melee_nuke_Wadzak

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:27.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Wadzak
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:281607.30
  • base_dd_max:344186.70
 
melee_nuke_Ylvi 4663 2.1% 15.7 29.15sec 133723 66713 Direct 15.6 134322 0 134322 0.0% 0.0% 79.3%  

Stats details: melee_nuke_Ylvi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.71 15.64 0.00 0.00 2.0045 0.0000 2100711.74 4894157.15 57.08 66712.56 66712.56
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.23 20.66% 209353.14 4497 239053 205123.76 0 239006 676481 1010816 32.41
hit (blocked) 6.92 44.22% 142296.78 23 167338 142158.10 44158 165995 984130 2164330 54.57
hit (crit blocked) 5.49 35.12% 80136.87 5 95621 80005.23 0 95577 440100 1719011 74.31
 
 

Action details: melee_nuke_Ylvi

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:27.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Ylvi
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:281607.30
  • base_dd_max:344186.70
 
spell_dot_Kehål 7698 3.6% 11.4 41.08sec 304600 304609 Periodic 81.1 42776 0 42776 0.0% 0.0% 0.0% 49.3%

Stats details: spell_dot_Kehål

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.39 0.00 111.07 81.10 1.0000 2.0000 3469194.57 4880121.17 28.91 14855.77 304609.23
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 81.1 100.00% 42775.73 6 53737 42787.05 38987 48124 3469195 4880121 28.89
 
 

Action details: spell_dot_Kehål

Static Values
  • id:0
  • school:fire
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:40.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Kehål
  • harmful:true
  • if_expr:
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:60172.50
  • dot_duration:20.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
spell_dot_Wadzak 13381 6.2% 11.4 41.08sec 529073 529089 Periodic 105.9 56878 0 56878 0.0% 0.0% 0.0% 49.3%

Stats details: spell_dot_Wadzak

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.39 0.00 111.07 105.94 1.0000 2.0000 6025795.71 6374913.81 5.48 25803.64 529089.10
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 105.9 100.00% 56877.63 11 57232 56879.91 55971 57232 6025796 6374914 5.47
 
 

Action details: spell_dot_Wadzak

Static Values
  • id:0
  • school:fire
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:40.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Wadzak
  • harmful:true
  • if_expr:
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:60172.50
  • dot_duration:20.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
spell_dot_Ylvi 12666 5.8% 11.4 41.08sec 500894 498676 Periodic 108.4 52616 0 52616 0.0% 0.0% 0.0% 49.3%

Stats details: spell_dot_Ylvi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.39 0.00 111.07 108.42 1.0045 2.0000 5704851.16 6524229.99 12.56 24423.86 498675.80
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 108.4 100.00% 52616.05 84 58308 52607.05 48673 56705 5704851 6524230 12.57
 
 

Action details: spell_dot_Ylvi

Static Values
  • id:0
  • school:fire
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:40.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Ylvi
  • harmful:true
  • if_expr:!ticking
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:60172.50
  • dot_duration:20.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
spell_nuke_Kehål 1769 0.8% 12.5 37.10sec 63542 31771 Direct 10.5 75753 0 75753 0.0% 0.0% 0.0%  

Stats details: spell_nuke_Kehål

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.51 10.49 0.00 0.00 2.0000 0.0000 794787.44 1389141.22 42.79 31771.16 31771.16
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.49 100.00% 75753.03 20 130040 75932.07 56608 95498 794787 1389141 42.65
 
 

Action details: spell_nuke_Kehål

Static Values
  • id:0
  • school:fire
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:35.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Kehål
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:119141.55
  • base_dd_max:145617.45
 
spell_nuke_Wadzak 3385 1.6% 12.5 37.10sec 121905 60953 Direct 12.3 123632 0 123632 0.0% 0.0% 0.0%  

Stats details: spell_nuke_Wadzak

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.51 12.33 0.00 0.00 2.0000 0.0000 1524804.04 1632692.99 6.61 60953.15 60953.15
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.33 100.00% 123632.07 15 138500 123621.50 106369 133746 1524804 1632693 6.62
 
 

Action details: spell_nuke_Wadzak

Static Values
  • id:0
  • school:fire
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:35.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Wadzak
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:119141.55
  • base_dd_max:145617.45
 
spell_nuke_Ylvi 3231 1.5% 12.5 37.10sec 116271 58006 Direct 12.5 116478 0 116478 0.0% 0.0% 0.0%  

Stats details: spell_nuke_Ylvi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.51 12.49 0.00 0.00 2.0045 0.0000 1454330.13 1653286.70 12.03 58006.15 58006.15
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.49 100.00% 116477.60 322 141103 116535.30 92707 133445 1454330 1653287 11.99
 
 

Action details: spell_nuke_Ylvi

Static Values
  • id:0
  • school:fire
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:35.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Ylvi
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:119141.55
  • base_dd_max:145617.45
 
Simple Action Stats Execute Interval
Fluffy_Pillow

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 1.0 0.0 0.0sec 0.0sec 10.27% 10.33% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (0 - 10)_1:10.27%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 1.0 0.0 0.0sec 0.0sec 10.40% 10.46% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (10 - 20)_1:10.40%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 10.66% 10.72% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (20 - 30)_1:10.66%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 10.73% 10.79% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (30 - 40)_1:10.73%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 10.44% 10.50% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (40 - 50)_1:10.44%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 10.90% 10.96% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (50 - 60)_1:10.90%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 10.51% 10.57% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (60 - 70)_1:10.51%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 10.97% 11.04% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (70 - 80)_1:10.97%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 9.71% 9.77% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (80 - 90)_1:9.71%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 5.42% 5.42% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (90 - 100)_1:5.42%

Trigger Attempt Success

  • trigger_pct:100.00%
Anguish 9.3 83.5 48.3sec 4.4sec 7.48% 7.50% 0.0(0.0) 9.2

Buff details

  • buff initial source:Yåmm
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:0.38%
  • anguish_2:0.38%
  • anguish_3:0.38%
  • anguish_4:0.38%
  • anguish_5:0.37%
  • anguish_6:0.37%
  • anguish_7:0.37%
  • anguish_8:0.37%
  • anguish_9:0.37%
  • anguish_10:4.10%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Blood of the Assassinated 8.6 1.0 50.5sec 44.5sec 20.55% 15.89% 1.0(1.0) 8.4

Buff details

  • buff initial source:Ptitfille
  • cooldown name:buff_blood_of_the_assassinated
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:35.00%
  • default_value:1.00

Stack Uptimes

  • blood_of_the_assassinated_1:20.55%

Trigger Attempt Success

  • trigger_pct:35.09%

Spelldata details

  • id:192925
  • name:Blood of the Assassinated
  • tooltip:Damage taken from Rupture increased by $s1%.
  • description:{$@spelldesc192923=Rupture has a chance to infect your target, increasing damage dealt by your Rupture by $192925s1% for {$192925d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
colossus_smash 18.4 39.0 24.7sec 7.9sec 68.84% 72.68% 39.0(39.0) 17.8

Buff details

  • buff initial source:Elidi
  • cooldown name:buff_colossus_smash
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • colossus_smash_1:68.84%

Trigger Attempt Success

  • trigger_pct:100.00%
colossus_smash 19.5 36.5 23.1sec 8.2sec 67.93% 70.03% 36.5(36.5) 18.8

Buff details

  • buff initial source:Zuan
  • cooldown name:buff_colossus_smash
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • colossus_smash_1:67.93%

Trigger Attempt Success

  • trigger_pct:100.00%
Demoralizing Shout (_debuff) 5.4 0.0 91.1sec 91.1sec 9.46% 9.80% 0.0(0.0) 5.3

Buff details

  • buff initial source:Ylvi
  • cooldown name:buff_demoralizing_shout_debuff
  • max_stacks:1
  • duration:8.00
  • cooldown:90.00
  • default_chance:101.00%
  • default_value:-0.20

Stack Uptimes

  • demoralizing_shout_debuff_1:9.46%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1160
  • name:Demoralizing Shout
  • tooltip:{$?s199023=false}[Demoralized, dealing $s1% less damage.][Demoralized, dealing $s1% less damage to the shouting Warrior.]
  • description:{$?s199023=false}[Demoralizes all enemies within $A2 yards, reducing the damage they do by $s1% for {$d=8 seconds}.][Demoralizes all enemies within $A2 yards, reducing the damage they do to you by $s1% for {$d=8 seconds}.]{$?s202743=false}[ |cFFFFFFFFGenerates ${$m5/10} Rage.|r][]
  • max_stacks:0
  • duration:8.00
  • cooldown:90.00
  • default_chance:101.00%
Eradication 25.6 21.2 17.3sec 9.4sec 53.36% 53.36% 21.2(21.2) 25.1

Buff details

  • buff initial source:Eldiabløød
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:53.36%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 29.4 22.2 15.2sec 8.6sec 58.47% 58.47% 22.2(22.2) 28.8

Buff details

  • buff initial source:Dèmonos
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:58.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Fel Burn 28.9 281.0 15.9sec 1.5sec 94.58% 90.66% 0.0(0.0) 27.9

Buff details

  • buff initial source:Ylvi
  • cooldown name:buff_fel_burn
  • max_stacks:30
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • fel_burn_1:9.10%
  • fel_burn_2:9.31%
  • fel_burn_3:9.34%
  • fel_burn_4:9.19%
  • fel_burn_5:9.18%
  • fel_burn_6:9.05%
  • fel_burn_7:8.78%
  • fel_burn_8:8.24%
  • fel_burn_9:7.23%
  • fel_burn_10:5.82%
  • fel_burn_11:4.15%
  • fel_burn_12:2.61%
  • fel_burn_13:1.43%
  • fel_burn_14:0.68%
  • fel_burn_15:0.29%
  • fel_burn_16:0.11%
  • fel_burn_17:0.04%
  • fel_burn_18:0.01%
  • fel_burn_19:0.00%
  • fel_burn_20:0.00%
  • fel_burn_21:0.00%
  • fel_burn_22:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:184256
  • name:Fel Burn
  • tooltip:Burning for $w1 Fire damage every $t1 sec. Successive attacks add stacks but do not refresh duration.
  • description:{$@spelldesc184257=Your attacks cause the target to burn for $184256o1 Fire damage over {$184256d=15 seconds}. Successive attacks do not refresh Fel Burn's duration, but instead add an additional stack of Fel Burn.}
  • max_stacks:30
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Kingsbane 7.5 125.6 62.0sec 3.1sec 32.53% 84.03% 0.0(0.0) 7.1

Buff details

  • buff initial source:Ptitfille
  • cooldown name:buff_kingsbane
  • max_stacks:99
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15

Stack Uptimes

  • kingsbane_1:1.53%
  • kingsbane_2:1.91%
  • kingsbane_3:1.70%
  • kingsbane_4:1.52%
  • kingsbane_5:1.41%
  • kingsbane_6:1.33%
  • kingsbane_7:1.27%
  • kingsbane_8:1.20%
  • kingsbane_9:1.15%
  • kingsbane_10:1.14%
  • kingsbane_11:1.19%
  • kingsbane_12:1.27%
  • kingsbane_13:1.45%
  • kingsbane_14:1.63%
  • kingsbane_15:1.80%
  • kingsbane_16:1.91%
  • kingsbane_17:1.91%
  • kingsbane_18:1.79%
  • kingsbane_19:1.54%
  • kingsbane_20:1.27%
  • kingsbane_21:0.94%
  • kingsbane_22:0.65%
  • kingsbane_23:0.42%
  • kingsbane_24:0.27%
  • kingsbane_25:0.16%
  • kingsbane_26:0.08%
  • kingsbane_27:0.04%
  • kingsbane_28:0.02%
  • kingsbane_29:0.01%
  • kingsbane_30:0.00%
  • kingsbane_31:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:192853
  • name:Kingsbane
  • tooltip:Kingsbane Damage increased by $s1%.
  • description:{$@spelldesc192759=Releases lethal poison within |cFFFFCC99The Kingslayers|r and injects it into your target, dealing ${$222062sw1+$192760sw1} Nature damage instantly and an additional $o4 Nature damage over {$d=14 seconds}. Each time you apply a Lethal Poison to a target affected by Kingsbane, Kingsbane damage increases by $192853s1%.}
  • max_stacks:99
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Razorice 52.1 305.9 8.7sec 1.3sec 86.48% 63.07% 99.1(99.1) 0.0

Buff details

  • buff initial source:Decalang
  • cooldown name:buff_razorice
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • razorice_1:14.55%
  • razorice_2:16.21%
  • razorice_3:14.07%
  • razorice_4:14.48%
  • razorice_5:27.18%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:51714
  • name:Razorice
  • tooltip:Frost damage taken from the Death Knight's abilities increased by $s1%.
  • description:{$@spelldesc53343=Affixes your weapon with a rune that causes $50401s1% extra weapon damage as Frost damage and increases enemies' vulnerability to your Frost attacks by $51714s1%, stacking up to {$51714u=5} times. Modifying your rune weapon requires a Rune Forge in Ebon Hold.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Razorice 1.0 411.9 0.1sec 1.1sec 99.96% 99.13% 407.9(407.9) 0.0

Buff details

  • buff initial source:Ethila
  • cooldown name:buff_razorice
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • razorice_1:0.22%
  • razorice_2:0.14%
  • razorice_3:0.23%
  • razorice_4:0.15%
  • razorice_5:99.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:51714
  • name:Razorice
  • tooltip:Frost damage taken from the Death Knight's abilities increased by $s1%.
  • description:{$@spelldesc53343=Affixes your weapon with a rune that causes $50401s1% extra weapon damage as Frost damage and increases enemies' vulnerability to your Frost attacks by $51714s1%, stacking up to {$51714u=5} times. Modifying your rune weapon requires a Rune Forge in Ebon Hold.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Roaring Blaze 14.4 29.5 32.1sec 10.2sec 71.56% 63.45% 0.0(0.0) 0.0

Buff details

  • buff initial source:Eldiabløød
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:4.16%
  • roaring_blaze_2:32.61%
  • roaring_blaze_3:33.48%
  • roaring_blaze_4:1.31%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Vendetta 4.5 0.0 118.0sec 118.1sec 19.73% 16.75% 0.0(0.0) 4.2

Buff details

  • buff initial source:Ptitfille
  • cooldown name:buff_vendetta
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30

Stack Uptimes

  • vendetta_1:19.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:79140
  • name:Vendetta
  • tooltip:Marked for death, increasing damage taken from the Rogue's attacks, and always visible to the Rogue.
  • description:Marks an enemy for death for {$d=20 seconds}, increasing the damage your abilities and auto attacks deal to the target by $s1%, and making the target visible to you even through concealments such as stealth and invisibility.
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
Constant Buffs
bleeding

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:93.39%
Mortal Wounds

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25

Stack Uptimes

  • mortal_wounds_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource RPS-Gain RPS-Loss
Health 0.00 2923788.22
Combat End Resource Mean Min Max
Health 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Deaths

death count 14246
death count pct 142.36
avg death time 449.55
min death time 350.15
max death time 555.44
dmg taken 1317057626.39

Statistics & Data Analysis

Fight Length
Sample Data Fluffy_Pillow Fight Length
Count 9999
Mean 450.42
Minimum 350.15
Maximum 555.44
Spread ( max - min ) 205.29
Range [ ( max - min ) / 2 * 100% ] 22.79%
DPS
Sample Data Fluffy_Pillow Damage Per Second
Count 9999
Mean 216901.30
Minimum 202896.30
Maximum 229934.47
Spread ( max - min ) 27038.18
Range [ ( max - min ) / 2 * 100% ] 6.23%
Standard Deviation 3252.0747
5th Percentile 211477.96
95th Percentile 222111.36
( 95th Percentile - 5th Percentile ) 10633.40
Mean Distribution
Standard Deviation 32.5224
95.00% Confidence Intervall ( 216837.56 - 216965.04 )
Normalized 95.00% Confidence Intervall ( 99.97% - 100.03% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 8
0.1% Error 863
0.1 Scale Factor Error with Delta=300 90282
0.05 Scale Factor Error with Delta=300 361130
0.01 Scale Factor Error with Delta=300 9028273
Priority Target DPS
Sample Data Fluffy_Pillow Priority Target Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
DPS(e)
Sample Data Fluffy_Pillow Damage Per Second (Effective)
Count 9999
Mean 216901.30
Minimum 202896.30
Maximum 229934.47
Spread ( max - min ) 27038.18
Range [ ( max - min ) / 2 * 100% ] 6.23%
Damage
Sample Data Fluffy_Pillow Damage
Count 9999
Mean 97718286.45
Minimum 74334974.06
Maximum 122887098.34
Spread ( max - min ) 48552124.28
Range [ ( max - min ) / 2 * 100% ] 24.84%
DTPS
Sample Data Fluffy_Pillow Damage Taken Per Second
Count 9999
Mean 2927601.39
Minimum 2814846.25
Maximum 3044148.62
Spread ( max - min ) 229302.37
Range [ ( max - min ) / 2 * 100% ] 3.92%
Standard Deviation 36026.1739
5th Percentile 2871769.04
95th Percentile 2988624.03
( 95th Percentile - 5th Percentile ) 116854.99
Mean Distribution
Standard Deviation 360.2798
95.00% Confidence Intervall ( 2926895.26 - 2928307.53 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 5
0.1% Error 581
0.1 Scale Factor Error with Delta=300 11079494
0.05 Scale Factor Error with Delta=300 44317978
0.01 Scale Factor Error with Delta=300 1107949459
HPS
Sample Data Fluffy_Pillow Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Fluffy_Pillow Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Fluffy_Pillow Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Fluffy_Pillow Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Fluffy_Pillow Theck-Meloree Index
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Fluffy_PillowTheck-Meloree Index (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Fluffy_Pillow Max Spike Value
Count 1247
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats
Default action list Executed every time the actor is available.
# count action,conditions
1 1.00 auto_attack,damage=264759.004,attack_speed=2,aoe_tanks=1
2 11.42 spell_dot,damage=60172.501,tick_time=2,dot_duration=20,cooldown=40,aoe_tanks=1,if=!ticking
3 12.56 spell_nuke,damage=132379.502,cooldown=35,attack_speed=2,aoe_tanks=1
4 15.77 melee_nuke,damage=312897.004,cooldown=27,attack_speed=2,aoe_tanks=1

Sample Sequence

1234432432434243243243423424342342343244

Sample Sequence Table

time name target resources buffs
0:00.000 auto_attack_tanks Ylvi 1305938438.9/1306070908: 100% health
0:02.000 spell_dot_Ylvi Ylvi 1297996157.0/1306070908: 99% health razorice(2), razorice(3), vendetta, colossus_smash, colossus_smash, fel_burn(3)
0:03.005 spell_nuke_Ylvi Ylvi 1291698791.8/1306070908: 99% health razorice(3), razorice(4), vendetta, colossus_smash, colossus_smash, fel_burn(5)
0:05.011 melee_nuke_Ylvi Ylvi 1279631073.1/1306070908: 98% health razorice(5), razorice(5), vendetta, roaring_blaze(2), colossus_smash, colossus_smash, fel_burn(8)
0:07.014 Waiting 27.000 sec 1267031413.5/1306070908: 97% health razorice(5), razorice(5), vendetta, roaring_blaze(2), colossus_smash, colossus_smash, fel_burn(10), demoralizing_shout_debuff
0:34.014 melee_nuke_Ylvi Ylvi 1143919572.1/1306070908: 88% health Health Decade (80 - 90), razorice(4), razorice(5), eradication, fel_burn(5)
0:36.019 Waiting 4.000 sec 1139628544.6/1306070908: 87% health Health Decade (80 - 90), razorice(5), razorice(5), roaring_blaze, eradication, fel_burn(6)
0:40.019 spell_nuke_Ylvi Ylvi 1125895365.2/1306070908: 86% health Health Decade (80 - 90), razorice(2), razorice(5), eradication, roaring_blaze(2), eradication, fel_burn(9)
0:42.022 Waiting 1.000 sec 1119503395.8/1306070908: 86% health Health Decade (80 - 90), razorice(5), razorice(5), eradication, roaring_blaze(2), eradication, colossus_smash, fel_burn(9)
0:43.022 spell_dot_Ylvi Ylvi 1118341124.3/1306070908: 86% health Health Decade (80 - 90), razorice(5), razorice(5), eradication, roaring_blaze(2), eradication, colossus_smash, fel_burn(9)
0:44.027 Waiting 19.000 sec 1114624917.5/1306070908: 85% health Health Decade (80 - 90), razorice(5), razorice(5), eradication, roaring_blaze(2), eradication, colossus_smash, fel_burn(9)
1:03.027 melee_nuke_Ylvi Ylvi 1065756620.9/1306070908: 82% health Health Decade (80 - 90), razorice, razorice(5), eradication, eradication, colossus_smash, colossus_smash, fel_burn
1:05.031 Waiting 12.000 sec 1060217352.1/1306070908: 81% health Health Decade (80 - 90), razorice, razorice(5), kingsbane(2), eradication, eradication, colossus_smash, colossus_smash, fel_burn(2)
1:17.031 spell_nuke_Ylvi Ylvi 1019142345.6/1306070908: 78% health Health Decade (70 - 80), razorice, razorice(5), kingsbane(17), eradication, roaring_blaze(2), eradication, colossus_smash, fel_burn(9)
1:19.035 Waiting 5.000 sec 1013167949.6/1306070908: 78% health Health Decade (70 - 80), razorice(3), razorice(5), kingsbane(20), eradication, roaring_blaze(3), eradication, colossus_smash, fel_burn
1:24.035 spell_dot_Ylvi Ylvi 999157689.9/1306070908: 77% health Health Decade (70 - 80), razorice(3), razorice(5), kingsbane(20), blood_of_the_assassinated, roaring_blaze(3), colossus_smash, colossus_smash, fel_burn(5)
1:25.040 Waiting 7.000 sec 997246549.5/1306070908: 76% health Health Decade (70 - 80), razorice(4), razorice(5), blood_of_the_assassinated, roaring_blaze(3), colossus_smash, colossus_smash, fel_burn(7)
1:32.040 melee_nuke_Ylvi Ylvi 981217895.4/1306070908: 75% health Health Decade (70 - 80), razorice, razorice(5), blood_of_the_assassinated, eradication, colossus_smash, fel_burn(10)
1:34.044 Waiting 20.000 sec 977854601.7/1306070908: 75% health Health Decade (70 - 80), razorice(3), razorice(5), blood_of_the_assassinated, eradication, colossus_smash, fel_burn(2)
1:54.044 spell_nuke_Ylvi Ylvi 927952274.4/1306070908: 71% health Health Decade (70 - 80), razorice(5), razorice(5), roaring_blaze(3), colossus_smash, colossus_smash, fel_burn(3)
1:56.050 Waiting 5.000 sec 923365826.1/1306070908: 71% health Health Decade (70 - 80), razorice(5), razorice(5), roaring_blaze(3), colossus_smash, colossus_smash, fel_burn(3)
2:01.050 melee_nuke_Ylvi Ylvi 912165743.5/1306070908: 70% health Health Decade (60 - 70), razorice(2), razorice(5), vendetta, eradication, eradication, colossus_smash, colossus_smash, fel_burn(7), anguish(10)
2:03.053 Waiting 2.000 sec 906192874.2/1306070908: 69% health Health Decade (60 - 70), razorice(4), razorice(5), vendetta, eradication, colossus_smash, fel_burn(8)
2:05.053 spell_dot_Ylvi Ylvi 897854404.2/1306070908: 69% health Health Decade (60 - 70), razorice(5), vendetta, eradication, colossus_smash, colossus_smash, fel_burn(2)
2:06.057 Waiting 24.000 sec 894484602.8/1306070908: 68% health Health Decade (60 - 70), razorice(5), vendetta, eradication, colossus_smash, colossus_smash, fel_burn(2)
2:30.057 melee_nuke_Ylvi Ylvi 817933688.1/1306070908: 63% health Health Decade (60 - 70), razorice(5), eradication, roaring_blaze(3), eradication, colossus_smash, colossus_smash, fel_burn(5)
2:32.060 spell_nuke_Ylvi Ylvi 813975404.3/1306070908: 62% health Health Decade (60 - 70), razorice(5), eradication, roaring_blaze(3), colossus_smash, colossus_smash, fel_burn(7)
2:34.064 Waiting 12.000 sec 808510778.0/1306070908: 62% health Health Decade (60 - 70), razorice, razorice(5), eradication, colossus_smash, colossus_smash, fel_burn(9)
2:46.064 spell_dot_Ylvi Ylvi 779883307.7/1306070908: 60% health Health Decade (50 - 60), razorice(2), razorice(5), roaring_blaze(2), eradication, colossus_smash, colossus_smash, fel_burn(9), anguish(2)
2:47.068 Waiting 12.000 sec 777983416.2/1306070908: 60% health Health Decade (50 - 60), razorice(3), razorice(5), roaring_blaze(2), eradication, colossus_smash, colossus_smash, fel_burn(10), anguish(7)
2:59.068 melee_nuke_Ylvi Ylvi 750753195.7/1306070908: 57% health Health Decade (50 - 60), razorice(5), blood_of_the_assassinated, roaring_blaze(3), colossus_smash, fel_burn(4)
3:01.073 Waiting 8.000 sec 745722933.6/1306070908: 57% health Health Decade (50 - 60), razorice, razorice(5), eradication, roaring_blaze(3), colossus_smash, fel_burn(6)
3:09.073 spell_nuke_Ylvi Ylvi 724052407.0/1306070908: 55% health Health Decade (50 - 60), razorice, razorice(5), eradication, colossus_smash, demoralizing_shout_debuff
3:11.077 Waiting 16.000 sec 716741579.0/1306070908: 55% health Health Decade (50 - 60), razorice(4), razorice(5), eradication, colossus_smash, colossus_smash, fel_burn(2), demoralizing_shout_debuff
3:27.077 spell_dot_Ylvi Ylvi 670838373.6/1306070908: 51% health Health Decade (50 - 60), razorice(2), razorice(5), roaring_blaze(2), colossus_smash
3:28.079 melee_nuke_Ylvi Ylvi 666736298.1/1306070908: 51% health Health Decade (50 - 60), razorice(3), razorice(5), roaring_blaze(3), colossus_smash
3:30.084 Waiting 16.000 sec 661269662.0/1306070908: 51% health Health Decade (50 - 60), razorice(5), razorice(5), eradication, roaring_blaze(3), eradication, colossus_smash, fel_burn(2)
3:46.084 spell_nuke_Ylvi Ylvi 624456049.2/1306070908: 48% health Health Decade (40 - 50), razorice(2), razorice(5), eradication, fel_burn(2)
3:48.088 Waiting 9.000 sec 620500441.8/1306070908: 48% health Health Decade (40 - 50), razorice(2), razorice(5), roaring_blaze(2), eradication, colossus_smash, fel_burn(3)
3:57.088 melee_nuke_Ylvi Ylvi 600053099.9/1306070908: 46% health Health Decade (40 - 50), razorice(5), razorice(5), eradication, roaring_blaze(2), eradication, colossus_smash, fel_burn(11)
3:59.091 Waiting 9.000 sec 595022633.9/1306070908: 46% health Health Decade (40 - 50), razorice(2), razorice(5), eradication, roaring_blaze(2), eradication, colossus_smash, colossus_smash, fel_burn
4:08.091 spell_dot_Ylvi Ylvi 565603638.6/1306070908: 43% health Health Decade (40 - 50), razorice(2), razorice(5), vendetta, kingsbane(3), eradication, roaring_blaze(3), colossus_smash, colossus_smash, fel_burn(6)
4:09.095 Waiting 14.000 sec 561671356.8/1306070908: 43% health Health Decade (40 - 50), razorice(2), razorice(5), vendetta, kingsbane(4), eradication, roaring_blaze(3), colossus_smash, colossus_smash, fel_burn(7)
4:23.095 spell_nuke_Ylvi Ylvi 515566701.2/1306070908: 39% health Health Decade (30 - 40), razorice(5), razorice(5), kingsbane(15), blood_of_the_assassinated, roaring_blaze(2), colossus_smash, colossus_smash, fel_burn(8), anguish(10)
4:25.099 Waiting 1.000 sec 509362270.6/1306070908: 39% health Health Decade (30 - 40), razorice, razorice(5), blood_of_the_assassinated, roaring_blaze(2), colossus_smash, colossus_smash, fel_burn(10)
4:26.099 melee_nuke_Ylvi Ylvi 505820296.7/1306070908: 39% health Health Decade (30 - 40), razorice(2), razorice(5), blood_of_the_assassinated, eradication, roaring_blaze(2), colossus_smash, colossus_smash, fel_burn(10)
4:28.103 Waiting 21.000 sec 499158985.4/1306070908: 38% health Health Decade (30 - 40), razorice(4), razorice(5), blood_of_the_assassinated, eradication, roaring_blaze(2), eradication, colossus_smash, colossus_smash, fel_burn(12)
4:49.103 spell_dot_Ylvi Ylvi 445257958.0/1306070908: 34% health Health Decade (30 - 40), razorice(3), razorice(5), eradication, colossus_smash, fel_burn(3)
4:50.108 Waiting 5.000 sec 440291161.3/1306070908: 34% health Health Decade (30 - 40), razorice(3), razorice(5), kingsbane(2), eradication, colossus_smash, fel_burn(4)
4:55.108 melee_nuke_Ylvi Ylvi 429165654.0/1306070908: 33% health Health Decade (30 - 40), razorice(3), razorice(5), kingsbane(8), roaring_blaze(2), eradication, colossus_smash, fel_burn(8)
4:57.113 Waiting 3.000 sec 423183960.0/1306070908: 32% health Health Decade (30 - 40), razorice(5), razorice(5), kingsbane(10), roaring_blaze(2), eradication, colossus_smash, fel_burn(10)
5:00.113 spell_nuke_Ylvi Ylvi 416226900.8/1306070908: 32% health Health Decade (30 - 40), razorice(5), kingsbane(14), eradication, roaring_blaze(2), eradication, colossus_smash, colossus_smash, fel_burn(12)
5:02.116 Waiting 22.000 sec 411274363.7/1306070908: 31% health Health Decade (30 - 40), razorice, razorice(5), kingsbane(16), eradication, roaring_blaze(2), eradication, colossus_smash, colossus_smash, fel_burn
5:24.116 melee_nuke_Ylvi Ylvi 350492368.6/1306070908: 27% health Health Decade (20 - 30), razorice(5), razorice(5), roaring_blaze, eradication, colossus_smash, colossus_smash, fel_burn(6)
5:26.119 Waiting 4.000 sec 346016457.9/1306070908: 26% health Health Decade (20 - 30), razorice(5), razorice(5), eradication, roaring_blaze(2), eradication, colossus_smash, fel_burn(8)
5:30.119 spell_dot_Ylvi Ylvi 336569733.7/1306070908: 26% health Health Decade (20 - 30), razorice(2), razorice(5), eradication, roaring_blaze(2), colossus_smash, fel_burn(11)
5:31.123 Waiting 6.000 sec 334084782.3/1306070908: 26% health Health Decade (20 - 30), razorice(2), razorice(5), eradication, roaring_blaze(2), colossus_smash, colossus_smash, fel_burn(11)
5:37.123 spell_nuke_Ylvi Ylvi 318213818.2/1306070908: 24% health Health Decade (20 - 30), razorice(2), razorice(5), eradication, roaring_blaze(3), eradication, colossus_smash, fel_burn(3)
5:39.127 Waiting 14.000 sec 314001324.0/1306070908: 24% health Health Decade (20 - 30), razorice(3), razorice(5), eradication, roaring_blaze(3), eradication, colossus_smash, colossus_smash, fel_burn(5)
5:53.127 melee_nuke_Ylvi Ylvi 279903073.5/1306070908: 21% health Health Decade (20 - 30), razorice(5), razorice(5), blood_of_the_assassinated, eradication, eradication, colossus_smash, fel_burn(2), anguish(10)
5:55.133 Waiting 16.000 sec 275106521.0/1306070908: 21% health Health Decade (20 - 30), razorice(5), blood_of_the_assassinated, eradication, roaring_blaze, eradication, colossus_smash, fel_burn(3)
6:11.133 spell_dot_Ylvi Ylvi 220601142.2/1306070908: 17% health Health Decade (10 - 20), razorice(5), razorice(5), vendetta, kingsbane(10), blood_of_the_assassinated, eradication, roaring_blaze(3), colossus_smash, colossus_smash, fel_burn(4), demoralizing_shout_debuff
6:12.136 Waiting 2.000 sec 216250770.0/1306070908: 17% health Health Decade (10 - 20), razorice(5), vendetta, kingsbane(11), blood_of_the_assassinated, eradication, roaring_blaze(3), colossus_smash, colossus_smash, fel_burn(4), demoralizing_shout_debuff
6:14.136 spell_nuke_Ylvi Ylvi 208037448.9/1306070908: 16% health Health Decade (10 - 20), razorice, razorice(5), vendetta, kingsbane(12), roaring_blaze(3), colossus_smash, colossus_smash, fel_burn(7), demoralizing_shout_debuff
6:16.141 Waiting 6.000 sec 199797773.4/1306070908: 15% health Health Decade (10 - 20), razorice(2), razorice(5), vendetta, kingsbane(15), eradication, roaring_blaze(3), colossus_smash, colossus_smash, fel_burn(9), demoralizing_shout_debuff
6:22.141 melee_nuke_Ylvi Ylvi 178303555.3/1306070908: 14% health Health Decade (10 - 20), razorice, razorice(5), kingsbane(18), blood_of_the_assassinated, eradication, eradication, colossus_smash, colossus_smash, fel_burn
6:24.146 Waiting 27.000 sec 172353202.5/1306070908: 13% health Health Decade (10 - 20), razorice(3), razorice(5), kingsbane(18), blood_of_the_assassinated, eradication, eradication, colossus_smash, colossus_smash, fel_burn
6:51.146 spell_nuke_Ylvi Ylvi 103377897.5/1306070908: 8% health Health Decade (0 - 10), razorice(2), razorice(5), eradication, colossus_smash, colossus_smash, fel_burn(12)
6:53.150 spell_dot_Ylvi Ylvi 98470704.0/1306070908: 8% health Health Decade (0 - 10), razorice(4), razorice(5), colossus_smash, colossus_smash, fel_burn
6:54.154 melee_nuke_Ylvi Ylvi 94183350.2/1306070908: 7% health Health Decade (0 - 10), razorice(4), razorice(5), eradication, colossus_smash, colossus_smash, fel_burn
6:56.158 Waiting 27.000 sec 89336543.8/1306070908: 7% health Health Decade (0 - 10), razorice, razorice(5), eradication, colossus_smash, colossus_smash, fel_burn(2)
7:23.158 melee_nuke_Ylvi Ylvi 12442993.3/1306070908: 1% health Health Decade (0 - 10), razorice(5), razorice(5), blood_of_the_assassinated, eradication, roaring_blaze(3), colossus_smash, colossus_smash
7:25.163 Waiting 3.000 sec 6643609.6/1306070908: 1% health Health Decade (0 - 10), razorice(5), razorice(5), blood_of_the_assassinated, eradication, colossus_smash, colossus_smash, fel_burn, anguish(8)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 1580537211 0
Melee Crit 0.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste INF% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 0 3474 3474
Tank-Miss 0.00% 3.00% 0
Tank-Dodge 0.00% 3.00% 0
Tank-Parry 0.00% 3.00% 0
Tank-Block 0.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
level=113
race=humanoid
role=tank
position=front
spec=unknown

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.
actions=auto_attack,damage=264759.004,attack_speed=2,aoe_tanks=1
actions+=/spell_dot,damage=60172.501,tick_time=2,dot_duration=20,cooldown=40,aoe_tanks=1,if=!ticking
actions+=/spell_nuke,damage=132379.502,cooldown=35,attack_speed=2,aoe_tanks=1
actions+=/melee_nuke,damage=312897.004,cooldown=27,attack_speed=2,aoe_tanks=1


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Max Spike Damage Frequency

This is roughly how many spikes as large as MSD Mean you take per iteration. Calculated from TMI and MSD values.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 450.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.